Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Name
Filgrastim
Accession Number
DB00099  (BTD00072, BIOD00072, DB09560)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Haematopoietic growth factors
Description

Chemotherapy-induced neutropenia (CIN) is a common and serious complication of myelosuppressive chemotherapy. It is associated with significant morbidity and mortality and can increase the cost of cancer therapy. In these cases, colony stimulating factor is necessary to restore important cells for immune function 3.

For over twenty years, granulocyte colony-stimulating factors (G-CSFs; filgrastims) have been a pillar of treatment and prevention of CIN, and have been found to reduce the risk of neutropenia across various patient settings, decrease the incidence of febrile neutropenia, reduce the incidence of infection, reduce the requirement for treatment with antibiotics, and accelerate neutrophil recovery 3.

Filgrastim is a recombinant, non-pegylated human granulocyte colony stimulating factor (G-CSF) analog. It is marketed as the brand name Neupogen by Amgen (initially approved in 1998) and as Nivestym, a biosimilar agent by Pfizer. Nivestym was approved by the FDA on July 20th, 2018 5. Between 1998 and the present, Neupogen/filgrastim has been approved for various indications 8.

Tbo-filgrastim, which is marketed by Sicor Biotech and FDA approved on August 29, 2012, contains the same active ingredient as Neupogen and is biologically similar, but it is formulated to be short-acting 10. On March 6, 2015, the FDA approved the biosimilar Zarxio (filgrastim-sndz) and is indicated for use in the same conditions as Neupogen. Zarxio is marketed by Sandoz 7.

Protein structure
Db00099
Protein chemical formula
C845H1343N223O243S9
Protein average weight
18800.0 Da
Sequences
>Amino acid sequence for filgrastim
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWA
PLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQ
QMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Download FASTA Format
Synonyms
  • Filgrastim-aafi
  • Filgrastim-sndz
  • G-CSF
  • Granulocyte Colony Stimulating Factor
  • Tbo-filgrastim
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution30000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
AccofilInjection, solution48000000 [units of filgrastim]/0.5mlIntravenous; SubcutaneousAccord Healthcare Limited2014-09-18Not applicableEu
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
International/Other Brands
Biocilin / Biofigran / Biofilgran / Endufil / Filatil / Filgen / Gran / Granulokine / Grimatin / Inmunef / Jiexin / Leucogen / Leucostim / Macroleuco / Neukine / Neutromax / Neutroval (Sicor Biotech) / Recombicyte / SciLocyte / Tevagastrim / White-C / Zarzio
Categories
UNII
PVI5M0M1GW
CAS number
121181-53-1

Pharmacology

Indication

This drug is a leucocyte growth factor Label indicated to:

Decrease the incidence of infection‚ as manifested by febrile neutropenia‚ in patients with nonmyeloid malignancies receiving myelosuppressive anti-cancer drugs associated with a significant incidence of severe neutropenia with fever Label.

Reduce the time to neutrophil recovery and the duration of fever, following induction or consolidation chemotherapy treatment in patients with acute myeloid leukemia (AML) Label

Reduce the duration of neutropenia and neutropenia-related clinical sequelae‚ e.g.‚ febrile neutropenia, in patients with nonmyeloid malignancies undergoing myeloablative chemotherapy followed by bone marrow transplantation (BMT) Label

Mobilize autologous hematopoietic progenitor cells into the peripheral blood for collection by leukapheresis Label

Reduce the incidence and duration of sequelae of severe neutropenia (e.g.‚ fever‚ infections‚ oropharyngeal ulcers) in symptomatic patients with congenital neutropenia‚ cyclic neutropenia‚ or idiopathic neutropenia Label.

Neupogen is approved for treatment of patients with radiation-induced myelosuppression following a radiological/nuclear incident 6.

Associated Conditions
Associated Therapies
Pharmacodynamics

Filgrastim binds to the G-CSF receptor and stimulates the production of neutrophils in the bone marrow Label. Colony-stimulating factors are glycoproteins which act on hematopoietic cells by binding to specific cell surface receptors, in turn, stimulating proliferation and differentiation 9.

G-CSF and its receptor are necessary for basal and stress-induced granulopoiesis, which forms neutrophils. Mice deficient in G-CSF or G-CSFR have severe neutropenia and reduced levels (~50%) of late-stage neutrophil precursors in the bone marrow under normal, resting conditions 4.

Endogenous G-CSF is a lineage-specific colony-stimulating factor that is produced by monocytes‚ fibroblasts, and endothelial cells. G-CSF regulates the production of neutrophils within the bone marrow and enhances neutrophil progenitor proliferation‚ differentiation, and selected end-cell functions (including enhanced phagocytic ability‚ priming of the cellular metabolism associated with respiratory burst‚ antibody-dependent killing, and enhanced expression of certain cell surface antigens). G-CSF is not species-specific and has demonstrated to have negligible direct in vivo or in vitro effects on the production or action of hematopoietic cell types other than the neutrophil and its lineage9.

Mechanism of action

As a G-CSF analog, this drug controls the proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Filgrastim also stimulates the release of neutrophils from bone marrow storage pools and decreases their time to maturation. Filgrastim acts to increase the phagocytic activity of mature neutrophils, thus allowing them to prevent infection. In patients receiving cytotoxic chemotherapy, filgrastim may accelerate neutrophil recovery, leading to a reduction in the duration of the neutropenic phase post chemotherapy Label.

Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils, filgrastim acts on hematopoietic cells by binding to specific cell surface receptors, thereby stimulating proliferation, differentiation, commitment, and end cell functional activation. In one efficacy study, levels of neutrophils returned to baseline by 21 days following completion of chemotherapy and the administration of tbo-filgrastim (fast-acting) 10.

In phase 1 studies involving 96 patients with various non-myeloid malignancies‚ filgrastim administration resulted in a dose-dependent increase in circulating neutrophil counts over the dose range of 1 to 70 mcg/kg/day.

This increase in neutrophil counts was seen whether filgrastim was administered intravenous (1 to 70 mcg/kg twice daily)‚ subcutaneous (1 to 3 mcg/kg once daily)‚ or by continuous subcutaneous (SC) infusion (3 to 11 mcg/kg/day). After the discontinuation of filgrastim therapy‚ neutrophil counts returned to baseline in most cases within only 4 days after Nevistym was used Label.

TargetActionsOrganism
AGranulocyte colony-stimulating factor receptor
stimulator
Humans
UNeutrophil elastase
other/unknown
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Absorption and clearance of Neupogen follows first-order pharmacokinetics without concentration dependence. Subcutaneous administration of 3.45 mcg/kg and 11.5 mcg/kg of filgrastim resulted in maximum serum concentrations of 4 and 49 ng/mL‚ respectively‚ within 2-8 hours Label. Filgrastim does not accumulate. It is estimated that when filgrastim is subcutaneously administered, the absolute bioavailability is approximately 62% and 71% for 375 mcg and 750 mcg doses respectively. When 5 mcg/kg tbo-filgrastim is subcutaneously administered, the absolute bioavailability is 33%. It takes 4-6 hours for tho-filgrastim to reach maximum concentration 10.

Volume of distribution

150 mL/kg Label

Protein binding
Not Available
Metabolism
Not Available
Route of elimination

Filgrastim products demonstrate nonlinear pharmacokinetics. The clearance is dependent on filgrastim product concentration in addition to neutrophil count. G-CSF receptor-mediated clearance is saturated by a high concentration of filgrastim products and is diminished by neutropenia. In addition, filgrastim products are cleared by the kidney 9.

