Identification
NameFilgrastim
Accession NumberDB00099  (BTD00072, BIOD00072, DB09560)
TypeBiotech
GroupsApproved
Description

Filgrastim is a recombinant, non-pegylated human granulocyte colony stimulating factor (G-CSF) analogue manufactured by recombinant DNA technology using a strain of E. coli. It is marketed as the brand name Neupogen by Amgen. Chemically, it consists of 175 amino acid residues. The protein has an amino acid sequence that is identical to the natural sequence predicted from human DNA sequence analysis, except for the addition of an N-terminal methionine necessary for expression in E coli. Tbo-filgrastim, which is marketed by Sicor Biotech and FDA approved on August 29, 2012, contains the same active ingredient as Neupogen and is biologically similar, but it is formulated to be short-acting. On March 6, 2015, the FDA approved the biosimilar Zarxio (filgrastim-sndz) and is indicated for use in the same conditions as Neupogen. Zarxio is marketed by Sandoz.

Protein structureDb00099
Related Articles
Protein chemical formulaC845H1343N223O243S9
Protein average weight18800.0 Da
Sequences
>Amino acid sequence for filgrastim
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWA
PLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQ
QMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Download FASTA Format
Synonyms
Filgrastim-sndz
G-CSF
Granulocyte Colony Stimulating Factor
Tbo-filgrastim
External IDs Not Available
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
BiograstimInjection, solution48 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution30 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution48 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution30 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution30 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution30 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution48 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution48 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution30 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
BiograstimInjection, solution48 MIUIntravenous; SubcutaneousAb Z Pharma Gmb H2008-09-15Not applicableEu
GrastofilInjection, solution30000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousApotex Europe Bv2013-10-18Not applicableEu
GrastofilInjection, solution30000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousApotex Europe Bv2013-10-18Not applicableEu
GrastofilSolution300 mcgIntravenous; SubcutaneousApotex Corporation2016-03-17Not applicableCanada
GrastofilInjection, solution48000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousApotex Europe Bv2013-10-18Not applicableEu
GrastofilSolution480 mcgIntravenous; SubcutaneousApotex Corporation2016-11-28Not applicableCanada
GrastofilInjection, solution48000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousApotex Europe Bv2013-10-18Not applicableEu
NeupogenInjection, solution300 ug/mLIntravenousPhysicians Total Care, Inc.1994-06-08Not applicableUs
NeupogenInjection, solution480 ug/.8mLIntravenous; SubcutaneousAmgen2000-10-02Not applicableUs
NeupogenSolution300 mcgIntravenous; SubcutaneousAmgen1992-12-31Not applicableCanada
NeupogenInjection, solution300 ug/.5mLIntravenous; SubcutaneousAmgen2000-10-02Not applicableUs
NeupogenInjection, solution480 ug/.8mLIntravenousPhysicians Total Care, Inc.2006-08-14Not applicableUs
NeupogenInjection, solution300 ug/mLIntravenous; SubcutaneousAmgen1997-05-19Not applicableUs
NeupogenSolution600 mcgIntravenous; SubcutaneousAmgen2016-01-28Not applicableCanada
NeupogenInjection, solution300 ug/.5mLIntravenousPhysicians Total Care, Inc.2004-03-11Not applicableUs
NeupogenInjection, solution480 ug/1.6mLIntravenous; SubcutaneousAmgen1997-04-07Not applicableUs
NeupogenSolution600 mcgIntravenous; SubcutaneousAmgen2016-02-02Not applicableCanada
NivestimInjection, solution12000000 [units of filgrastim]/0.2mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution12000000 [units of filgrastim]/0.2mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution30000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution12000000 [units of filgrastim]/0.2mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution48000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution30000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution12000000 [units of filgrastim]/0.2mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution30000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution48000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution48000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution30000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
NivestimInjection, solution48000000 [units of filgrastim]/0.5mLIntravenous; SubcutaneousHospira, Inc.2010-06-08Not applicableEu
RatiograstimInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
RatiograstimInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Filgrastim RatiopharmInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
Filgrastim RatiopharmInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
Filgrastim RatiopharmInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
Filgrastim RatiopharmInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
Filgrastim RatiopharmInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
Filgrastim RatiopharmInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
Filgrastim RatiopharmInjection, solution30 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
Filgrastim RatiopharmInjection, solution48 MIUIntravenous; SubcutaneousRatiopharm Inc2008-09-15Not applicableEu
International Brands
NameCompany
BiocilinNot Available
BiofigranNot Available
BiofilgranNot Available
EndufilNot Available
FilatilNot Available
FilgenNot Available
GranNot Available
GranulokineNot Available
GrimatinNot Available
InmunefNot Available
JiexinNot Available
LeucogenNot Available
LeucostimNot Available
MacroleucoNot Available
NeukineNot Available
NeutromaxNot Available
Neutroval Sicor Biotech
NivestimNot Available
RecombicyteNot Available
SciLocyteNot Available
TevagastrimNot Available
White-C Not Available
ZarzioNot Available
Brand mixturesNot Available
Categories
UNIIPVI5M0M1GW
CAS number121181-53-1
Pharmacology
Indication

Filgrastim is used in patients with acute myeloid leukemia receiving induction or consolidation chemotherapy. It is also used in cancer patients receiving bone marrow transplant. In general, filgrastim increases neutrophil counts in order to decrease the risk of infection or duration of neutropenia in the aforementioned patient populations. Infection and neutropenia are adverse events associated with chemotherapy. Furthermore, filgrastim is also indicated for patients with severe chronic neutropenia. It mobilizes hematopoietic progenitor cells into the peripheral blood for collection by leukapheresis to allow for a more rapid engraftment. Tbo-filgrastim has a narrower indication profile than Neupogen - it is a leukocyte growth factor indicated for the reduction in the duration of severe neutropenia in patients with non-myeloid malignancies.

Structured Indications
Pharmacodynamics

Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Filgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment, and end cell functional activation. When tbo-filgrastim is administered to cancer patients, it took 3-5 days to reach maximum absolute neutrophil count (ANC). Levels of neutrophils returned to baseline by 21 days following completion of chemotherapy. In the healthy volunteer trials, doubling the tbo-filgrastim subcutaneous dose from 5 to 10 mcg/kg resulted in a 16-19% increase in the ANCmax and a 33-36% increase in the area under the effect curve for ANC.

Mechanism of action

Filgrastim binds to the G-CSF receptor and stimulates the production of neutrophils in the bone marrow. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Filgrastim also stimulates the release of neutrophils from bone marrow storage pools and reduces their maturation time. Filgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, Filgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase

TargetKindPharmacological actionActionsOrganismUniProt ID
Granulocyte colony-stimulating factor receptorProteinyes
stimulator
HumanQ99062 details
Neutrophil elastaseProteinunknown
other/unknown
HumanP08246 details
Related Articles
Absorption

Absorption and clearance of Neupogen follows first-order pharmacokinetic modeling without apparent concentration dependence. When 3.45 mcg/kg and 11.5 mcg/kg of Neupogen is subcutaneously administered, the maximum serum concentration is 4 and 49 ng/mL‚ respectively‚ within 2 to 8 hours. Neupogen does not accumulate. It is estimated that when filgrastim is subcutaneously administered, the absolute bioavailability is approximately 62% and 71% for 375 mcg and 750 mcg doses respectively. When 5 mcg/kg tbo-filgrastim is subcutaneously administered, the absolute bioavailability is 33%. It takes 4-6 hours for tho-filgrastim to reach maximum concentration. Like Neupogen, accumulation was not observed.

Volume of distribution

Vd, healthy subjects and cancer patients = 150 mL/kg

Protein bindingNot Available
MetabolismNot Available
Route of elimination

Filgrastim is primarily eliminated by the kidney and neutrophils/neutrophil precursors; the latter presumably involves binding of the growth factor to the G-CSF receptor on the cell surface, internalization of the growth factor-receptor complexes via endocytosis, and subsequent degradation inside the cells.

Half life

Elimination half-life, healthy subjects and cancer patients, Neopogen = 3.5 hours; Elimination half-life, cancer patients, tbo-filgrastim = 3.2-3.8 hours

Clearance

0.5 - 0.7 mL/minute/kg (SC administration of 3.45 mcg/kg and 11.5 mcg/kg in both normal subjects and cancer patients, Neupogen)

ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
BleomycinThe risk or severity of adverse effects can be increased when Filgrastim is combined with Bleomycin.Approved
CyclophosphamideThe risk or severity of adverse effects can be increased when Filgrastim is combined with Cyclophosphamide.Approved, Investigational
TopotecanThe risk or severity of adverse effects can be increased when Filgrastim is combined with Topotecan.Approved, Investigational
Food InteractionsNot Available
References
Synthesis Reference

Tetsuro Kuga, Hiromasa Miyaji, Moriyuki Sato, Masami Okabe, Makoto Morimoto, Seiga Itoh, Motoo Yamasaki, Yoshiharu Yokoo, Kazuo Yamaguchi, Hajime Yoshida, Yoshinori Komatsu, "Method of producing a polypeptide having human granulocyte colony stimulating factor activity." U.S. Patent US5994518, issued February, 1988.