Half life

Elimination half-life was approximately 3.5 hours in both normal subjects and cancer subjects Label

Clearance

0.5 - 0.7 mL/minute/kg after SC administration of 3.45 mcg/kg and 11.5 mcg/kg in both normal subjects and cancer patients Label

Toxicity

There are numerous adverse effects associated with Filgastrim. They are organized by organ system as follows:

Generalized effects

Serious allergic reactions, including anaphylaxis: Permanently discontinue NIVESTYM in patients with serious allergic reactions. With non-myeloid malignancies receiving myelosuppressive anti-cancer drugs (≥ 5% difference in incidence compared to placebo) are pyrexia, pain, rash, cough, and dyspnea Label. With AML (≥ 2% difference in incidence) are pain, epistaxis and rash Label. With severe chronic neutropenia (SCN) (≥ 5% difference in incidence) are pain, anemia, epistaxis, diarrhea, hypoesthesia, and alopecia Label.

Musculoskeletal system

Exacerbation of arthritic symptoms has been uncommonly observed 9.

Spleen

Fatal splenic rupture: Evaluate patients who report left upper abdominal or shoulder pain for an enlarged spleen or splenic rupture. Cases of splenomegaly and splenic rupture have been reported uncommonly following administration of filgrastim. Some cases of splenic rupture were fatal Label.

Respiratory system

Acute respiratory distress syndrome (ARDS): Evaluate patients who develop fever and lung infiltrates or respiratory distress for ARDS. Discontinue filgrastim in patients with ARDS Label. Pulmonary adverse effects, in particular interstitial lung disease, have been reported after G-CSF administration. Patients with a recent history of lung infiltrates or pneumonia may be at higher risk. The onset of pulmonary signs, such as cough, fever and dyspnea in association with radiological signs of pulmonary infiltrates and deterioration in pulmonary function may be preliminary signs of acute respiratory distress syndrome (ARDS). Filgrastim should be discontinued and appropriate treatment should be given 9.

Hematological system

Fatal sickle cell crises have occurred.

The granulocyte-colony stimulating factor can promote the malignant growth of myeloid cells in vitro and the same effects may be seen on some non-myeloid cells in vitro. The safety and efficacy of filgrastim administration in patients with myelodysplastic syndrome, or chronic myelogenous leukemia have not been established. Filgrastim is not indicated for use in these conditions. Particular care should be taken to distinguish the diagnosis of blast transformation of chronic myeloid leukemia from acute myeloid leukemia 9.

Capillary leak syndrome has been reported after granulocyte colony-stimulating factor administration, and is characterised by hypotension, hypoalbuminaemia, edema and hemoconcentration. Patients who show symptoms of capillary leak syndrome must be closely monitored and receive standard symptomatic treatment, which may include a need for intensive care 9.

Leukocytosis (white blood cell (WBC) > 50 x 109/l) was seen in 41% of donors and transient thrombocytopenia (platelets < 100 x 109/l) following filgrastim and leukapheresis was observed in 35% of donors 9.

Renal system

This drug increases the risk of glomerulonephritis. Evaluate and consider dose-reduction or interruption of filgrastim if causality is likely Label.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
BleomycinThe risk or severity of pulmonary toxicity can be increased when Filgrastim is combined with Bleomycin.
CyclophosphamideThe risk or severity of pulmonary toxicity can be increased when Filgrastim is combined with Cyclophosphamide.
TopotecanThe risk or severity of neutropenia can be increased when Filgrastim is combined with Topotecan.
VinblastineThe risk or severity of peripheral neuropathy can be increased when Filgrastim is combined with Vinblastine.
VincamineThe risk or severity of peripheral neuropathy can be increased when Filgrastim is combined with Vincamine.
VincristineThe risk or severity of peripheral neuropathy can be increased when Filgrastim is combined with Vincristine.
VindesineThe risk or severity of peripheral neuropathy can be increased when Filgrastim is combined with Vindesine.
VinflunineThe risk or severity of peripheral neuropathy can be increased when Filgrastim is combined with Vinflunine.
VinorelbineThe risk or severity of peripheral neuropathy can be increased when Filgrastim is combined with Vinorelbine.
VintafolideThe risk or severity of peripheral neuropathy can be increased when Filgrastim is combined with Vintafolide.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

Synthesis Reference

Tetsuro Kuga, Hiromasa Miyaji, Moriyuki Sato, Masami Okabe, Makoto Morimoto, Seiga Itoh, Motoo Yamasaki, Yoshiharu Yokoo, Kazuo Yamaguchi, Hajime Yoshida, Yoshinori Komatsu, "Method of producing a polypeptide having human granulocyte colony stimulating factor activity." U.S. Patent US5994518, issued February, 1988.

US5994518
General References
  1. Wang B, Ludden TM, Cheung EN, Schwab GG, Roskos LK: Population pharmacokinetic-pharmacodynamic modeling of filgrastim (r-metHuG-CSF) in healthy volunteers. J Pharmacokinet Pharmacodyn. 2001 Aug;28(4):321-42. [PubMed:11677930]
  2. Krzyzanski W, Wiczling P, Lowe P, Pigeolet E, Fink M, Berghout A, Balser S: Population modeling of filgrastim PK-PD in healthy adults following intravenous and subcutaneous administrations. J Clin Pharmacol. 2010 Sep;50(9 Suppl):101S-112S. doi: 10.1177/0091270010376966. [PubMed:20881223]
  3. Kamioner D, Fruehauf S, Maloisel F, Cals L, Lepretre S, Berthou C: Study design: two long-term observational studies of the biosimilar filgrastim Nivestim (Hospira filgrastim) in the treatment and prevention of chemotherapy-induced neutropenia. BMC Cancer. 2013 Nov 16;13:547. doi: 10.1186/1471-2407-13-547. [PubMed:24237790]
  4. Panopoulos AD, Watowich SS: Granulocyte colony-stimulating factor: molecular mechanisms of action during steady state and 'emergency' hematopoiesis. Cytokine. 2008 Jun;42(3):277-88. doi: 10.1016/j.cyto.2008.03.002. Epub 2008 Apr 8. [PubMed:18400509]
  5. FDA Approves Second Neupogen Biosimilar, Nivestym [Link]
  6. FDA Approves Radiation Medical Countermeasure [Link]
  7. Zarxio [Link]
  8. Drugs Approved by the FDA document [Link]
  9. EMA label [File]
  10. TBO filgrastim [File]
External Links
UniProt
P09919
Genbank
X03438
KEGG Drug
D03235
PubChem Substance
46505833
ChEMBL
CHEMBL1201567
Therapeutic Targets Database
DAP000113
PharmGKB
PA449626
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Filgrastim
ATC Codes
L03AA02 — Filgrastim
AHFS Codes
  • 20:16.00 — Hematopoietic Agents
FDA label
Download (2.27 MB)
MSDS
Download (125 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentAutologous Transplant / Malignant Lymphoma, Stem Cell Type1
0CompletedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Waldenström's Macroglobulinemia (WM)1
0CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Post Transplant Lymphoproliferative Disorder / Primary Mediastinal (Thymic) Large B-cell Lymphoma1
0CompletedTreatmentPeripheral Vascular Disease (PVD)1
0CompletedTreatmentPrecursor Cell Lymphoblastic Leukemia-Lymphoma1
0Enrolling by InvitationSupportive CareBiliary Atresia1
0RecruitingTreatmentAgnogenic Myeloid Metaplasia / Hematopoietic Cell Transplantation Recipient / Primary Myelofibrosis / Secondary Myelofibrosis1
0RecruitingTreatmentHLA-A2 Positive Cells Present / Metastatic Malignant Neoplasm / Metastatic Malignant Neoplasm in the Brain1
0RecruitingTreatmentInherited Immune Deficiencies1
0RecruitingTreatmentMetastatic Pheochromocytoma / Relapsed Neuroblastoma1
0SuspendedTreatmentMultiple Myeloma (MM)1
0TerminatedTreatmentMultiple Myeloma (MM)1
0WithdrawnTreatmentMultiple Myeloma (MM) / Myeloma-Multiple1
1Active Not RecruitingOtherOrthopedic Disorders / Stem Cells1
1Active Not RecruitingPreventionAcute Leukemia in Remission / Chronic Myeloid Leukemia (CML) / Chronic Myelomonocytic Leukemia / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Non-Hodgkin's Lymphoma (NHL) / Primary Myelofibrosis1
1Active Not RecruitingTreatmentAIDS Related Non-Hodgkin Lymphoma / AIDS-Related Burkitt Lymphoma / AIDS-Related Diffuse Large B-cell Lymphoma / AIDS-Related Plasmablastic Lymphoma / AIDS-Related Primary Effusion Lymphoma / Human Immunodeficiency Virus (HIV) Infections1
1Active Not RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome1
1Active Not RecruitingTreatmentAdult Central Nervous System Germ Cell Tumor / Adult Rhabdomyosarcoma / Childhood Central Nervous System Germ Cell Tumor / Childhood Soft Tissue Sarcoma / Ewing's Sarcoma (ES) / Metastatic Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Ovarian Mixed Germ Cell Tumor / Previously Untreated Childhood Rhabdomyosarcoma / Recurrent Adult Brain Tumor / Recurrent Adult Soft Tissue Sarcoma / Recurrent Childhood Brain Stem Glioma / Recurrent Childhood Cerebellar Astrocytoma / Recurrent Childhood Cerebral Astrocytoma / Recurrent Childhood Ependymoma / Recurrent Childhood Malignant Germ Cell Tumor / Recurrent Childhood Medulloblastoma / Recurrent Childhood Pineoblastoma / Recurrent Childhood Supratentorial Primitive Neuroectodermal Tumor / Recurrent Childhood Visual Pathway and Hypothalamic Glioma / Recurrent Childhood Visual Pathway Glioma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Extragonadal Germ Cell Tumor / Recurrent Extragonadal Non-seminomatous Germ Cell Tumor / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Neuroblastoma / Recurrent Ovarian Germ Cell Tumor / Recurrent Wilms Tumor and Other Childhood Kidney Tumors / Tumors, Solid / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
1Active Not RecruitingTreatmentAdult Solid Neoplasm1
1Active Not RecruitingTreatmentCancer of the Ovary / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
1Active Not RecruitingTreatmentCancer, Breast1
1Active Not RecruitingTreatmentCancer, Breast / Neoplasms Metastasis / Neoplasms, Colorectal1
1Active Not RecruitingTreatmentChildhood Solid Tumors1
1Active Not RecruitingTreatmentCongenital Hypoplastic Anemia1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Tumors, Solid1
1Active Not RecruitingTreatmentMalignant Lymphomas1
1Active Not RecruitingTreatmentMantle Cell Lymphoma (MCL)1
1Active Not RecruitingTreatmentMultiple Myeloma, Refractory to Standard Treatment / Relapsed Multiple Myeloma1
1Active Not RecruitingTreatmentPlasma Cell Myeloma1
1CompletedNot AvailableChemotherapy Patients1
1CompletedNot AvailableHealthy Volunteers1
1CompletedNot AvailableNeutropenias1
1CompletedBasic ScienceNeutropenia (Low White Blood Cell Count)2
1CompletedHealth Services ResearchHealthy Volunteers1
1CompletedOtherHealthy Volunteers2
1CompletedOtherLeucocytosis1
1CompletedSupportive CareChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1CompletedSupportive CareChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Precancerous/Nonmalignant Condition1
1CompletedSupportive CareMalignancies1
1CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Multiple Myeloma (MM) / Myelodysplastic Syndrome1
1CompletedTreatmentAcute Myelogenous Leukaemia (AML) / Leukemias1
1CompletedTreatmentAdult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Myelomonocytic Leukemia (M4) / Adult Acute Promyelocytic Leukemia (M3) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Recurrent Adult Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia1
1CompletedTreatmentAdvanced Cancers1
1CompletedTreatmentAdvanced Solid Tumors1
1CompletedTreatmentAplastic Anaemia (AA)1
1CompletedTreatmentBladder Cancers / Cancer of the Ovary / Cancer, Breast / Carcinoma of Unknown Primary / Esophageal Cancers / Head and Neck Carcinoma / Lung Cancers / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Melanoma (Skin) / Prostate Cancer / Sarcomas1
1CompletedTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter2
1CompletedTreatmentBrain and Central Nervous System Tumors1
1CompletedTreatmentBrain and Central Nervous System Tumors / Cancer of the Ovary / Childhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Liver Cancer / Neuroblastomas / Sarcomas / Testicular germ cell tumour1
1CompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas / Neuroblastomas / Retinoblastoma1
1CompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas / Unspecified Childhood Solid Tumor, Protocol Specific1
1CompletedTreatmentBrenner Tumor / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Carcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Ovarian Undifferentiated Adenocarcinoma / Stage III Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