US5994518
General References
  1. Wang B, Ludden TM, Cheung EN, Schwab GG, Roskos LK: Population pharmacokinetic-pharmacodynamic modeling of filgrastim (r-metHuG-CSF) in healthy volunteers. J Pharmacokinet Pharmacodyn. 2001 Aug;28(4):321-42. [PubMed:11677930 ]
External Links
ATC CodesL03AA02 — Filgrastim
AHFS Codes
  • 20:16.00
PDB Entries
FDA labelDownload (769 KB)
MSDSDownload (125 KB)
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentAutologous Transplant / Malignant Lymphoma, Stem Cell Type1
0CompletedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
0CompletedTreatmentPeripheral Vascular Disease (PVD)1
0CompletedTreatmentPrecursor Cell Lymphoblastic Leukemia-Lymphoma1
0TerminatedTreatmentMultiple Myeloma (MM)1
0WithdrawnTreatmentMultiple Myeloma (MM) / Myeloma-Multiple1
1Active Not RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
1Active Not RecruitingTreatmentCancer, Ovarian / Peritoneal Cavity Cancer1
1Active Not RecruitingTreatmentEndometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Mixed Adenocarcinoma / Endometrial Serous Adenocarcinoma / Endometrial Squamous Cell Carcinoma / Endometrial Undifferentiated Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer1
1Active Not RecruitingTreatmentMalignant Lymphomas1
1Active Not RecruitingTreatmentMetastatic Cancers / Pancreatic Cancer Metastatic1
1Active Not RecruitingTreatmentPlasma Cell Myeloma1
1CompletedNot AvailableHealthy Volunteers1
1CompletedOtherHealthy Volunteers2
1CompletedSupportive CareCancers1
1CompletedSupportive CareChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1CompletedSupportive CareChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Precancerous/Nonmalignant Condition1
1CompletedTreatmentAcute Myelogenous Leukaemia (AML) / Leukemias1
1CompletedTreatmentAdult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Myelomonocytic Leukemia (M4) / Adult Acute Promyelocytic Leukemia (M3) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Recurrent Adult Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia1
1CompletedTreatmentAdvanced Cancers1
1CompletedTreatmentBladder Cancers / Cancer, Breast / Cancer, Ovarian / Carcinoma of Unknown Primary / Esophageal Cancers / Head and Neck Carcinoma / Lung Cancers / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Prostate / Malignant Neoplasm of Stomach / Melanoma (Skin) / Sarcomas1
1CompletedTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter2
1CompletedTreatmentBrain and Central Nervous System Tumors1
1CompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas / Neuroblastomas / Retinoblastoma1
1CompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas / Unspecified Childhood Solid Tumor, Protocol Specific1
1CompletedTreatmentBrenner Tumor / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Carcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Ovarian Undifferentiated Adenocarcinoma / Stage III Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
1CompletedTreatmentCancer, Breast4
1CompletedTreatmentCancer, Breast / Neutropenias1
1CompletedTreatmentCancer, Ovarian1
1CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cavity Cancer1
1CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
1CompletedTreatmentCancers1
1CompletedTreatmentCardiac Toxicity / Unspecified Childhood Solid Tumor, Protocol Specific1
1CompletedTreatmentChildhood Central Nervous System Germ Cell Tumor / Childhood Choroid Plexus Tumor / Childhood Craniopharyngioma / Childhood Ependymoblastoma / Childhood Grade I Meningioma / Childhood Grade II Meningioma / Childhood Grade III Meningioma / Childhood High-grade Cerebellar Astrocytoma / Childhood High-grade Cerebral Astrocytoma / Childhood Infratentorial Ependymoma / Childhood Low-grade Cerebellar Astrocytoma / Childhood Low-grade Cerebral Astrocytoma / Childhood Medulloepithelioma / Childhood Mixed Glioma / Childhood Oligodendroglioma / Childhood Supratentorial Ependymoma / Recurrent Childhood Brain Stem Glioma / Recurrent Childhood Cerebellar Astrocytoma / Recurrent Childhood Cerebral Astrocytoma / Recurrent Childhood Ependymoma / Recurrent Childhood Medulloblastoma / Recurrent Childhood Pineoblastoma / Recurrent Childhood Subependymal Giant Cell Astrocytoma / Recurrent Childhood Supratentorial Primitive Neuroectodermal Tumor / Recurrent Childhood Visual Pathway and Hypothalamic Glioma1
1CompletedTreatmentChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Precancerous/Nonmalignant Condition / Small Intestine Cancer1
1CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1CompletedTreatmentDisseminated Sclerosis2
1CompletedTreatmentEwing's Sarcoma (ES) / High-risk Sarcoma / MPNST / Rhabdomyosarcomas / Synovial Sarcoma1
1CompletedTreatmentHealthy Male Subjects1
1CompletedTreatmentHealthy Volunteers1
1CompletedTreatmentHematopoietic Stem Cell Transplantation (HSCT)1
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections2
1CompletedTreatmentLeukemia, Myeloid, Acute1
1CompletedTreatmentLeukemias7
1CompletedTreatmentLeukemias / Malignant Lymphomas1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentLeukemias / Myelodysplastic Syndrome2
1CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1CompletedTreatmentLeukemias / Neutropenias1
1CompletedTreatmentLiver Cirrhosis1
1CompletedTreatmentMalignant Lymphomas2
1CompletedTreatmentMalignant Lymphomas / Small Intestine Cancer / Unspecified Adult Solid Tumor, Protocol Specific2
1CompletedTreatmentMelanoma (Skin)3
1CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Lymphoepithelioma of the Oropharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1CompletedTreatmentMiscellaneous Peripheral Blood Cell Abnormalities1
1CompletedTreatmentMultiple Myeloma (MM)1
1CompletedTreatmentMyelodysplastic Syndromes1
1CompletedTreatmentNeoplasms, Brain / Neuroblastomas / Sarcomas / Tumors, Central Nervous System1
1CompletedTreatmentNeuroblastomas6
1CompletedTreatmentNeutropenias / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentRecurrent Neuroblastoma / Unspecified Childhood Solid Tumor, Protocol Specific1
1CompletedTreatmentRefractory Multiple Myeloma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
1CompletedTreatmentSarcomas2
1CompletedTreatmentSevere Combined Immunodeficiency1
1CompletedTreatmentStem Cell Transplant Patients1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific3
1CompletedTreatmentUnspecified Childhood Solid Tumor, Protocol Specific1
1Not Yet RecruitingNot AvailableLeucocytosis1
1RecruitingOtherBlood Component Removal / Blood Donors / Granulocyte Colony-Stimulation Factor / Leukocyte Transfusion1
1RecruitingTreatmentAcute Myeloid Leukaemias (AML)1
1RecruitingTreatmentAgnogenic Myeloid Metaplasia / Leukemias / Malignant Lymphomas / Smith-Magenis Syndrome1
1RecruitingTreatmentChildhood Solid Tumors1
1RecruitingTreatmentCongenital Hypoplastic Anemia1
1RecruitingTreatmentHigh-risk Tumor / Malignant Lymphomas / Neuroblastomas1
1RecruitingTreatmentHuman Immunodeficiency Virus (HIV) Infections / Human Immunodeficiency Virus 1 Positive / Stage I Adult Hodgkin Lymphoma / Stage I Adult Non-Hodgkin Lymphoma / Stage II Adult Hodgkin Lymphoma / Stage II Adult Non-Hodgkin Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Adult Non-Hodgkin Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Non-Hodgkin Lymphoma1
1RecruitingTreatmentIncrease of Muscle Strength in Patients With Muscular Dystrophy1
1RecruitingTreatmentLeukemias1
1RecruitingTreatmentMantle Cell Lymphoma (MCL)1
1RecruitingTreatmentDe Novo Myelodysplastic Syndrome / Mixed Phenotype Acute Leukemia (MPAL) / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia1
1RecruitingTreatmentMultiple Myeloma (MM)1
1RecruitingTreatmentMultiple Myeloma, Refractory to Standard Treatment / Multiple Myeloma, Relapsed1
1TerminatedSupportive CareBrain and Central Nervous System Tumors / Cancer, Ovarian / Childhood Germ Cell Tumor / Chordomas / Liver Cancer / Neuroblastomas / Renal Cancers / Retinoblastoma / Sarcomas1
1TerminatedSupportive CareMalignant Lymphomas / Neutropenias1
1TerminatedTreatmentAIDS-related Peripheral/Systemic Lymphoma / AIDS-related Primary CNS Lymphoma / Post-Transplant Lymphoproliferative Disorder / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma1
1TerminatedTreatmentAplastic Anaemia (AA)1
1TerminatedTreatmentBone Marrow Suppression / Brain and Central Nervous System Tumors / Drug/Agent Toxicity by Tissue/Organ / Long-Term Effects Secondary to Cancer Therapy in Children1
1TerminatedTreatmentBrain and Central Nervous System Tumors / Liver Cancer / Renal Cancers / Retinoblastoma / Sarcomas1
1TerminatedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas / Unspecified Adult Solid Tumor, Protocol Specific1
1TerminatedTreatmentCancer, Breast1
1TerminatedTreatmentCancer, Breast / Malignant Lymphomas1
1TerminatedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
1TerminatedTreatmentDisseminated Neuroblastoma / Recurrent Neuroblastoma1
1TerminatedTreatmentDrug/Agent Toxicity by Tissue/Organ / Multiple Myeloma and Plasma Cell Neoplasm1
1TerminatedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1Unknown StatusTreatmentBrain and Central Nervous System Tumors / Cancer, Ovarian / Childhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Liver Cancer / Neuroblastomas / Sarcomas / Testicular germ cell tumour1
1Unknown StatusTreatmentCancer, Breast3
1Unknown StatusTreatmentCongenital Hypoplastic Anemia1
1Unknown StatusTreatmentEnd Stage Liver Diseases1
1Unknown StatusTreatmentHealthy Volunteers1
1Unknown StatusTreatmentInfertilities1
1Unknown StatusTreatmentLeukemias / Malignant Lymphomas1
1Unknown StatusTreatmentMalignant Lymphomas1
1Unknown StatusTreatmentMalignant Neoplasm of Prostate1
1Unknown StatusTreatmentMelanoma (Skin)2
1Unknown StatusTreatmentStroke, Ischemic1
1Unknown StatusTreatmentSystemic Lupus Erythematosus (SLE)1
1Unknown StatusTreatmentUnspecified Childhood Solid Tumor, Protocol Specific1
1WithdrawnTreatmentCNS 2a / CNS 2b / CNS 2c / CNS1 / Recurrent Adult Acute Myeloid Leukemia / Recurrent Childhood Acute Myeloid Leukemia1
1WithdrawnTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes1
1WithdrawnTreatmentLeukemias / Malignant Lymphomas / Pediatric Disorders / Transplantation, Stem Cell1
1WithdrawnTreatmentLung Cancer, Non-Small Cell1
1, 2Active Not RecruitingTreatmentAdult Glioblastoma / Adult Gliosarcoma / Glioblastomas / Gliosarcoma1
1, 2Active Not RecruitingTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Myelodysplastic Syndromes1
1, 2Active Not RecruitingTreatmentLeukemia, Myeloid, Acute1
1, 2Active Not RecruitingTreatmentMalignant Lymphomas2
1, 2Active Not RecruitingTreatmentMultiple Myeloma (MM)1
1, 2Active Not RecruitingTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
1, 2Active Not RecruitingTreatmentRecurrent Childhood Acute Lymphoblastic Leukemia1
1, 2Active Not RecruitingTreatmentRefractory Multiple Myeloma / Smoldering Multiple Myeloma (SMM) / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
1, 2CompletedSupportive CareAcute Lymphoblastic Leukaemias (ALL) / Acute Myeloid Leukaemias (AML) / Chronic Myeloid Leukemia (CML) / Myelodysplasia1
1, 2CompletedTreatmentAcute Lymphocytic Leukemia (ALL) / Leukemias1
1, 2CompletedTreatmentAcute Myeloid Leukaemias (AML) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Promyelocytic Leukemia (M3) / Recurrent Adult Acute Myeloid Leukemia1
1, 2CompletedTreatmentAcute Myocardial Infarction (AMI)1
1, 2CompletedTreatmentAcute Undifferentiated Leukemia (AUL) / B-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / L1 Adult Acute Lymphoblastic Leukemia / L1 Childhood Acute Lymphoblastic Leukemia / L2 Adult Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia / Philadelphia Chromosome Negative Adult Precursor Acute Lymphoblastic Leukemia / Philadelphia Chromosome Positive Adult Precursor Acute Lymphoblastic Leukemia / Philadelphia Chromosome Positive Childhood Precursor Acute Lymphoblastic Leukemia / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
1, 2CompletedTreatmentAlzheimer's Disease (AD)1
1, 2CompletedTreatmentAplastic Anaemia (AA)1
1, 2CompletedTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter1
1, 2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer, Ovarian / Childhood Germ Cell Tumor / Head and Neck Carcinoma / Neuroblastomas / Renal Cancers / Sarcomas / Testicular germ cell tumour1
1, 2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer, Ovarian / Extragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
1, 2CompletedTreatmentCancer, Breast5
1, 2CompletedTreatmentCancer, Breast / Cancer, Ovarian / Leukemias / Malignant Lymphomas / Neuroblastomas / Sarcomas / Unspecified Adult Solid Tumor, Protocol Specific1
1, 2CompletedTreatmentCancer, Breast / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic/Myeloproliferative Diseases1
1, 2CompletedTreatmentCancer, Ovarian1
1, 2CompletedTreatmentCancer, Ovarian / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
1, 2CompletedTreatmentCancer, Ovarian / Primary Peritoneal Cavity Cancer1
1, 2CompletedTreatmentCancer, Ovarian / Testicular germ cell tumour1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias / Malignant Lymphomas1
1, 2CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Myelodysplastic Syndromes / Thrombocytopenias1
1, 2CompletedTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1, 2CompletedTreatmentCongenital Hypoplastic Anemia1
1, 2CompletedTreatmentDrug/Agent Toxicity by Tissue/Organ / Lung Cancers / Radiation Toxicity1
1, 2CompletedTreatmentHead and Neck Carcinoma1
1, 2CompletedTreatmentHodgkins Disease (HD) / Non-Hodgkin's Lymphoma (NHL)1
1, 2CompletedTreatmentInfection NOS / Multiple Myeloma and Plasma Cell Neoplasm1
1, 2CompletedTreatmentInfertility, Female1
1, 2CompletedTreatmentLeukemias3
1, 2CompletedTreatmentLeukemias / Malignant Lymphomas3
1, 2CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Neuroblastomas / Renal Cancers / Sarcomas1
1, 2CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
1, 2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1, 2CompletedTreatmentLeukemias / Transplantation, Stem Cell1
1, 2CompletedTreatmentMalignant Lymphomas3
1, 2CompletedTreatmentMelanoma (Skin)1
1, 2CompletedTreatmentMetastatic Cancers / Pancreatic Cancer Metastatic1
1, 2CompletedTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
1, 2CompletedTreatmentRenal Cancers1
1, 2CompletedTreatmentSarcomas2
1, 2Not Yet RecruitingTreatmentAcute Myeloid Leukaemias (AML) / Other Diseases of Blood and Blood-Forming Organs1
1, 2RecruitingTreatmentAcute Biphenotypic Leukemia (ABL) / Acute Myeloid Leukaemias (AML) / De Novo Myelodysplastic Syndrome / Myeloproliferative Neoplasms1
1, 2RecruitingTreatmentAcute Biphenotypic Leukemia (ABL) / De Novo Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes / Untreated Adult Acute Myeloid Leukemia1
1, 2RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myeloid Leukaemias (AML) / Myelodysplastic Syndrome1
1, 2RecruitingTreatmentCongenital Hypoplastic Anemia2
1, 2RecruitingTreatmentHaploidentical Hematopoietic Stem Cell Transplantation / Malignant Diseases / Non-malignant Diseases1
1, 2RecruitingTreatmentLeukemias3
1, 2RecruitingTreatmentLeukemias / Malignant Lymphomas2
1, 2RecruitingTreatmentLeukemias / Myeloproliferative Diseases1
1, 2RecruitingTreatmentMalignant Lymphomas1
1, 2RecruitingTreatmentMalignant Neoplasm of Prostate1
1, 2RecruitingTreatmentPlasma Cell Leukemia in Remission / Plasma Cell Myeloma1
1, 2RecruitingTreatmentPlasma Cell Myeloma2
1, 2RecruitingTreatmentRecurrent Childhood Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia / Therapy-Related Acute Myeloid Leukemia1
1, 2TerminatedTreatmentCancer, Ovarian1
1, 2TerminatedTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentHead and Neck Carcinoma1
1, 2TerminatedTreatmentInfertility, Female1
1, 2TerminatedTreatmentLeukemia, Plasma Cell / Multiple Myeloma (MM)1
1, 2TerminatedTreatmentLeukemias1
1, 2TerminatedTreatmentLeukemias / Myeloproliferative Diseases / Plasma Cell Myeloma1
1, 2TerminatedTreatmentMale Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2TerminatedTreatmentMalignant Neoplasm of Prostate / Pain1
1, 2TerminatedTreatmentMyelodysplastic Syndromes1
1, 2TerminatedTreatmentNeoplasm Metastases / Neoplasms, Breast1
1, 2TerminatedTreatmentNeoplasms, Brain / Tumors, Central Nervous System1
1, 2TerminatedTreatmentRelapsed T-Cell Acute Lymphoblastic Leukemia / Relapsed T-Cell Lymphoblastic Lymphoma1
1, 2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Cancer, Ovarian / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
1, 2Unknown StatusTreatmentCancer, Breast3
1, 2Unknown StatusTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
1, 2Unknown StatusTreatmentLeukaemia, Acute / Myelodysplastic Syndrome / Tumors, Solid1
1, 2Unknown StatusTreatmentMalignant Lymphomas1
1, 2Unknown StatusTreatmentMalignant Neoplasm of Prostate1
1, 2WithdrawnTreatmentCancer, Breast1
1, 2WithdrawnTreatmentLarge-Cell Lymphoma, Diffuse / Lymphoma, Diffuse Large-Cell / Lymphoma, Diffuse Large-Cell B-cell / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
1, 2WithdrawnTreatmentLeukemias1
1, 2WithdrawnTreatmentMalignant Lymphomas1
1, 2WithdrawnTreatmentMyelodysplastic Syndromes1
2Active Not RecruitingPreventionCancer, Ovarian / Endometrial Cancers / Uterine Cervical Cancer1
2Active Not RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myeloid Leukaemias (AML) / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myeloid Leukemia (CML) / Leukemias / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Myeloproliferative Diseases / Non-Hodgkin's Lymphoma (NHL)1
2Active Not RecruitingTreatmentAcute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Adult Acute Myeloid Leukemia in Remission1
2Active Not RecruitingTreatmentAcute Myeloid Leukemia With Multilineage Dysplasia Following Myelodysplastic Syndrome / Adult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / De Novo Myelodysplastic Syndromes / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia1
2Active Not RecruitingTreatmentAcute Myeloid Leukemia With Myelodysplasia-Related Changes / Adult Acute Myeloid Leukemia With Inv(16)(p13.1q22); CBFB-MYH11 / Adult Acute Myeloid Leukemia With t(16;16)(p13.1;q22); CBFB-MYH11 / Adult Acute Myeloid Leukemia With t(8;21)(q22;q22); RUNX1-RUNX1T1 / Adult Acute Myeloid Leukemia With t(8;21); (q22; q22.1); RUNX1-RUNX1T1 / Adult Acute Myeloid Leukemia With t(9;11)(p22.3;q23.3); MLLT3-KMT2A / Adult Acute Myeloid Leukemia With t(9;11)(p22;q23); MLLT3-MLL / Untreated Adult Acute Myeloid Leukemia1
2Active Not RecruitingTreatmentAdult Acute Lymphoblastic Leukemia in Remission / Adult B Acute Lymphoblastic Leukemia / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Adult L1 Acute Lymphoblastic Leukemia / Adult L2 Acute Lymphoblastic Leukemia / Adult T Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Chronic Myelomonocytic Leukemia / De Novo Myelodysplastic Syndromes / Myeloproliferative Neoplasm With 10% Blasts or Higher / Refractory Anemia With Excess Blasts / Untreated Adult Acute Myeloid Leukemia1
2Active Not RecruitingTreatmentAdult B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentBlood Stem Cell Transplant Failure / Leukemias / Malignancies, Hematologic1
2Active Not RecruitingTreatmentCancer, Breast1
2Active Not RecruitingTreatmentChildhood Extracranial Germ Cell Tumor / Childhood Extragonadal Germ Cell Tumor / Childhood Malignant Ovarian Germ Cell Tumor / Childhood Malignant Testicular Germ Cell Tumor / Ovarian Choriocarcinoma / Ovarian Embryonal Carcinoma / Ovarian Yolk Sac Tumor / Recurrent Childhood Malignant Germ Cell Tumor / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Ovarian Germ Cell Tumor / Testicular Choriocarcinoma / Testicular Choriocarcinoma and Embryonal Carcinoma / Testicular Choriocarcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma / Testicular Embryonal Carcinoma and Yolk Sac Tumor / Testicular Yolk Sac Tumor1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Lymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Lymphoma, Low-Grade / Lymphoma, Mantle-Cell / Small Lymphocytic Lymphoma (SLL) / T-Cell Lymphomas1
2Active Not RecruitingTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
2Active Not RecruitingTreatmentHemoglobinuria, Paroxysmal Nocturnal (PNH) / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia, Acute Lymphocytic (ALL) / Leukemia, Myeloid, Acute(AML) / Leukemia, Myeloid, Chronic(CML) / Lymphoma, Hodgkins / Lymphoma, Non-Hodgkin (NHL) / Myelodysplastic Syndromes (MDS)1