1CompletedTreatmentCD20 Positive / Chronic Lymphocytic Leukaemia (CLL) / Follicular Lymphoma (FL) / Leukemias / Malignant Lymphomas / Mantle Cell Lymphoma (MCL) / Marginal Zone Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / T-Cell Non-Hodgkin Lymphoma1
1CompletedTreatmentCancer of the Ovary1
1CompletedTreatmentCancer of the Ovary / Fallopian Tube Cancer / Peritoneal Cavity Cancer1
1CompletedTreatmentCancer of the Ovary / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
1CompletedTreatmentCancer of the Ovary / Peritoneal Cavity Cancer1
1CompletedTreatmentCancer, Breast4
1CompletedTreatmentCancer, Breast / Neutropenias1
1CompletedTreatmentCardiac Toxicity / Unspecified Childhood Solid Tumor, Protocol Specific1
1CompletedTreatmentChildhood Central Nervous System Germ Cell Tumor / Childhood Choroid Plexus Tumor / Childhood Craniopharyngioma / Childhood Ependymoblastoma / Childhood Grade I Meningioma / Childhood Grade II Meningioma / Childhood Grade III Meningioma / Childhood High-grade Cerebellar Astrocytoma / Childhood High-grade Cerebral Astrocytoma / Childhood Infratentorial Ependymoma / Childhood Low-grade Cerebellar Astrocytoma / Childhood Low-grade Cerebral Astrocytoma / Childhood Medulloepithelioma / Childhood Mixed Glioma / Childhood Oligodendroglioma / Childhood Supratentorial Ependymoma / Recurrent Childhood Brain Stem Glioma / Recurrent Childhood Cerebellar Astrocytoma / Recurrent Childhood Cerebral Astrocytoma / Recurrent Childhood Ependymoma / Recurrent Childhood Medulloblastoma / Recurrent Childhood Pineoblastoma / Recurrent Childhood Subependymal Giant Cell Astrocytoma / Recurrent Childhood Supratentorial Primitive Neuroectodermal Tumor / Recurrent Childhood Visual Pathway and Hypothalamic Glioma1
1CompletedTreatmentChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Precancerous/Nonmalignant Condition / Small Intestine Cancer1
1CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1CompletedTreatmentCrohn's Disease (CD)1
1CompletedTreatmentCutaneous Lymphomas / Multiple Myeloma (MM)1
1CompletedTreatmentDisseminated Sclerosis2
1CompletedTreatmentEndometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Mixed Adenocarcinoma / Endometrial Serous Adenocarcinoma / Endometrial Squamous Cell Carcinoma / Endometrial Undifferentiated Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer1
1CompletedTreatmentEwing's Sarcoma (ES) / High-risk Sarcoma / MPNST / Rhabdomyosarcomas / Synovial Sarcoma1
1CompletedTreatmentFallopian Tube Carcinoma / Infectious Disorder / Neutropenias / Ovarian Carcinosarcoma / Primary Peritoneal Carcinoma / Stage III Ovarian Cancer / Stage IV Ovarian Cancer1
1CompletedTreatmentHealthy Male Subjects1
1CompletedTreatmentHealthy Volunteers3
1CompletedTreatmentHematopoietic Stem Cell Transplantation (HSCT)1
1CompletedTreatmentHigh-risk Tumor / Malignant Lymphomas / Neuroblastomas1
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections2
1CompletedTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1CompletedTreatmentLeukemias7
1CompletedTreatmentLeukemias / Malignant Lymphomas1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentLeukemias / Myelodysplastic Syndrome2
1CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1CompletedTreatmentLeukemias / Neutropenias1
1CompletedTreatmentLiver Cirrhosis1
1CompletedTreatmentMalignancies1
1CompletedTreatmentMalignant Lymphomas3
1CompletedTreatmentMalignant Lymphomas / Small Intestine Cancer / Unspecified Adult Solid Tumor, Protocol Specific2
1CompletedTreatmentMelanoma (Skin)3
1CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Lymphoepithelioma of the Oropharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1CompletedTreatmentMiscellaneous Peripheral Blood Cell Abnormalities1
1CompletedTreatmentMultiple Myeloma (MM)1
1CompletedTreatmentMultiple Myeloma, Plasma Cell Leukemia1
1CompletedTreatmentMyelodysplastic Syndromes1
1CompletedTreatmentNeoplasms, Brain / Neuroblastomas / Sarcomas / Tumors, Central Nervous System1
1CompletedTreatmentNeuroblastomas6
1CompletedTreatmentNeutropenias / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentRecurrent Neuroblastoma / Unspecified Childhood Solid Tumor, Protocol Specific1
1CompletedTreatmentRefractory Multiple Myeloma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
1CompletedTreatmentSarcomas2
1CompletedTreatmentSclerosis, Progressive Systemic1
1CompletedTreatmentSevere Combined Immunodeficiency1
1CompletedTreatmentStem Cell Transplant Patients1
1CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific3
1CompletedTreatmentUnspecified Childhood Solid Tumor, Protocol Specific1
1Not Yet RecruitingTreatmentBone Metastases / Sarcoma, Osteogenic1
1RecruitingOtherBlood Component Removal / Blood Donors / Granulocyte Colony-Stimulation Factor / Leukocyte Transfusion1
1RecruitingTreatmentAcute Myelogenous Leukaemia (AML)1
1RecruitingTreatmentAcute myeloid leukaemia (in remission) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Adult Acute Lymphoblastic Leukemia in Complete Remission / Aplastic Anaemia (AA) / Blasts Under 10 Percent of Bone Marrow Nucleated Cells / Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Chronic Myelomonocytic Leukemia / Chronic, recurrent Lymphocytic Leukemia / Hematopoietic Cell Transplantation Recipient / Leukemias / Minimal Residual Disease / Myeloproliferative Neoplasms / Plasma Cell Myeloma / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma / Recurrent Small Lymphocytic Lymphoma / Therapy-Related Myelodysplastic Syndrome1
1RecruitingTreatmentAcute myeloid leukaemia (in remission) / Hematopoietic Cell Transplantation Recipient1
1RecruitingTreatmentAgnogenic Myeloid Metaplasia / Leukemias / Malignant Lymphomas / Smith-Magenis Syndrome1
1RecruitingTreatmentAllogeneic Hematopoietic Stem Cell Transplant Recipient / Blasts 15 Percent or Less of Bone Marrow Nucleated Cells / Blasts 5 Percent or Less of Bone Marrow Nucleated Cells / Secondary Myelofibrosis1
1RecruitingTreatmentAnaplastic Astrocytoma (AA) / Anaplastic Ependymoma / Anaplastic Ganglioglioma / Anaplastic Meningioma / Anaplastic Oligodendroglioma (AO) / Atypical Teratoid/Rhabdoid Tumor / Brain Cancer / Central Nervous System Neoplasms / Choroid Plexus Carcinoma / CNS Embryonal Tumor With Rhabdoid Features / CNS Tumors / Embryonal Tumor of CNS / Embryonal Tumor With Multilayered Rosettes (ETMR) / Embryonal Tumor, NOS / Ependymoma, NOS, WHO Grade II / Ependymoma, NOS, WHO Grade III / Ependymoma, Recurrent / Ependymoma, RELA Fusion Positive / Ependymomas / Ganglioneuroblastoma of Central Nervous System / Glioblastoma, IDH-mutant / Glioblastoma, IDH-wildtype / Glioblastomas / Glioma, Diffuse Midline, H3K27M-mutant / Glioma, High Grade / Glioma, Malignant / Glioma, Recurrent High Grade / Glioma, Recurrent Malignant / Gliomas / Medulloblastoma, Chromosome 9q Loss / Medulloblastoma, G3/G4 / Medulloblastoma, Group 3 / Medulloblastoma, Group 4 / Medulloblastoma, Non-WNT Non-SHH, NOS / Medulloblastoma, Non-WNT/Non-SHH / Medulloblastoma, PTCH1 Mutation / Medulloblastoma, SHH-activated and TP53 Mutant / Medulloblastoma, SHH-activated and TP53 Wildtype / Medulloblastoma, WNT-activated / Medulloblastoma; Unspecified Site / Medulloblastomas / Medulloepithelioma / Neoplasms / Neoplasms, Brain / Neoplasms, Neuroepithelial / Neuroblastoma. CNS / Neuroepithelial Tumor / Neuroepithelial Tumor, High Grade / Papillary Tumor of the Pineal Region (High-grade Only) / Pediatric Brain Tumor / Pineal Parenchymal Tumor of Intermediate Differentiation (High-grade Only) / Pinealoblastoma / Pleomorphic Xanthoastrocytoma, Anaplastic / Primitive Neuroectodermal Tumor / Recurrent Medulloblastoma / Refractory Brain Tumor1