2Active Not RecruitingTreatmentInflammatory carcinoma of the breast / Male Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingTreatmentLeukemias1
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas1
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Plasma Cell Neoplasms / Renal Cancers1
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas / Multiple Myleoma / Myelodysplastic Syndrome / Myeloproliferative Disorders1
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas / Transplantation, Stem Cell1
2Active Not RecruitingTreatmentLymphoma, Hodgkins1
2Active Not RecruitingTreatmentMalignant Lymphomas5
2Active Not RecruitingTreatmentMalignant Lymphomas / Nonneoplastic Condition1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)2
2Active Not RecruitingTreatmentMultiple Myeloma (MM) / Plasma Cell Myeloma2
2Active Not RecruitingTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2Active Not RecruitingTreatmentNeoplasms, Brain / Tumors, Central Nervous System1
2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)2
2Active Not RecruitingTreatmentPlasma Cell Myeloma1
2Active Not RecruitingTreatmentRetinoblastoma1
2Active Not RecruitingTreatmentSarcomas1
2Active Not RecruitingTreatmentTransplantation, Kidney1
2Active Not RecruitingTreatmentTumors, Solid1
2CompletedNot AvailableAcute Myocardial Infarction (AMI)1
2CompletedDiagnosticMalignant Lymphomas1
2CompletedPreventionNeutropenias / Sarcomas1
2CompletedSupportive CareAnemias / Leukemias / Neutropenias / Thrombocytopenias1
2CompletedSupportive CareBrain and Central Nervous System Tumors1
2CompletedSupportive CareCancer, Breast / Chemotherapeutic Agent Toxicity / Neutropenias1
2CompletedSupportive CareChemotherapy-Induced Neutropenia1
2CompletedSupportive CareColorectal Cancers1
2CompletedSupportive CareDiarrhea / Gastrointestinal Complications / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedSupportive CareDrug/Agent Toxicity by Tissue/Organ / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Oral Complications / Radiation Toxicity1
2CompletedSupportive CareGraft Versus Host Disease (GVHD)1
2CompletedSupportive CareLeukemias / Malignant Lymphomas / Oral Complications1
2CompletedSupportive CareLung Cancers1
2CompletedSupportive CareMalignant Lymphomas / Neutropenias1
2CompletedTreatmentAcute Ischemic Stroke (AIS)1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2CompletedTreatmentAcute Myeloid Leukaemias (AML) / Myelodysplastic Syndrome1
2CompletedTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Small Cell Carcinoma / Cervical Squamous Cell Carcinoma / Recurrent Cervical Carcinoma / Stage III Cervical Cancer / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer1
2CompletedTreatmentAdult Acute Lymphoblastic Leukemia in Remission1
2CompletedTreatmentAdult Lymphocyte Depletion Hodgkin Lymphoma / Adult Lymphocyte Predominant Hodgkin Lymphoma / Adult Mixed Cellularity Hodgkin Lymphoma / Adult Nodular Lymphocyte Predominant Hodgkin Lymphoma / Adult Nodular Sclerosis Hodgkin Lymphoma / Childhood Lymphocyte Depletion Hodgkin Lymphoma / Childhood Lymphocyte Predominant Hodgkin Lymphoma / Childhood Mixed Cellularity Hodgkin Lymphoma / Childhood Nodular Lymphocyte Predominant Hodgkin Lymphoma / Childhood Nodular Sclerosis Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma / Stage I Adult Hodgkin Lymphoma / Stage I Childhood Hodgkin Lymphoma / Stage II Adult Hodgkin Lymphoma / Stage II Childhood Hodgkin Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Childhood Hodgkin Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Childhood Hodgkin Lymphoma1
2CompletedTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Multiple Myeloma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2CompletedTreatmentAlveolar Childhood Rhabdomyosarcoma / Embryonal Childhood Rhabdomyosarcoma / Embryonal-botryoid Childhood Rhabdomyosarcoma / Previously Treated Childhood Rhabdomyosarcoma / Recurrent Childhood Rhabdomyosarcoma1
2CompletedTreatmentAmyotrophic Lateral Sclerosis (ALS)1
2CompletedTreatmentAnemia, Hemolytic, Autoimmune / Autoimmune Diseases / Felty's Syndrome / Thrombocytopenic Purpura1
2CompletedTreatmentAnti-p53 TCR-Gene1
2CompletedTreatmentAplastic Anaemia (AA) / Myelodysplastic Syndrome1
2CompletedTreatmentAutologous Stem Cell Transplantation / Lymphoma, Hodgkins / Mobilization of hematopoietic stem cells therapy / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentB-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Lymphoblastic Lymphoma / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia1
2CompletedTreatmentBladder Cancers1
2CompletedTreatmentBladder Cancers / Brain and Central Nervous System Tumors / Cancer, Ovarian / Carcinoma of Unknown Primary / Extragonadal Germ Cell Tumor / Head and Neck Carcinoma / Lung Cancers / Renal Cancers / Sarcomas / Testicular germ cell tumour / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter1
2CompletedTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter / Urethral Cancer1
2CompletedTreatmentBlood And Marrow Transplantation1
2CompletedTreatmentBone Marrow Ablation / Leukemias1
2CompletedTreatmentBrain and Central Nervous System Tumors8
2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer, Ovarian / Childhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Retinoblastoma / Testicular germ cell tumour / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer, Ovarian / Extragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
2CompletedTreatmentBrain and Central Nervous System Tumors / Head and Neck Carcinoma / Malignant Lymphomas1
2CompletedTreatmentBrain and Central Nervous System Tumors / Neuroblastomas1
2CompletedTreatmentBrain and Central Nervous System Tumors / Neuroblastomas / Sarcomas1
2CompletedTreatmentBurkitt's Lymphoma / Burkitt'S-like Lymphoma1
2CompletedTreatmentCancer, Breast16
2CompletedTreatmentCancer, Breast / Cancer, Ovarian / Gestational Trophoblastic Disease / Malignant Lymphomas / Neuroblastomas / Renal Cancers / Sarcomas / Testicular germ cell tumour1
2CompletedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentCancer, Ovarian1
2CompletedTreatmentCancer, Ovarian / Childhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Head and Neck Carcinoma / Liver Cancer / Malignant Lymphomas / Neuroblastomas / Renal Cancers / Retinoblastoma / Sarcomas / Testicular germ cell tumour1
2CompletedTreatmentCancer, Ovarian / Extragonadal Germ Cell Tumor1
2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cavity Cancer1
2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
2CompletedTreatmentCancer, Ovarian / Sarcomas1
2CompletedTreatmentCancer, Ovarian / Sarcomas / Small Intestine Cancer2
2CompletedTreatmentCarcinoma of Unknown Primary / Lung Cancers1
2CompletedTreatmentCentral Nervous System Tumor, Pediatric1
2CompletedTreatmentCervical Cancers1
2CompletedTreatmentChemotherapy Induced Neutropenia1
2CompletedTreatmentChildhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / Stage I Childhood Large Cell Lymphoma / Stage I Childhood Small Noncleaved Cell Lymphoma / Stage II Childhood Large Cell Lymphoma / Stage II Childhood Small Noncleaved Cell Lymphoma / Stage III Childhood Large Cell Lymphoma / Stage III Childhood Small Noncleaved Cell Lymphoma / Stage IV Childhood Large Cell Lymphoma / Stage IV Childhood Small Noncleaved Cell Lymphoma / Untreated Childhood Acute Lymphoblastic Leukemia1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias2
2CompletedTreatmentChronic Myelogenous Leukemia (CML) / Leukemias1
2CompletedTreatmentChronic Myeloproliferative Disorders1
2CompletedTreatmentColorectal Cancers / Metastatic Cancers1
2CompletedTreatmentCongenital Hypoplastic Anemia / Dyskeratosis Congenita / Shwachman Syndrome / Thrombocytopenias1
2CompletedTreatmentContiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Stage I Mantle Cell Lymphoma / Stage III Mantle Cell Lymphoma / Stage IV Mantle Cell Lymphoma1
2CompletedTreatmentCytopenias / Human Immunodeficiency Virus (HIV) Infections1
2CompletedTreatmentEsophageal Cancers1
2CompletedTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2CompletedTreatmentEstrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / HER2-positive Breast Cancer / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
2CompletedTreatmentEstrogen Receptor-Positive Breast Cancer / HER2-positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentExtensive Stage Small Cell Lung Cancer1
2CompletedTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Myelodysplastic Syndromes1
2CompletedTreatmentHead and Neck Carcinoma3
2CompletedTreatmentHead and Neck Carcinoma / Lung Cancers1
2CompletedTreatmentHematological Neoplasms / Tumors1
2CompletedTreatmentHematology / Lymphoma, Hodgkins / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL) / Oncology1
2CompletedTreatmentHodgkins Disease (HD)1
2CompletedTreatmentHodgkins Disease (HD) / Human Immunodeficiency Virus (HIV) Infections1
2CompletedTreatmentHodgkins Disease (HD) / Pediatric1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Progressive Multifocal Leukoencephalopathy1
2CompletedTreatmentInflammatory carcinoma of the breast / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2CompletedTreatmentLeukemias28
2CompletedTreatmentLeukemias / Lymphoproliferative Disorders / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
2CompletedTreatmentLeukemias / Malignant Lymphomas6
2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Myeloproliferative Neoplasms / Plasma Cell Neoplasms1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic-Myeloproliferative Diseases1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms2
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases2
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Neutropenias1
2CompletedTreatmentLung Cancers5
2CompletedTreatmentLupus Erythematosus, Systemic1
2CompletedTreatmentLymphoma, AIDS Related1
2CompletedTreatmentLymphoma, B-Cell1
2CompletedTreatmentMale Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer1
2CompletedTreatmentMalignant Lymphomas47
2CompletedTreatmentMalignant Lymphomas / Mantle Cell Lymphoma (MCL)1
2CompletedTreatmentMalignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm1
2CompletedTreatmentMalignant Lymphomas / Plasma Cell Myeloma1
2CompletedTreatmentMalignant Lymphomas / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedTreatmentMalignant Neoplasm of Pancreas1
2CompletedTreatmentMalignant Neoplasm of Prostate2
2CompletedTreatmentMalignant Neoplasm of Stomach1
2CompletedTreatmentMelanoma (Skin)2
2CompletedTreatmentMelanoma (Skin) / Renal Cancers1
2CompletedTreatmentMelanoma / Neoplasms Metastasis1
2CompletedTreatmentMetastatic Breast Cancer (MBC)1
2CompletedTreatmentMetastatic Osteosarcoma1
2CompletedTreatmentMetastatic Renal Cell Carcinoma / Renal Cell Carcinoma With Sarcomatoid Features1
2CompletedTreatmentMultiple Myeloma (MM)4
2CompletedTreatmentMultiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentMultiple Myeloma (MM) / Plasma Cell Neoplasms1
2CompletedTreatmentMultiple Myeloma (MM) / Refractory Multiple Myeloma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm6
2CompletedTreatmentMyelodysplastic Syndrome1
2CompletedTreatmentMyeloid Leukemias1
2CompletedTreatmentNeoplasms, Brain / Neuroblastomas / Tumors, Central Nervous System1
2CompletedTreatmentNeoplasms, Brain / Tumors, Central Nervous System1
2CompletedTreatmentNeoplasms, Breast1
2CompletedTreatmentNeuroblastomas7
2CompletedTreatmentNeurofibromatosis Type 1 / Sarcomas1
2CompletedTreatmentNeutropenias / Sarcomas1
2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)2
2CompletedTreatmentPemphigus1
2CompletedTreatmentRecurrent Uterine Corpus Sarcoma / Uterine Corpus Leiomyosarcoma1
2CompletedTreatmentRenal Cancers1
2CompletedTreatmentRetinoblastoma2
2CompletedTreatmentSarcomas10
2CompletedTreatmentStroke, Ischemic1
2CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
2Not Yet RecruitingPreventionCancer, Breast / Neutropenia, Febrile / Neutropenias1
2Not Yet RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2Not Yet RecruitingTreatmentAdult Acute Myeloid Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission1
2Not Yet RecruitingTreatmentB Acute Lymphoblastic Leukemia / B Lymphoblastic Lymphoma / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent B Lymphoblastic Lymphoma / Recurrent T Lymphoblastic Leukemia/Lymphoma / Refractory B Lymphoblastic Lymphoma / Refractory T Lymphoblastic Lymphoma / T Acute Lymphoblastic Leukemia / T Lymphoblastic Lymphoma1
2Not Yet RecruitingTreatmentB-cell Non-Hodgkin's Lymphomas1
2Not Yet RecruitingTreatmentHematopoietic/Lymphoid Cancer1
2Not Yet RecruitingTreatmentMultiple Myeloma (MM)1
2Not Yet RecruitingTreatmentSevere Aplastic Anemia (SAA)1
2RecruitingPreventionAcute Leukemia in Remission / Chronic Myeloid Leukemia (CML) / Chronic Myelomonocytic Leukemia / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Non-Hodgkin's Lymphoma (NHL) / Primary Myelofibrosis1
2RecruitingSupportive CareAcute Myeloid Leukaemias (AML)1
2RecruitingTreatmentAcute Biphenotypic Leukemia (ABL) / Acute Erythroid Leukemia in Remission / Acute Leukemia in Remission / Acute Megakaryoblastic Leukemia / Acute myeloid leukaemia (in remission) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute Myeloid Leukemia With FLT3/ITD Mutation / Acute Myeloid Leukemia With Inv(3)(q21q26.2) or t(3;3)(q21;q26.2); RPN1-EVI1 / Acute Myeloid Leukemia With Inv(3)(q21q26.2); RPN1-EVI1 / Acute Myeloid Leukemia With Multilineage Dysplasia / Acute Myeloid Leukemia With t(6;9)(p23;q34); DEK-NUP214 / Acute Undifferentiated Leukemia (AUL) / Adult Acute Lymphoblastic Leukemia in Complete Remission / B Acute Lymphoblastic Leukemia With t(1;19)(q23;p13.3); E2A-PBX1 (TCF3-PBX1) / B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Burkitt's Lymphoma / Childhood Acute Lymphoblastic Leukemia in Complete Remission / DS Stage II Plasma Cell Myeloma / DS Stage III Plasma Cell Myeloma / Myelodysplastic Syndrome / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Hodgkin Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma / Secondary Acute Myeloid Leukemia / T Lymphoblastic Lymphoma1
2RecruitingTreatmentAcute Biphenotypic Leukemia (ABL) / Acute Lymphoblastic Leukemia (ALL)/T Lymphoblastic Lymphoma / Acute Myelogenous Leukaemia (AML) / Acute Undifferentiated Leukemia (AUL) / Chemotherapy-sensitive Lymphoma / Chronic Lymphocytic Leukaemia (CLL) / Myelodysplastic Syndromes (MDS)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Myeloid Leukaemias (AML) / Chronic Myeloid Leukemia (CML) / Granulocytic Sarcoma / Juvenile Myelomonocytic Leukemia (JMML) / Myelodysplastic Syndromes (MDS) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myeloid Leukaemias (AML) / Agnogenic Myeloid Metaplasia / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myelogenous Leukemia (CML) / Leukemia, Prolymphocytic / Leukemias / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Non-Hodgkin's Lymphoma (NHL) / Refractory Anemia / Smith-Magenis Syndrome1
2RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myeloid Leukaemias (AML) / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myeloid Leukemia (CML) / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Myeloproliferative Syndromes / Non-Hodgkin's Lymphoma (NHL) / Other Diseases of Blood and Blood-Forming Organs1
2RecruitingTreatmentAcute Myelogenous Leukaemia (AML)1
2RecruitingTreatmentAcute Myelogenous Leukaemia (AML) / Congenital Hypoplastic Anemia / Myelodysplastic Syndromes (MDS) / Severe Marrow Failure1
2RecruitingTreatmentAcute Myeloid Leukaemias (AML)1
2RecruitingTreatmentAcute Myeloid Leukaemias (AML) / Myelodysplastic Syndrome1
2RecruitingTreatmentAcute Myeloid Leukaemias (AML) / Myelodysplastic Syndromes1
2RecruitingTreatmentBladder Cancers1
2RecruitingTreatmentCancer, Ovarian / Childhood Germ Cell Tumor / Teratoma1
2RecruitingTreatmentCarcinoma, Islet Cell / Gastro-enteropancreatic Neuroendocrine Tumor / Malignant Neoplasm of Pancreas / Neuroendocrine Carcinomas of Pancreas1
2RecruitingTreatmentCerebral Palsy (CP)1
2RecruitingTreatmentChildhood Acute Lymphoblastic Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission / Childhood Myelodysplastic Syndrome / De Novo Myelodysplastic Syndrome / Leukemias / Myelodysplastic Syndromes / Previously Treated Myelodysplastic Syndromes / Recurrent Childhood Acute Myeloid Leukemia / Refractory Anemia / Refractory Anemia With Excess Blasts / Refractory Anemia With Excess Blasts in Transformation / Secondary Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes1
2RecruitingTreatmentCongenital Hypoplastic Anemia2
2RecruitingTreatmentFibrolamellar Hepatocellular Carcinoma / Hepatocellular Carcinoma (Fibrolamellar Variant) / Hepatocellular,Carcinoma1
2RecruitingTreatmentHHV-8 / HIV Disease / Lymphoproliferative Disorders / Malignancies1
2RecruitingTreatmentHaematological Malignancies1
2RecruitingTreatmentHematopoietic Stem Cells / Malignant Lymphomas / Multiple Myeloma (MM) / Transplantation, Bone Marrow1
2RecruitingTreatmentLeukemia, Lymphocytic / Leukemias / Lymphoma, Hodgkins / Malignant Lymphomas / Plasma Cell Myeloma1
2RecruitingTreatmentLeukemias6
2RecruitingTreatmentLeukemias / Malignant Lymphomas1
2RecruitingTreatmentLymphoma, AIDS Related / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
2RecruitingTreatmentLymphoma, Hodgkins / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
2RecruitingTreatmentLymphoma, Mantle-Cell / Malignant Lymphomas1
2RecruitingTreatmentMalignant Lymphomas1
2RecruitingTreatmentMultiple Myeloma (MM)2
2RecruitingTreatmentMultiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentNeuroblastomas1
2RecruitingTreatmentNeutropenias2
2RecruitingTreatmentRetinoblastoma1
2RecruitingTreatmentRhabdomyosarcomas1
2RecruitingTreatmentScleroderma, Systemic1
2RecruitingTreatmentStage II Childhood Hodgkin Lymphoma / Stage III Childhood Hodgkin Lymphoma / Stage IV Childhood Hodgkin Lymphoma1
2TerminatedDiagnosticMalignant Lymphomas1
2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Myeloid Leukaemias (AML) / Chronic Myelogenous Leukemia (CML) / Granulocytic Sarcoma / Juvenile Myelomonocytic Leukemia (JMML) / Myelodysplastic Syndromes (MDS) / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentAdult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Recurrent Adult Acute Myeloid Leukemia1
2TerminatedTreatmentB-cell Childhood Acute Lymphoblastic Leukemia / Childhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / L3 Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma1
2TerminatedTreatmentBladder Cancers1
2TerminatedTreatmentBrain and Central Nervous System Tumors / Drug/Agent Toxicity by Tissue/Organ / Malignant Lymphomas / Thrombocytopenias1
2TerminatedTreatmentCancer, Breast1
2TerminatedTreatmentCancer, Ovarian / Childhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
2TerminatedTreatmentCardiac Toxicity / Sarcomas1
2TerminatedTreatmentChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
2TerminatedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms / Unusual Cancers of Childhood1
2TerminatedTreatmentHead and Neck Carcinoma1
2TerminatedTreatmentLeukemias2
2TerminatedTreatmentLeukemias / Malignant Lymphomas / Myeloproliferative Diseases / Plasma Cell Myeloma1
2TerminatedTreatmentLeukemias / Myelodysplastic Syndromes1
2TerminatedTreatmentMalignant Lymphomas2
2TerminatedTreatmentMalignant Ovarian Mixed Epithelial Tumor / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Primary Peritoneal Carcinoma / Stage III Ovarian Cancer / Undifferentiated Ovarian Carcinoma1
2TerminatedTreatmentMelanoma (Skin)1
2TerminatedTreatmentMelanoma (Skin) / Renal Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
2TerminatedTreatmentMultiple Myeloma (MM)1
2TerminatedTreatmentMultiple Myeloma (MM) / Multiple Myeloma and Plasma Cell Neoplasm / Plasma Cell Neoplasms1
2TerminatedTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2TerminatedTreatmentParkinson's Disease (PD)1
2TerminatedTreatmentRecurrent Adult Soft Tissue Sarcoma / Stage I Adult Soft Tissue Sarcoma / Stage II Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma1
2TerminatedTreatmentRecurrent Melanoma / Stage IV Melanoma1
2TerminatedTreatmentRelapsed Acute Myelogenous Leukemia1
2TerminatedTreatmentSarcomas2
2TerminatedTreatmentT-Cell Non-Hodgkin Lymphoma1
2Unknown StatusTreatmentAcquired Aplastic Anemia1
2Unknown StatusTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter1