1RecruitingTreatmentAnn Arbor Stage II Diffuse Large B-Cell Lymphoma / Ann Arbor Stage III Diffuse Large B-Cell Lymphoma / Ann Arbor Stage IV Diffuse Large B-Cell Lymphoma / CD20 Negative / CD20 Positive / HIV Positivity / Human Immunodeficiency Virus Positive / Lymphoma, AIDS Related / Stage II Diffuse Large B-Cell Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma1
1RecruitingTreatmentBrain Cancer / Brain Tumor, Pediatric / Brain Tumor, Refractory / Central Nervous System Neoplasms / Cns Cancer / CNS Tumors / Medulloblastoma, Non-WNT/Non-SHH / Medulloblastoma, Non-WNT/Non-SHH, Group 3 / Medulloblastoma, Non-WNT/Non-SHH, Group 4 / Medulloblastomas / Neoplasms, Brain / Recurrent Brain Tumors / Recurrent Medulloblastoma1
1RecruitingTreatmentChemotherapy Induced Neutropenia1
1RecruitingTreatmentClear Cell Sarcoma of Soft Tissue / Ewing's Sarcoma (ES) / Germ Cell Tumors / Hepatoblastomas / Neuroblastomas / Non-rhabdomyosarcoma Soft Tissue Sarcomas / Renal Cell Adenocarcinoma / Retinoblastoma / Rhabdoid Tumors / Rhabdomyosarcomas / Sarcoma, Osteogenic / Wilms' tumor1
1RecruitingTreatmentCoronary Artery Atherosclerosis1
1RecruitingTreatmentHLA-A*0201 Positive Cells Present / Locally Advanced Malignant Neoplasm / NY-ESO-1 Positive / Unresectable Malignant Neoplasm1
1RecruitingTreatmentHidradenitis Suppurativa (HS) / Palmoplantar Pustulosis1
1RecruitingTreatmentIncrease of Muscle Strength in Patients With Muscular Dystrophy1
1RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)2
1RecruitingTreatmentMalignancies / Neoplasms / Neuroendocrine Tumors / Tumors1
1RecruitingTreatmentMultiple Myeloma (MM)2
1RecruitingTreatmentPeripheral Arterial Disease (PAD)1
1RecruitingTreatmentPostmenopausal Syndrome1
1TerminatedSupportive CareBrain and Central Nervous System Tumors / Cancer of the Ovary / Childhood Germ Cell Tumor / Chordomas / Liver Cancer / Neuroblastomas / Renal Cancers / Retinoblastoma / Sarcomas1
1TerminatedSupportive CareMalignant Lymphomas / Neutropenias1
1TerminatedTreatmentAIDS-related Peripheral/Systemic Lymphoma / AIDS-related Primary CNS Lymphoma / Post Transplant Lymphoproliferative Disorder / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma1
1TerminatedTreatmentAcute Leukemias of Ambiguous Lineage / Adult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With Inv(16)(p13.1q22); CBFB-MYH11 / Adult Acute Myeloid Leukemia With t(16;16)(p13.1;q22); CBFB-MYH11 / Adult Acute Myeloid Leukemia With t(8;21)(q22;q22); RUNX1-RUNX1T1 / Adult Acute Myeloid Leukemia With t(8;21); (q22; q22.1); RUNX1-RUNX1T1 / Adult Acute Myeloid Leukemia With t(9;11)(p22.3;q23.3); MLLT3-KMT2A / Adult Acute Myeloid Leukemia With t(9;11)(p22;q23); MLLT3-MLL / Adult Acute Promyelocytic Leukemia With PML-RARA / Adult Acute Promyelocytic Leukemia With t(15;17)(q22;q12); PML-RARA / Alkylating Agent-Related Acute Myeloid Leukemia / Childhood Acute Myeloid Leukemia in Remission / Leukemia Acute Myeloid Leukemia (AML) / Recurrent Adult Acute Myeloid Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia1
1TerminatedTreatmentAdult Solid Neoplasm / Colorectal Adenocarcinoma / Pancreatic Adenocarcinoma Metastatic / Recurrent Breast Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Melanoma of the Skin / Recurrent Non-Small Cell Lung Carcinoma / Recurrent Pancreatic Carcinoma / Renal Cell Carcinoma Recurrent / Solid Neoplasms / Stage IV Breast Cancer / Stage IV Non-Small Cell Lung Cancer / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Colorectal Cancer / Stage IVA Pancreatic Cancer / Stage IVB Colorectal Cancer / Stage IVB Pancreatic Cancer1
1TerminatedTreatmentAplastic Anaemia (AA)1
1TerminatedTreatmentBone Marrow Suppression / Brain and Central Nervous System Tumors / Drug/Agent Toxicity by Tissue/Organ / Long-Term Effects Secondary to Cancer Therapy in Children1
1TerminatedTreatmentBrain and Central Nervous System Tumors / Liver Cancer / Renal Cancers / Retinoblastoma / Sarcomas1
1TerminatedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas / Unspecified Adult Solid Tumor, Protocol Specific1
1TerminatedTreatmentCancer of the Ovary / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
1TerminatedTreatmentCancer, Breast1
1TerminatedTreatmentCancer, Breast / Malignant Lymphomas1
1TerminatedTreatmentDisseminated Neuroblastoma / Recurrent Neuroblastoma1
1TerminatedTreatmentDrug/Agent Toxicity by Tissue/Organ / Multiple Myeloma and Plasma Cell Neoplasm1
1TerminatedTreatmentLeukemia Acute Myeloid Leukemia (AML)2
1TerminatedTreatmentLeukemias1
1TerminatedTreatmentLung Cancer Metastatic / Sarcoma, Osteogenic1
1TerminatedTreatmentMalignant Neoplasm of Pancreas / Metastatic Cancers / Pancreatic Cancer Metastatic / Tumors, Solid1
1TerminatedTreatmentMyasthenia Gravis1
1TerminatedTreatmentMyopathies1
1TerminatedTreatmentProstate Cancer1
1TerminatedTreatmentRheumatoid Arthritis1
1TerminatedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1TerminatedTreatmentUnspecified Childhood Solid Tumor, Protocol Specific1
1TerminatedTreatmentVasculitis1
1Unknown StatusTreatmentCancer, Breast3
1Unknown StatusTreatmentCongenital Hypoplastic Anemia1
1Unknown StatusTreatmentEnd Stage Liver Diseases1
1Unknown StatusTreatmentInfertilities1
1Unknown StatusTreatmentLeukemias / Malignant Lymphomas1
1Unknown StatusTreatmentMalignant Lymphomas1
1Unknown StatusTreatmentMelanoma (Skin)2
1Unknown StatusTreatmentProstate Cancer1
1Unknown StatusTreatmentStroke, Ischemic1
1Unknown StatusTreatmentSystemic Lupus Erythematosus (SLE)1
1WithdrawnTreatmentCNS 2a / CNS 2b / CNS 2c / CNS1 / Recurrent Adult Acute Myeloid Leukemia / Recurrent Childhood Acute Myeloid Leukemia1
1WithdrawnTreatmentHLA-A*0201 Positive Cells Present / NY-ESO-1 Positive Tumor Cells Present / Recurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
1WithdrawnTreatmentHuman Immunodeficiency Virus (HIV) Infections / Human Immunodeficiency Virus 1 Positive / Stage I Adult Hodgkin Lymphoma / Stage I Adult Non-Hodgkin Lymphoma / Stage II Adult Hodgkin Lymphoma / Stage II Adult Non-Hodgkin Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Adult Non-Hodgkin Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Non-Hodgkin Lymphoma1
1WithdrawnTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1WithdrawnTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes1
1WithdrawnTreatmentLeukemias / Malignant Lymphomas / Pediatric Disorders / Transplantation, Stem Cell1
1WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Active Not RecruitingTreatmentAcute Biphenotypic Leukemia (ABL) / De Novo Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Secondary Myelodysplastic Syndromes / Untreated Adult Acute Myeloid Leukemia1
1, 2Active Not RecruitingTreatmentAdult Glioblastoma / Adult Gliosarcoma / Glioblastomas / Gliosarcoma1
1, 2Active Not RecruitingTreatmentAtypical Parkinson Disease / Atypical Parkinsonism / Cerebral Palsy (CP) / Hemorrhagic Strokes / Neurological Diseases / Stroke, Ischemic1
1, 2Active Not RecruitingTreatmentCongenital Hypoplastic Anemia1
1, 2Active Not RecruitingTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Myelodysplastic Syndromes1
1, 2Active Not RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)3
1, 2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas1