2Unknown StatusTreatmentBlood and Marrow Transplant (BMT) / Multiple Myeloma (MM) / Transplantation, Autologous / Transplantation, Homologous1
2Unknown StatusTreatmentBrain and Central Nervous System Tumors1
2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
2Unknown StatusTreatmentCancer, Breast1
2Unknown StatusTreatmentCarcinoid tumour of the gastrointestinal tract / Extrahepatic Bile Duct Cancer / Liver Cancer / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Small Intestine Cancer1
2Unknown StatusTreatmentExtrahepatic Bile Duct Cancer / Gallbladder Cancer / Liver Cancer1
2Unknown StatusTreatmentHead and Neck Carcinoma1
2Unknown StatusTreatmentLeukemias2
2Unknown StatusTreatmentLung Cancers3
2Unknown StatusTreatmentMalignant Lymphoma, Stem Cell Type1
2Unknown StatusTreatmentMalignant Lymphomas5
2Unknown StatusTreatmentMalignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm1
2Unknown StatusTreatmentMalignant Neoplasm of Prostate / Pain1
2Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm2
2Unknown StatusTreatmentNeuroblastomas2
2WithdrawnTreatmentAnemias / Chronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2WithdrawnTreatmentBrain and Central Nervous System Tumors1
2WithdrawnTreatmentBrain and Central Nervous System Tumors / Neuroblastomas / Retinoblastoma / Sarcomas1
2WithdrawnTreatmentCrohn's Disease (CD)1
2WithdrawnTreatmentLeukemias1
2WithdrawnTreatmentLung Cancers1
2WithdrawnTreatmentMalignant Lymphomas3
2WithdrawnTreatmentRecurrent Adult Soft Tissue Sarcoma / Stage IIB Adult Soft Tissue Sarcoma / Stage IIC Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage IVA Adult Soft Tissue Sarcoma1
2WithdrawnTreatmentTumors, Solid1
2, 3CompletedTreatmentAcute Respiratory Failure / Critically Ill1
2, 3CompletedTreatmentAdult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Childhood B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
2, 3CompletedTreatmentAmyotrophic Lateral Sclerosis (ALS)1
2, 3CompletedTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Myelodysplastic Syndromes1
2, 3CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes1
2, 3CompletedTreatmentMalignant Lymphomas1
2, 3RecruitingSupportive CareLeukemia, Myeloid, Acute1
2, 3RecruitingTreatmentMature B-Cell Lymphoma1
2, 3TerminatedTreatmentFollicular Lymphoma (FL) / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma1
2, 3TerminatedTreatmentMetastatic Breast Cancer (MBC)1
2, 3Unknown StatusTreatmentExtragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
2, 3Unknown StatusTreatmentMyocardial Infarction (MI)1
3Active Not RecruitingSupportive CareChildhood Choroid Plexus Tumor / Childhood Pineoblastoma / Childhood Soft Tissue Sarcoma / Childhood Supratentorial Primitive Neuroectodermal Tumor / Medulloblastoma, Childhood / Neuroblastomas / Recurrent/Refractory Childhood Hodgkin Lymphoma / Retinoblastoma / Sarcoma, Osteogenic / Unspecified Childhood Solid Tumor, Protocol Specific / Wilms Tumor and Other Childhood Kidney Tumors1
3Active Not RecruitingTreatmentAcute Undifferentiated Leukemia (AUL) / T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3Active Not RecruitingTreatmentAdult T Acute Lymphoblastic Leukemia / Childhood T Acute Lymphoblastic Leukemia / Stage II Adult T-Cell Leukemia/Lymphoma / Stage II Childhood Lymphoblastic Lymphoma / Stage II Contiguous Adult Lymphoblastic Lymphoma / Stage II Non-Contiguous Adult Lymphoblastic Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Adult T-Cell Leukemia/Lymphoma / Stage III Childhood Lymphoblastic Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Adult T-Cell Leukemia/Lymphoma / Stage IV Childhood Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3Active Not RecruitingTreatmentB-cell Childhood Acute Lymphoblastic Leukemia / Intermediate Risk Recurrent Childhood Acute Lymphoblastic Leukemia / L1 Childhood Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia1
3Active Not RecruitingTreatmentBrain and Central Nervous System Tumors1
3Active Not RecruitingTreatmentChildhood Acute Lymphoblastic Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission / Childhood Chronic Myelogenous Leukemia / Childhood Myelodysplastic Syndromes / Chronic Phase Chronic Myelogenous Leukemia / De Novo Myelodysplastic Syndromes / Juvenile Myelomonocytic Leukemia / Previously Treated Myelodysplastic Syndromes / Recurrent Childhood Acute Lymphoblastic Leukemia / Secondary Myelodysplastic Syndromes1
3Active Not RecruitingTreatmentChildhood Atypical Teratoid/Rhabdoid Tumor1
3Active Not RecruitingTreatmentChildhood Favorable Prognosis Hodgkin Lymphoma / Childhood Lymphocyte Depletion Hodgkin Lymphoma / Childhood Mixed Cellularity Hodgkin Lymphoma / Childhood Nodular Sclerosis Hodgkin Lymphoma / Stage I Childhood Hodgkin Lymphoma / Stage II Childhood Hodgkin Lymphoma1
3Active Not RecruitingTreatmentChildhood Nodular Lymphocyte Predominant Hodgkin Lymphoma / Stage III Childhood Hodgkin Lymphoma / Stage IV Childhood Hodgkin Lymphoma1
3Active Not RecruitingTreatmentEndometrial Cancers / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIB Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer1
3Active Not RecruitingTreatmentExtraocular Retinoblastoma1
3Active Not RecruitingTreatmentLarge B Cell Lymphoma1
3Active Not RecruitingTreatmentLocalized Resectable Neuroblastoma / Localized Unresectable Neuroblastoma / Recurrent Neuroblastoma / Regional Neuroblastoma / Stage 4 Neuroblastoma / Stage 4S Neuroblastoma1
3Active Not RecruitingTreatmentMalignant Lymphomas1
3Active Not RecruitingTreatmentNeoplasms, Brain / Tumors, Central Nervous System1
3Active Not RecruitingTreatmentPlasma Cell Myeloma1
3Active Not RecruitingTreatmentSarcomas1
3Active Not RecruitingTreatmentStage I Adrenocortical Carcinoma / Stage II Adrenocortical Carcinoma / Stage III Adrenocortical Carcinoma / Stage IV Adrenocortical Carcinoma1
3CompletedPreventionChemotherapy-Induced Neutropenia1
3CompletedPreventionNeutropenia in Breast Cancer1
3CompletedPreventionNeutropenia in Prematures1
3CompletedSupportive CareCancer, Breast / Chemotherapy Associated Neutropenia1
3CompletedSupportive CareChemotherapeutic Agent Toxicity / Neutropenias / Unspecified Adult Solid Tumor, Protocol Specific1
3CompletedSupportive CareChemotherapy-Induced Neutropenia1
3CompletedSupportive CareDrug/Agent Toxicity by Tissue/Organ / Lung Cancers / Oral Complications / Radiation Toxicity1
3CompletedSupportive CareFever, Sweats, and Hot Flashes / Neutropenias / Unspecified Childhood Solid Tumor, Protocol Specific1
3CompletedTreatmentAML1
3CompletedTreatmentAdult Acute Basophilic Leukemia / Adult Acute Eosinophilic Leukemia / Adult Acute Erythroid Leukemia (M6) / Adult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monoblastic Leukemia and Acute Monocytic Leukemia (M5) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Myelomonocytic Leukemia (M4) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Childhood Acute Basophilic Leukemia / Childhood Acute Eosinophilic Leukemia / Childhood Acute Erythroleukemia (M6) / Childhood Acute Megakaryocytic Leukemia (M7) / Childhood Acute Minimally Differentiated Myeloid Leukemia (M0) / Childhood Acute Monoblastic Leukemia (M5a) / Childhood Acute Monoblastic Leukemia and Acute Monocytic Leukemia (M5) / Childhood Acute Monocytic Leukemia (M5b) / Childhood Acute Myeloblastic Leukemia With Maturation (M2) / Childhood Acute Myeloblastic Leukemia Without Maturation (M1) / Childhood Acute Myelomonocytic Leukemia (M4) / Childhood Myelodysplastic Syndromes / De Novo Myelodysplastic Syndromes / Untreated Adult Acute Myeloid Leukemia / Untreated Childhood Acute Myeloid Leukemia and Other Myeloid Malignancies1
3CompletedTreatmentAdult Malignant Mesenchymoma / Adult Rhabdomyosarcoma / Alveolar Childhood Rhabdomyosarcoma / Childhood Malignant Mesenchymoma / Embryonal Childhood Rhabdomyosarcoma / Embryonal-botryoid Childhood Rhabdomyosarcoma / Nonmetastatic Childhood Soft Tissue Sarcoma / Previously Untreated Childhood Rhabdomyosarcoma / Stage I Adult Soft Tissue Sarcoma / Stage II Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma1
3CompletedTreatmentAmyloidosis1
3CompletedTreatmentAnemias / Myelodysplastic Syndromes1
3CompletedTreatmentBladder Cancers1
3CompletedTreatmentCancer, Breast10
3CompletedTreatmentCancer, Breast / Cyclophosphamide / Doxorubicin / High Risk / Positive Nodes1
3CompletedTreatmentCancer, Ovarian1
3CompletedTreatmentCancer, Ovarian / Endometrial Cancers / Metastatic Cancers / Pheochromocytomas / Renal Cancers / Sarcomas1
3CompletedTreatmentCancer, Ovarian / Endometrial Cancers / Pheochromocytomas / Renal Cancers / Sarcomas1
3CompletedTreatmentCardiac Toxicity / Malignant Lymphomas2
3CompletedTreatmentChemotherapy Induced Neutropenia1
3CompletedTreatmentChildhood Acute Erythroleukemia (M6) / Childhood Acute Megakaryocytic Leukemia (M7) / Childhood Acute Monoblastic Leukemia (M5a) / Childhood Acute Monocytic Leukemia (M5b) / Childhood Acute Myeloblastic Leukemia With Maturation (M2) / Childhood Acute Myeloblastic Leukemia Without Maturation (M1) / Childhood Acute Myelomonocytic Leukemia (M4) / Childhood Myelodysplastic Syndromes / Chronic Myelomonocytic Leukemia / De Novo Myelodysplastic Syndromes / Refractory Anemia / Refractory Anemia With Excess Blasts / Refractory Anemia With Excess Blasts in Transformation / Refractory Anemia With Ringed Sideroblasts / Secondary Myelodysplastic Syndromes / Untreated Childhood Acute Myeloid Leukemia and Other Myeloid Malignancies1
3CompletedTreatmentChildhood Acute Lymphoblastic Leukemia in Remission / Recurrent Childhood Acute Lymphoblastic Leukemia1
3CompletedTreatmentChildhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
3CompletedTreatmentChildhood Lymphocyte-Depleted Classical Hodgkin Lymphoma / Childhood Mixed Cellularity Classical Hodgkin Lymphoma / Childhood Nodular Lymphocyte Predominant Hodgkin Lymphoma / Childhood Nodular Sclerosis Classical Hodgkin Lymphoma / Malignant Lymphomas / Stage I Childhood Hodgkin Lymphoma / Stage II Childhood Hodgkin Lymphoma / Stage III Childhood Hodgkin Lymphoma / Stage IV Childhood Hodgkin Lymphoma1
3CompletedTreatmentChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Secondary Myelofibrosis1