1, 2Active Not RecruitingTreatmentDe Novo Myelodysplastic Syndrome / Mixed Phenotype Acute Leukemia (MPAL) / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Recurrent High Risk Myelodysplastic Syndrome / Refractory Acute Myeloid Leukemia / Refractory High Risk Myelodysplastic Syndrome / Untreated Adult Acute Myeloid Leukemia1
1, 2Active Not RecruitingTreatmentMultiple Myeloma-Light Chain Only / Plasma Cell Myeloma / Recurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
1, 2Active Not RecruitingTreatmentNeuromyelitis Optica1
1, 2Active Not RecruitingTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
1, 2Active Not RecruitingTreatmentRefractory Multiple Myeloma / Smoldering Multiple Myeloma (SMM) / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
1, 2Active Not RecruitingTreatmentStiff Person Syndrome / Stiff-Person Syndrome1
1, 2CompletedPreventionFeeding Intolerance / Necrotizing Enterocolitis1
1, 2CompletedSupportive CareAcute Lymphoblastic Leukaemias (ALL) / Chronic Myeloid Leukemia (CML) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplasia1
1, 2CompletedTreatmentAcute Lymphocytic Leukemia (ALL)1
1, 2CompletedTreatmentAcute Lymphocytic Leukemia (ALL) / Leukemias1
1, 2CompletedTreatmentAcute Myeloblastic Leukemia1
1, 2CompletedTreatmentAcute Myocardial Infarction (AMI)1
1, 2CompletedTreatmentAcute Undifferentiated Leukemia (AUL) / B-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / L1 Adult Acute Lymphoblastic Leukemia / L1 Childhood Acute Lymphoblastic Leukemia / L2 Adult Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia / Philadelphia Chromosome Negative Adult Precursor Acute Lymphoblastic Leukemia / Philadelphia Chromosome Positive Adult Precursor Acute Lymphoblastic Leukemia / Philadelphia Chromosome Positive Childhood Precursor Acute Lymphoblastic Leukemia / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
1, 2CompletedTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Promyelocytic Leukemia (M3) / Leukemia Acute Myeloid Leukemia (AML) / Recurrent Adult Acute Myeloid Leukemia1
1, 2CompletedTreatmentAlzheimer's Disease (AD)1
1, 2CompletedTreatmentAplastic Anaemia (AA)1
1, 2CompletedTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter1
1, 2CompletedTreatmentBlasts 5 Percent or More of Bone Marrow Nucleated Cells / Recurrent Childhood Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Therapy-Related Acute Myeloid Leukemia1
1, 2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer of the Ovary / Childhood Germ Cell Tumor / Head and Neck Carcinoma / Neuroblastomas / Renal Cancers / Sarcomas / Testicular germ cell tumour1
1, 2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer of the Ovary / Extragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
1, 2CompletedTreatmentCancer of the Ovary1
1, 2CompletedTreatmentCancer of the Ovary / Cancer, Breast / Leukemias / Malignant Lymphomas / Neuroblastomas / Sarcomas / Unspecified Adult Solid Tumor, Protocol Specific1
1, 2CompletedTreatmentCancer of the Ovary / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
1, 2CompletedTreatmentCancer of the Ovary / Primary Peritoneal Cavity Cancer1
1, 2CompletedTreatmentCancer of the Ovary / Testicular germ cell tumour1
1, 2CompletedTreatmentCancer, Breast5
1, 2CompletedTreatmentCancer, Breast / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic/Myeloproliferative Diseases1
1, 2CompletedTreatmentCancer, Breast / Neutropenias1
1, 2CompletedTreatmentCerebral Palsy (CP) / G-CSF / Neurodegeneration / Peripheral Blood Mononuclear Cells1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias / Malignant Lymphomas1
1, 2CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms / Precancerous Conditions1
1, 2CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Myelodysplastic Syndromes / Thrombocytopenias1
1, 2CompletedTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1, 2CompletedTreatmentCongenital Hypoplastic Anemia1
1, 2CompletedTreatmentDrug/Agent Toxicity by Tissue/Organ / Lung Cancers / Radiation Toxicity1
1, 2CompletedTreatmentHead and Neck Carcinoma1
1, 2CompletedTreatmentHodgkins Disease (HD) / Malignant Lymphomas1
1, 2CompletedTreatmentHodgkins Disease (HD) / Non-Hodgkin's Lymphoma (NHL)1
1, 2CompletedTreatmentInfection NOS / Multiple Myeloma and Plasma Cell Neoplasm1
1, 2CompletedTreatmentInfertility, Female1
1, 2CompletedTreatmentLeukemia Acute Myeloid Leukemia (AML) / Smith-Magenis Syndrome1
1, 2CompletedTreatmentLeukemia, Acute / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Non-Hodgkin's Disease1
1, 2CompletedTreatmentLeukemia, Plasma Cell / Multiple Myeloma (MM)1
1, 2CompletedTreatmentLeukemias3
1, 2CompletedTreatmentLeukemias / Malignant Lymphomas3
1, 2CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Neuroblastomas / Renal Cancers / Sarcomas1
1, 2CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
1, 2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1, 2CompletedTreatmentLeukemias / Transplantation, Stem Cell1
1, 2CompletedTreatmentLymphoma, B-Cell / Lymphoma, Large-Cell, Diffuse1
1, 2CompletedTreatmentMalignant Lymphomas5
1, 2CompletedTreatmentMalignant Lymphomas / Non Hodgkin Lymphoma (NHL)1
1, 2CompletedTreatmentMalignant Neoplasm of Pancreas / Metastatic Cancers / Pancreatic Cancer Metastatic / Tumors, Solid1
1, 2CompletedTreatmentMelanoma (Skin)1
1, 2CompletedTreatmentNeutropenias1
1, 2CompletedTreatmentPancreatic Adenocarcinoma Metastatic1
1, 2CompletedTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
1, 2CompletedTreatmentRecurrent Childhood Acute Lymphoblastic Leukemia1
1, 2CompletedTreatmentRelapsed/Refractory Acute Myeloid Leukemia (AML)1
1, 2CompletedTreatmentRenal Cancers1
1, 2CompletedTreatmentSarcomas2
1, 2Not Yet RecruitingTreatmentAllogeneic Hematopoietic Stem Cell Transplant Recipient / Donor / Hematopoietic and Lymphoid Cell Neoplasm1
1, 2Not Yet RecruitingTreatmentCD19 Positive / Mantle Cell Lymphoma (MCL) / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma1
1, 2Not Yet RecruitingTreatmentMultiple Myeloma (MM)1
1, 2RecruitingTreatmentAcute Biphenotypic Leukemia (ABL) / De Novo Myelodysplastic Syndrome / High Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Myeloproliferative Neoplasms1
1, 2RecruitingTreatmentAcute Lymphoblastic Leukemia in Remission / Acute myeloid leukaemia (in remission) / Chronic Myelomonocytic Leukemia / Myeloproliferative Neoplasm, Unclassifiable1
1, 2RecruitingTreatmentAcute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplant Recipient / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / Donor / Leukemia Acute Myeloid Leukemia (AML) / Malignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Refractory Acute Myeloid Leukemia1
1, 2RecruitingTreatmentBlasts 10 Percent or More of Bone Marrow Nucleated Cells / Blasts 10 Percent or More of Peripheral Blood White Cells / High-Grade Myeloid Neoplasm / Leukemia Acute Myeloid Leukemia (AML)1
1, 2RecruitingTreatmentCongenital Hypoplastic Anemia2
1, 2RecruitingTreatmentCrohn's Disease (CD)1
1, 2RecruitingTreatmentEmphysema or COPD / Idiopathic Pulmonary Fibrosis (IPF)1
1, 2RecruitingTreatmentHaploidentical Hematopoietic Stem Cell Transplantation / Malignant Diseases / Non-malignant Diseases1
1, 2RecruitingTreatmentAcute, recurrent Myeloid Leukemia / High Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Other Diseases of Blood and Blood-Forming Organs / Refractory Acute Myeloid Leukemia1
1, 2RecruitingTreatmentLeukemias / Recurrent Adult Acute Myeloid Leukemia / Refractory Acute Myeloid Leukemia1
1, 2RecruitingTreatmentProstate Cancer1
1, 2RecruitingTreatmentRefractory Non-Hodgkin's lymphoma / Relapsed Non Hodgkin Lymphoma1
1, 2TerminatedTreatmentAllogeneic Hematopoietic Stem Cell Transplantation Recipient / Chronic Lymphocytic Leukaemia (CLL) / Leukemia, Prolymphocytic / Leukemias / Richter's Syndrome1
1, 2TerminatedTreatmentCancer of the Ovary1
1, 2TerminatedTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Waldenström's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentHead and Neck Carcinoma1
1, 2TerminatedTreatmentInfertility, Female1
1, 2TerminatedTreatmentLeukemia, Plasma Cell / Multiple Myeloma (MM)1
1, 2TerminatedTreatmentLeukemias1
1, 2TerminatedTreatmentLeukemias / Myeloproliferative Disorders / Plasma Cell Myeloma1
1, 2TerminatedTreatmentMale Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2TerminatedTreatmentMultiple Myeloma (MM)1
1, 2TerminatedTreatmentMyelodysplastic Syndromes1
1, 2TerminatedTreatmentNeoplasm Metastases / Neoplasms, Breast1
1, 2TerminatedTreatmentNeoplasms, Brain / Tumors, Central Nervous System1
1, 2TerminatedTreatmentPain NOS / Prostate Cancer1
1, 2TerminatedTreatmentRelapsed T-Cell Acute Lymphoblastic Leukemia / Relapsed T-Cell Lymphoblastic Lymphoma1
1, 2TerminatedTreatmentStage IV (Metastatic) Breast Cancer1
1, 2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Cancer of the Ovary / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
1, 2Unknown StatusTreatmentCancer of the Ovary / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
1, 2Unknown StatusTreatmentCancer, Breast3
1, 2Unknown StatusTreatmentCritical Limb Ischemia (CLI) / Diabetic Foot / Ulcer, Leg1
1, 2Unknown StatusTreatmentLeukemia, Acute / Myelodysplastic Syndrome / Tumors, Solid1
1, 2Unknown StatusTreatmentMalignant Lymphomas1
1, 2Unknown StatusTreatmentProstate Cancer1
1, 2WithdrawnTreatmentCancer, Breast1
1, 2WithdrawnTreatmentLarge-Cell Lymphoma, Diffuse / Lymphoma, Diffuse Large-Cell / Lymphoma, Diffuse Large-Cell B-cell / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
1, 2WithdrawnTreatmentLeukemias1
1, 2WithdrawnTreatmentMalignant Lymphomas1
1, 2WithdrawnTreatmentMyelodysplastic Syndromes1
1, 2WithdrawnTreatmentPlasma Cell Leukemia in Remission / Plasma Cell Myeloma1
2Active Not RecruitingTreatmentAccelerated Phase Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Acute Biphenotypic Leukemia (ABL) / Acute Lymphoblastic Leukaemias (ALL) / Acute Lymphoblastic Leukemia in Remission / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Chemotherapy-Related Leukemia / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Chronic Myelomonocytic Leukemia / Hematopoietic/Lymphoid Cancer / Langerhans Cell Histiocytosis (LCH) / Leukemia Acute Myeloid Leukemia (AML) / Leukemia, Acute / Lymphoma, Hodgkins / Minimal Residual Disease / Myelodysplastic Syndrome / Myelodysplastic Syndrome With Excess Blasts / Non-Hodgkin's Lymphoma (NHL) / Recurrent Hodgkin Lymphoma / Refractory Acute Lymphoblastic Leukemia / Refractory Myelodysplastic Syndrome / Small Lymphocytic Lymphoma (SLL) / Therapy-Related Myelodysplastic Syndrome1
2Active Not RecruitingTreatmentAcute Biphenotypic Leukemia (ABL) / Acute Lymphoblastic Leukemia (ALL)/T Lymphoblastic Lymphoma / Acute Myelogenous Leukaemia (AML) / Acute Undifferentiated Leukemia (AUL) / Chemotherapy-sensitive Lymphoma / Chronic Lymphocytic Leukaemia (CLL) / Myelodysplastic Syndromes (MDS)1
2Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult Acute Lymphoblastic Leukemia in Remission / Adult B Acute Lymphoblastic Leukemia / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Adult L1 Acute Lymphoblastic Leukemia / Adult L2 Acute Lymphoblastic Leukemia / Adult T Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Agnogenic Myeloid Metaplasia / Chronic Chronic myelogenous leukemia / Chronic Lymphocytic Leukaemia (CLL) / Leukemia Acute Myeloid Leukemia (AML) / Leukemia, Prolymphocytic / Leukemias / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Non-Hodgkin's Lymphoma (NHL) / Refractory Anemia / Smith-Magenis Syndrome1
2Active Not RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myeloid Leukemia (CML) / Leukemia Acute Myeloid Leukemia (AML) / Leukemias / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Myeloproliferative Disorders / Non-Hodgkin's Lymphoma (NHL)1
2Active Not RecruitingTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Adenosquamous Lung Carcinoma / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Large Cell Lung Carcinoma / Lung Adenosquamous Carcinoma / Lung Large Cell Carcinoma / Lung Squamous Cell Carcinoma / Minimally Invasive Lung Adenocarcinoma / Squamous Cell Carcinoma of Lung / Squamous Cell Lung Carcinoma / Stage IIIA Lung Non-Small Cell Cancer AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Lung Non-Small Cell Cancer AJCC v7 / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v71
2Active Not RecruitingTreatmentAdvanced Myelodysplastic Syndromes / Leukemia Acute Myeloid Leukemia (AML)1
2Active Not RecruitingTreatmentCancer, Breast1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Lymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Lymphoma, Low-Grade / Mantle Cell Lymphoma (MCL) / Small Lymphocytic Lymphoma (SLL) / T-Cell Lymphomas1
2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Active Not RecruitingTreatmentInflammatory carcinoma of the breast / Male Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingTreatmentLeukemias2
2Active Not RecruitingTreatmentLymphoma, Hodgkins2
2Active Not RecruitingTreatmentMalignant Lymphomas5
2Active Not RecruitingTreatmentMalignant Lymphomas / Mantle Cell Lymphoma (MCL)1
2Active Not RecruitingTreatmentMalignant Lymphomas / Nonneoplastic Condition1
2Active Not RecruitingTreatmentMetastatic Colorectal Adenocarcinoma1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)3
2Active Not RecruitingTreatmentNeoplasms, Brain / Tumors, Central Nervous System1
2Active Not RecruitingTreatmentRetinoblastoma1
2Active Not RecruitingTreatmentSarcomas1
2Active Not RecruitingTreatmentStage II Childhood Hodgkin Lymphoma / Stage III Childhood Hodgkin Lymphoma / Stage IV Childhood Hodgkin Lymphoma1
2Active Not RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2CompletedNot AvailableAcute Myocardial Infarction (AMI)1
2CompletedDiagnosticMalignant Lymphomas1
2CompletedOtherNon-Metastatic Breast Cancer1
2CompletedPreventionCancer of the Ovary / Endometrial Cancers / Uterine Cervical Cancer1
2CompletedPreventionNeutropenias / Sarcomas1
2CompletedSupportive CareAnemias / Leukemias / Neutropenias / Thrombocytopenias1
2CompletedSupportive CareBrain and Central Nervous System Tumors1
2CompletedSupportive CareCancer, Breast / Chemotherapeutic Agent Toxicity / Neutropenias1
2CompletedSupportive CareChemotherapy Induced Neutropenia1
2CompletedSupportive CareColorectal Cancers1
2CompletedSupportive CareDrug/Agent Toxicity by Tissue/Organ / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Oral Complications / Radiation Toxicity1
2CompletedSupportive CareGastrointestinal Complications / Severe or persistent diarrhea / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedSupportive CareInfection NOS / Leukemia Acute Myeloid Leukemia (AML) / Neutropenias1
2CompletedSupportive CareLeukemias / Malignant Lymphomas / Oral Complications1
2CompletedSupportive CareLung Cancers1
2CompletedSupportive CareMalignant Lymphomas / Neutropenias1
2CompletedSupportive CareMultiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentAIDS-Associated Lymphoma / Lymphoma, AIDS Related1