3CompletedTreatmentEndometrial Adenocarcinomas / Endometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Endometrioid Adenocarcinoma, Variant With Squamous Differentiation / Endometrial Serous Adenocarcinoma / Stage III Uterine Corpus Cancer1
3CompletedTreatmentEndometrial Cancers1
3CompletedTreatmentHodgkins Disease (HD)1
3CompletedTreatmentInfection NOS / Neutropenias1
3CompletedTreatmentIntraocular Retinoblastoma1
3CompletedTreatmentLeukemias3
3CompletedTreatmentLeukemias / Malignant Lymphomas2
3CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
3CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
3CompletedTreatmentLeukemias / Neutropenias1
3CompletedTreatmentLiver Cirrhosis1
3CompletedTreatmentMalignant Lymphomas8
3CompletedTreatmentMediastinal Cancer / Metastatic Cancers / Testicular germ cell tumour1
3CompletedTreatmentMelanoma (Skin)2
3CompletedTreatmentMultiple Myeloma (MM)1
3CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm3
3CompletedTreatmentNeoplasms, Brain / Tumors, Central Nervous System2
3CompletedTreatmentNeuroblastomas4
3CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
3CompletedTreatmentRecurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma1
3CompletedTreatmentRenal Cancers2
3CompletedTreatmentSarcomas4
3CompletedTreatmentStage III Bladder Cancer / Stage IV Bladder Cancer / Transitional Cell Carcinoma of the Bladder1
3CompletedTreatmentUntreated Childhood Medulloblastoma / Untreated Childhood Supratentorial Primitive Neuroectodermal Tumor1
3Not Yet RecruitingTreatmentB Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / BCR-ABL1 Fusion Protein Expression / Minimal Residual Disease / Philadelphia Chromosome Positive / T Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3Not Yet RecruitingTreatmentTriple-Negative Breast Cancer (TNBC)1
3RecruitingOtherHealthy Volunteers1
3RecruitingTreatmentAlcoholic Hepatitis (AH)1
3RecruitingTreatmentB Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia1
3RecruitingTreatmentChildhood Acute Myeloid Leukemia / Childhood Myelodysplastic Syndrome / Cytopenias / Down Syndrome (DS) / Myeloid Leukemia Associated With Down Syndrome / Myeloproliferative Neoplasms1
3RecruitingTreatmentGerm Cell Tumors1
3RecruitingTreatmentGranulocytic Sarcoma / Leukaemia cutis / Untreated Adult Acute Myeloid Leukemia / Untreated Childhood Myeloid Neoplasm1
3RecruitingTreatmentLymphoma, Hodgkins / Non-Hodgkin's Lymphoma (NHL)1
3RecruitingTreatmentMultiple Myeloma (MM)1
3RecruitingTreatmentNeuroblastomas1
3RecruitingTreatmentPharmacokinetics1
3RecruitingTreatmentRepeated Embryo Implantation Failure1
3RecruitingTreatmentStage I Uterine Sarcoma / Uterine Corpus Leiomyosarcoma1
3RecruitingTreatmentUntreated Childhood Medulloblastoma / Untreated Childhood Pineoblastoma / Untreated Childhood Supratentorial Primitive Neuroectodermal Tumor1
3SuspendedTreatmentAnterior Acute Myocardial Infarction / Left Ventricular Systolic Dysfunction1
3TerminatedTreatmentAL Amyloidosis1
3TerminatedTreatmentBladder Cancers1
3TerminatedTreatmentCancer, Breast1
3TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
3TerminatedTreatmentEndometrial Cancers1
3TerminatedTreatmentHead and Neck Carcinoma1
3TerminatedTreatmentLung Cancers1
3TerminatedTreatmentMalignant Lymphomas2
3TerminatedTreatmentMultiple Myeloma (MM)1
3TerminatedTreatmentRecurrent Uterine Corpus Sarcoma / Stage IIIA Uterine Sarcoma / Stage IIIB Uterine Sarcoma / Stage IIIC Uterine Sarcoma / Stage IVA Uterine Sarcoma / Stage IVB Uterine Sarcoma / Uterine Corpus Leiomyosarcoma1
3TerminatedTreatmentRefractory Multiple Myeloma1
3Unknown StatusNot AvailableMyelodysplastic Syndrome1
3Unknown StatusPreventionG-CSF, Multiple Myeloma, Febrile Episode, Filgrastim, Leograstim1
3Unknown StatusTreatmentGraft Versus Host Disease (GVHD)1
3Unknown StatusTreatmentLeukemias3
3Unknown StatusTreatmentLeukemias / Neutropenias1
3Unknown StatusTreatmentLung Cancers1
3Unknown StatusTreatmentMalignant Lymphomas6
3Unknown StatusTreatmentMultiple Myeloma (MM)1
3Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm2
3Unknown StatusTreatmentNeuroblastomas3
4Active Not RecruitingTreatmentPremature Ovarian Failure (POF)1
4CompletedNot AvailableMultiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
4CompletedDiagnosticDiabetes Mellitus (DM)1
4CompletedPreventionCancer, Breast1
4CompletedPreventionMycoses1
4CompletedTreatmentAnemias / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
4CompletedTreatmentAsherman's Syndrome / Endometrium; Atrophy, Cervix1
4CompletedTreatmentMyocardial Infarction (MI)1
4CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
4CompletedTreatmentRecurrent Abortion1
4RecruitingTreatmentEarly Stage Breast Cancer2
4RecruitingTreatmentStevens - Johnson Syndrome1
4TerminatedTreatmentLeukemias1
4TerminatedTreatmentNeutropenia, Severe Chronic1
4Unknown StatusSupportive CareCancer, Breast / Neutropenias1
4WithdrawnTreatmentLower Limb Ischemia1
Not AvailableActive Not RecruitingNot AvailableBlood Diseases1
Not AvailableActive Not RecruitingNot AvailableCancer, Breast / Lung Cancers1
Not AvailableActive Not RecruitingNot AvailableStage I Ovarian Cancer / Stage IA Fallopian Tube Cancer / Stage IB Fallopian Tube Cancer / Stage IC Fallopian Tube Cancer / Stage II Ovarian Cancer / Stage IIA Fallopian Tube Cancer / Stage IIB Fallopian Tube Cancer / Stage IIC Fallopian Tube Cancer / Stage III Ovarian Cancer / Stage III Primary Peritoneal Cancer / Stage IIIA Fallopian Tube Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIC Fallopian Tube Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer1
Not AvailableActive Not RecruitingTreatmentAcute Leukemias of Ambiguous Lineage / Adult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With Inv(16)(p13.1q22); CBFB-MYH11 / Adult Acute Myeloid Leukemia With t(16;16)(p13.1;q22); CBFB-MYH11 / Adult Acute Myeloid Leukemia With t(8;21)(q22;q22); RUNX1-RUNX1T1 / Adult Acute Myeloid Leukemia With t(8;21); (q22; q22.1); RUNX1-RUNX1T1 / Adult Acute Myeloid Leukemia With t(9;11)(p22.3;q23.3); MLLT3-KMT2A / Adult Acute Myeloid Leukemia With t(9;11)(p22;q23); MLLT3-MLL / Adult Acute Promyelocytic Leukemia With PML-RARA / Adult Acute Promyelocytic Leukemia With t(15;17)(q22;q12); PML-RARA / Alkylating Agent-Related Acute Myeloid Leukemia / Childhood Acute Myeloid Leukemia in Remission / Recurrent Adult Acute Myeloid Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia1
Not AvailableActive Not RecruitingTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Squamous Cell Carcinoma of Lung / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer1
Not AvailableActive Not RecruitingTreatmentAdult Central Nervous System Germ Cell Tumor / Adult Rhabdomyosarcoma / Childhood Central Nervous System Germ Cell Tumor / Childhood Soft Tissue Sarcoma / Ewing's Sarcoma (ES) / Metastatic Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Ovarian Mixed Germ Cell Tumor / Previously Untreated Childhood Rhabdomyosarcoma / Recurrent Adult Brain Tumor / Recurrent Adult Soft Tissue Sarcoma / Recurrent Childhood Brain Stem Glioma / Recurrent Childhood Cerebellar Astrocytoma / Recurrent Childhood Cerebral Astrocytoma / Recurrent Childhood Ependymoma / Recurrent Childhood Malignant Germ Cell Tumor / Recurrent Childhood Medulloblastoma / Recurrent Childhood Pineoblastoma / Recurrent Childhood Supratentorial Primitive Neuroectodermal Tumor / Recurrent Childhood Visual Pathway and Hypothalamic Glioma / Recurrent Childhood Visual Pathway Glioma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Extragonadal Germ Cell Tumor / Recurrent Extragonadal Non-seminomatous Germ Cell Tumor / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Neuroblastoma / Recurrent Ovarian Germ Cell Tumor / Recurrent Wilms Tumor and Other Childhood Kidney Tumors / Tumors, Solid / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
Not AvailableActive Not RecruitingTreatmentAdult Grade III Lymphomatoid Granulomatosis / B-Cell Chronic Lymphocytic Leukemia / Contiguous Stage II Adult Burkitt Lymphoma / Contiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Contiguous Stage II Adult Lymphoblastic Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Progressive Hairy Cell Leukemia, Initial Treatment / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Refractory Multiple Myeloma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Adult Burkitt Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Mixed Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Adult Immunoblastic Large Cell Lymphoma / Stage I Adult Lymphoblastic Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Multiple Myeloma / Stage I Small Lymphocytic Lymphoma / Stage II Multiple Myeloma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Multiple Myeloma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Untreated Hairy Cell Leukemia / Waldenstrom's Macroglobulinemia (WM)1
Not AvailableActive Not RecruitingTreatmentCancer, Breast1
Not AvailableActive Not RecruitingTreatmentDS Stage I Plasma Cell Myeloma / DS Stage II Plasma Cell Myeloma / DS Stage III Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
Not AvailableActive Not RecruitingTreatmentLeukemias1
Not AvailableActive Not RecruitingTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes1
Not AvailableCompletedNot AvailableChemotherapy-induced Febrile Neutropenia (FN) / Malignant Hemopathies / Tumors, Solid1
Not AvailableCompletedNot AvailableNormal PBPC Donors1
Not AvailableCompletedTreatmentAntiphospholipid Antibody Syndrome / Systemic Lupus Erythematosus (SLE)1
Not AvailableCompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas1
Not AvailableCompletedTreatmentCancer, Breast1
Not AvailableCompletedTreatmentChildhood Germ Cell Tumor / Extragonadal Germ Cell Tumor1
Not AvailableCompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
Not AvailableCompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Myelodysplastic Syndromes1
Not AvailableCompletedTreatmentCoronary Artery Disease1
Not AvailableCompletedTreatmentCytopenias / Human Immunodeficiency Virus (HIV) Infections1
Not AvailableCompletedTreatmentEwing Sarcoma of Bone / Localized Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor1
Not AvailableCompletedTreatmentFertility Disorders1
Not AvailableCompletedTreatmentHematologic Diseases / Malignancies, Hematologic1
Not AvailableCompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
Not AvailableCompletedTreatmentL1 Childhood Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia / Non-T, Non-B Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia1
Not AvailableCompletedTreatmentLeukemias1
Not AvailableCompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Post Transplant Lymphoproliferative Disorder / Primary Mediastinal (Thymic) Large B-cell Lymphoma1
Not AvailableCompletedTreatmentMalignant Lymphomas2
Not AvailableCompletedTreatmentPeripheral Stem Cell/Marrow Transplant1
Not AvailableNot Yet RecruitingTreatmentCritical Limb Ischemia (CLI)1
Not AvailableNot Yet RecruitingTreatmentHLA-A2 Positive Cells Present / Metastatic Malignant Neoplasm / Metastatic Malignant Neoplasm in the Brain1
Not AvailableRecruitingNot AvailableChemotherapy-Induced Neutropenia1
Not AvailableRecruitingBasic ScienceHead and Neck Carcinoma / Malignant Melanoma1
Not AvailableRecruitingTreatmentAIDS Related Non-Hodgkin Lymphoma / AIDS-Related Burkitt Lymphoma / AIDS-Related Diffuse Large B-cell Lymphoma / AIDS-Related Plasmablastic Lymphoma / AIDS-Related Primary Effusion Lymphoma / Human Immunodeficiency Virus (HIV) Infections1
Not AvailableRecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Myeloid Leukaemias (AML) / Myelodysplastic Syndrome1
Not AvailableRecruitingTreatmentAcute-On-Chronic Liver Failure1
Not AvailableRecruitingTreatmentMalignancies, Hematologic1
Not AvailableRecruitingTreatmentMyelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Recurrent Childhood Acute Myeloid Leukemia1
Not AvailableRecruitingTreatmentNeuroblastomas1
Not AvailableSuspendedTreatmentDisseminated Neuroblastoma / Localized Resectable Neuroblastoma / Localized Unresectable Neuroblastoma / Regional Neuroblastoma / Stage 4S Neuroblastoma1
Not AvailableTerminatedNot AvailableHealthy Stem Cell Donor / Healthy, no Evidence of Disease1
Not AvailableTerminatedTreatmentAccelerated Phase Chronic Myelogenous Leukemia / Adult Acute Lymphoblastic Leukemia in Remission / Adult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL Negative / Blastic Phase Chronic Myelogenous Leukemia / Chronic Phase Chronic Myelogenous Leukemia / De Novo Myelodysplastic Syndromes / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Secondary Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes / Splenic Marginal Zone Lymphoma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Multiple Myeloma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma1
Not AvailableTerminatedTreatmentAdult Acute Lymphoblastic Leukemia in Remission / Adult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
Not AvailableTerminatedTreatmentAdult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Myelomonocytic Leukemia (M4) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Recurrent Adult Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia1
Not AvailableTerminatedTreatmentChronic Myeloproliferative Disorders / Congenital Hypoplastic Anemia / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
Not AvailableTerminatedTreatmentChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases / Sarcomas1
Not AvailableTerminatedTreatmentGraft Versus Host Disease (GVHD)1
Not AvailableTerminatedTreatmentLeukemias / Malignant Lymphomas1
Not AvailableTerminatedTreatmentMalignancies, Hematologic1
Not AvailableTerminatedTreatmentNon Hodgkin Lymphoma (NHL)1
Not AvailableUnknown StatusTreatmentAcute on Chronic Liver Failure1
Not AvailableUnknown StatusTreatmentAmyotrophic Lateral Sclerosis (ALS) / Brain Injury / Cerebral Palsy (CP) / Parkinson's Disease (PD)1
Not AvailableUnknown StatusTreatmentAnemia, Hemolytic, Autoimmune / Arthritis, Juvenile Rheumatoid / Autoimmune Thrombocytopenic Purpura / Churg-Strauss Syndrome (CSS) / Giant Cells Arteritis / Graft Versus Host Disease (GVHD) / Granulomatosis With Polyangiitis / Polyarteritis Nodosa / Pure Red Cell Aplasia / Purpura, Schoenlein-Henoch / Rheumatoid Arthritis / Systemic Lupus Erythematosus (SLE) / Takayasu's Disease / Vasculitis, Hypersensitivity1
Not AvailableUnknown StatusTreatmentAplastic Anaemia (AA) / Paroxysmal Hemoglobinuria, Nocturnal1
Not AvailableUnknown StatusTreatmentChediak-Higashi Syndrome / Familial Erythrophagocytic Lymphohistiocytosis / Graft Versus Host Disease (GVHD) / Lymphohistiocytosis, Hemophagocytic / Virus-Associated Hemophagocytic Syndrome / X-Linked Lymphoproliferative Syndrome1
Not AvailableUnknown StatusTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms / Renal Cancers1
Not AvailableUnknown StatusTreatmentLiver Failure, Acute1
Not AvailableUnknown StatusTreatmentMalignant Lymphomas1
Not AvailableWithdrawnTreatmentAgnogenic Myeloid Metaplasia / MF1
Not AvailableWithdrawnTreatmentHuman Immunodeficiency Virus (HIV) Infections1
Not AvailableWithdrawnTreatmentRetinoblastoma1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous; Subcutaneous30000000 [units of filgrastim]/0.5ml
Injection, solutionIntravenous; Subcutaneous48000000 [units of filgrastim]/0.5ml
Injection, solutionIntravenous; Subcutaneous30 MIU
Injection, solutionIntravenous; Subcutaneous48 MIU
SolutionIntravenous; Subcutaneous480 mcg
Injection, solutionIntravenous300 ug/mL
Injection, solutionIntravenous300 ug/.5mL
Injection, solutionIntravenous480 ug/.8mL
Injection, solutionIntravenous; Subcutaneous300 ug/.5mL
Injection, solutionIntravenous; Subcutaneous300 ug/mL
Injection, solutionIntravenous; Subcutaneous480 ug/1.6mL
Injection, solutionIntravenous; Subcutaneous480 ug/.8mL
SolutionIntravenous; Subcutaneous300 mcg
SolutionIntravenous; Subcutaneous600 mcg
Injection, solutionIntravenous; Subcutaneous12000000 [units of filgrastim]/0.2mL
Prices
Unit descriptionCostUnit
Neupogen 480 mcg/0.8ml Solution 1 Box Contains Ten 0.8ml Syringes4998.24USD box
Neupogen 480 mcg/1.6ml Solution 1 Box Contains Ten 1.6ml Syringes4554.58USD box
Neupogen 300 mcg/0.5ml Solution 1 Box Contains Ten 0.5ml Syringes3138.1USD box
Neupogen 480 mcg/1.6 ml vial437.94USD ml
Neupogen 300 mcg/ml vial286.04USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339071 No1997-07-292014-07-29Canada
CA1341537 No2007-07-312024-07-31Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point (°C)60 °CLuo, P., Protein Science 11:1218-1226 (2002)
hydrophobicity0.209Not Available
isoelectric point5.65Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
stimulator
General Function:
Receptor activity
Specific Function:
Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
Gene Name:
CSF3R
Uniprot ID:
Q99062
Uniprot Name:
Granulocyte colony-stimulating factor receptor
Molecular Weight:
92155.615 Da
References
  1. Erkeland SJ, Aarts LH, Irandoust M, Roovers O, Klomp A, Valkhof M, Gits J, Eyckerman S, Tavernier J, Touw IP: Novel role of WD40 and SOCS box protein-2 in steady-state distribution of granulocyte colony-stimulating factor receptor and G-CSF-controlled proliferation and differentiation signaling. Oncogene. 2007 Mar 29;26(14):1985-94. Epub 2006 Sep 25. [PubMed:17001306 ]
  2. Link DC, Kunter G, Kasai Y, Zhao Y, Miner T, McLellan MD, Ries RE, Kapur D, Nagarajan R, Dale DC, Bolyard AA, Boxer LA, Welte K, Zeidler C, Donadieu J, Bellanne-Chantelot C, Vardiman JW, Caligiuri MA, Bloomfield CD, DiPersio JF, Tomasson MH, Graubert TA, Westervelt P, Watson M, Shannon W, Baty J, Mardis ER, Wilson RK, Ley TJ: Distinct patterns of mutations occurring in de novo AML versus AML arising in the setting of severe congenital neutropenia. Blood. 2007 Sep 1;110(5):1648-55. Epub 2007 May 9. [PubMed:17494858 ]
  3. Cao YR, Shao ZH, Liu H, Shi J, Bai J, Tu MF, Wang HQ, Xing LM, Cui ZZ, Sun J, Jia HR, Yang TY: [The response of bone marrow hematopoietic cells to G-CSF in paroxysmal nocturnal hemoglobinuria patients]. Zhonghua Xue Ye Xue Za Zhi. 2005 Apr;26(4):235-8. [PubMed:15949269 ]
  4. Ward AC: The role of the granulocyte colony-stimulating factor receptor (G-CSF-R) in disease. Front Biosci. 2007 Jan 1;12:608-18. [PubMed:17127322 ]
  5. Zhuang D, Qiu Y, Haque SJ, Dong F: Tyrosine 729 of the G-CSF receptor controls the duration of receptor signaling: involvement of SOCS3 and SOCS1. J Leukoc Biol. 2005 Oct;78(4):1008-15. Epub 2005 Jul 20. [PubMed:16033816 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
other/unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis.
Gene Name:
ELANE
Uniprot ID:
P08246
Uniprot Name:
Neutrophil elastase
Molecular Weight:
28517.81 Da
References
  1. Carter CR, Whitmore KM, Thorpe R: The significance of carbohydrates on G-CSF: differential sensitivity of G-CSFs to human neutrophil elastase degradation. J Leukoc Biol. 2004 Mar;75(3):515-22. Epub 2003 Dec 4. [PubMed:14657210 ]
  2. Jian MY, Koizumi T, Tsushima K, Fujimoto K, Kubo K: Effects of granulocyte colony-stimulating factor (G-CSF) and neutrophil elastase inhibitor (ONO-5046) on acid-induced lung injury in rats. Inflammation. 2004 Dec;28(6):327-36. [PubMed:16245075 ]
  3. Donini M, Fontana S, Savoldi G, Vermi W, Tassone L, Gentili F, Zenaro E, Ferrari D, Notarangelo LD, Porta F, Facchetti F, Notarangelo LD, Dusi S, Badolato R: G-CSF treatment of severe congenital neutropenia reverses neutropenia but does not correct the underlying functional deficiency of the neutrophil in defending against microorganisms. Blood. 2007 Jun 1;109(11):4716-23. Epub 2007 Feb 20. [PubMed:17311988 ]
  4. Schepers H, Wierenga AT, van Gosliga D, Eggen BJ, Vellenga E, Schuringa JJ: Reintroduction of C/EBPalpha in leukemic CD34+ stem/progenitor cells impairs self-renewal and partially restores myelopoiesis. Blood. 2007 Aug 15;110(4):1317-25. Epub 2007 May 2. [PubMed:17475913 ]
  5. Druhan LJ, Ai J, Massullo P, Kindwall-Keller T, Ranalli MA, Avalos BR: Novel mechanism of G-CSF refractoriness in patients with severe congenital neutropenia. Blood. 2005 Jan 15;105(2):584-91. Epub 2004 Sep 7. [PubMed:15353486 ]
  6. El Ouriaghli F, Fujiwara H, Melenhorst JJ, Sconocchia G, Hensel N, Barrett AJ: Neutrophil elastase enzymatically antagonizes the in vitro action of G-CSF: implications for the regulation of granulopoiesis. Blood. 2003 Mar 1;101(5):1752-8. Epub 2002 Oct 17. [PubMed:12393522 ]
Drug created on June 13, 2005 07:24 / Updated on May 31, 2017 11:38