2CompletedTreatmentAcute Ischemic Stroke (AIS)1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2CompletedTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myelogenous Leukaemia (AML) / Advanced Myeloproliferative Disease / Chronic Myeloid Leukemia (CML) / Lymphoproliferative Disease / Multiple Myeloma (MM) / Myelodysplasia / Non-Hodgkin's Lymphoma (NHL) / Severe Aplastic Anemia (SAA)1
2CompletedTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myelogenous Leukaemia (AML) / Chronic Chronic myelogenous leukemia / Chronic Lymphocytic Leukaemia (CLL) / Hodgkins Disease (HD) / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Non-Hodgkin's Lymphoma (NHL) / Peripheral T-Cell Lymphoma (PTCL)1
2CompletedTreatmentAcute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Adult Acute Myeloid Leukemia in Remission1
2CompletedTreatmentAcute Myeloid Leukemia With Multilineage Dysplasia Following Myelodysplastic Syndrome / Adult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / De Novo Myelodysplastic Syndromes / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML)1
2CompletedTreatmentAcute Myeloid Leukemia With Myelodysplasia-Related Changes / Adult Acute Myeloid Leukemia With Inv(16)(p13.1q22); CBFB-MYH11 / Adult Acute Myeloid Leukemia With t(16;16)(p13.1;q22); CBFB-MYH11 / Adult Acute Myeloid Leukemia With t(8;21)(q22;q22); RUNX1-RUNX1T1 / Adult Acute Myeloid Leukemia With t(8;21); (q22; q22.1); RUNX1-RUNX1T1 / Adult Acute Myeloid Leukemia With t(9;11)(p22.3;q23.3); MLLT3-KMT2A / Adult Acute Myeloid Leukemia With t(9;11)(p22;q23); MLLT3-MLL / Leukemia Acute Myeloid Leukemia (AML) / Untreated Adult Acute Myeloid Leukemia1
2CompletedTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Small Cell Carcinoma / Cervical Squamous Cell Carcinoma / Recurrent Cervical Carcinoma / Stage III Cervical Cancer / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Non-Small Cell Lung Cancer Recurrent / Squamous Cell Carcinoma of Lung / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2CompletedTreatmentAdult Acute Lymphoblastic Leukemia in Remission1
2CompletedTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Chronic Myelomonocytic Leukemia / De Novo Myelodysplastic Syndromes / Myeloproliferative Neoplasm With 10% Blasts or Higher / Refractory Anemia With Excess Blasts / Untreated Adult Acute Myeloid Leukemia1
2CompletedTreatmentAdult Lymphocyte Depletion Hodgkin Lymphoma / Adult Lymphocyte Predominant Hodgkin Lymphoma / Adult Mixed Cellularity Hodgkin Lymphoma / Adult Nodular Lymphocyte Predominant Hodgkin Lymphoma / Adult Nodular Sclerosis Hodgkin Lymphoma / Childhood Lymphocyte Depletion Hodgkin Lymphoma / Childhood Lymphocyte Predominant Hodgkin Lymphoma / Childhood Mixed Cellularity Hodgkin Lymphoma / Childhood Nodular Lymphocyte Predominant Hodgkin Lymphoma / Childhood Nodular Sclerosis Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma / Stage I Adult Hodgkin Lymphoma / Stage I Childhood Hodgkin Lymphoma / Stage II Adult Hodgkin Lymphoma / Stage II Childhood Hodgkin Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Childhood Hodgkin Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Childhood Hodgkin Lymphoma1
2CompletedTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Multiple Myeloma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Waldenström's Macroglobulinemia (WM)1
2CompletedTreatmentAdvanced Multiple Myeloma2
2CompletedTreatmentAllogeneic Marrow Transplant / Leukemias / Myelodysplastic Syndrome / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentAll / Aplastic Anaemia (AA) / Chronic Lymphocytic Leukaemia (CLL) / CML Chronic Phase, Accelerated Phase, or Blast Crisis / Leukemia Acute Myeloid Leukemia (AML) / Multiple Myeloma (MM) / MYELOPROLIFERATIVE DISORDER (P Vera, CMML, ET) / Relapsed non-Hodgkin's or Hodgkin's lymphoma / Smith-Magenis Syndrome1
2CompletedTreatmentAlveolar Childhood Rhabdomyosarcoma / Embryonal Childhood Rhabdomyosarcoma / Embryonal-botryoid Childhood Rhabdomyosarcoma / Previously Treated Childhood Rhabdomyosarcoma / Recurrent Childhood Rhabdomyosarcoma1
2CompletedTreatmentAlzheimer's Disease (AD)1
2CompletedTreatmentAmyotrophic Lateral Sclerosis (ALS)1
2CompletedTreatmentAmyotrophic Lateral Sclerosis (ALS) / Stroke, Chronic1
2CompletedTreatmentAnemia, Hemolytic, Autoimmune / Autoimmune Diseases / Felty's Syndrome / Thrombocytopenic Purpura1
2CompletedTreatmentAnti-p53 TCR-Gene1
2CompletedTreatmentAplastic Anaemia (AA) / Myelodysplastic Syndrome1
2CompletedTreatmentAplastic Anaemia (AA) / Paroxysmal Hemoglobinuria, Nocturnal1
2CompletedTreatmentAutologous Stem Cell Transplantation1
2CompletedTreatmentAutologous Stem Cell Transplantation / Lymphoma, Hodgkins / Mobilization of hematopoietic stem cells therapy / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentB-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Lymphoblastic Lymphoma / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia1
2CompletedTreatmentB-cell Non-Hodgkin's Lymphomas / Malignant Lymphomas1
2CompletedTreatmentBladder Cancers1
2CompletedTreatmentBladder Cancers / Brain and Central Nervous System Tumors / Cancer of the Ovary / Carcinoma of Unknown Primary / Extragonadal Germ Cell Tumor / Head and Neck Carcinoma / Lung Cancers / Renal Cancers / Sarcomas / Testicular germ cell tumour / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter1
2CompletedTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter / Urethral Cancer1
2CompletedTreatmentBlood And Marrow Transplantation1
2CompletedTreatmentBlood Cancers / Chronic Lymphocytic Leukaemia (CLL) / Graft Versus Host Disease (GVHD) / Hodgkins Disease (HD) / Leukemias / Malignancies / NHL / Smith-Magenis Syndrome1
2CompletedTreatmentBlood Cancers / Leukemias1
2CompletedTreatmentBlood Cancers / Multiple Myeloma (MM)1
2CompletedTreatmentBlood Stem Cell Transplant Failure / Leukemias / Malignancies, Hematologic1
2CompletedTreatmentBlood and Marrow Transplant (BMT) / Multiple Myeloma (MM) / Transplantation, Autologous / Transplantation, Homologous1
2CompletedTreatmentBone Marrow Ablation / Leukemias1
2CompletedTreatmentBrain and Central Nervous System Tumors8
2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer of the Ovary / Childhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Retinoblastoma / Testicular germ cell tumour / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedTreatmentBrain and Central Nervous System Tumors / Cancer of the Ovary / Extragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
2CompletedTreatmentBrain and Central Nervous System Tumors / Head and Neck Carcinoma / Malignant Lymphomas1
2CompletedTreatmentBrain and Central Nervous System Tumors / Neuroblastomas1
2CompletedTreatmentBrain and Central Nervous System Tumors / Neuroblastomas / Sarcomas1
2CompletedTreatmentBurkitt's Lymphoma / Burkitt'S-like Lymphoma1
2CompletedTreatmentCD20 Positive / Hematopoietic and Lymphoid Cell Neoplasm / Lymphocytic Neoplasm / Malignant Lymphomas1
2CompletedTreatmentCancer of the Ovary1
2CompletedTreatmentCancer of the Ovary / Cancer, Breast / Gestational Trophoblastic Disease / Malignant Lymphomas / Neuroblastomas / Renal Cancers / Sarcomas / Testicular germ cell tumour1
2CompletedTreatmentCancer of the Ovary / Childhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Head and Neck Carcinoma / Liver Cancer / Malignant Lymphomas / Neuroblastomas / Renal Cancers / Retinoblastoma / Sarcomas / Testicular germ cell tumour1
2CompletedTreatmentCancer of the Ovary / Extragonadal Germ Cell Tumor1
2CompletedTreatmentCancer of the Ovary / Fallopian Tube Cancer / Peritoneal Cavity Cancer1
2CompletedTreatmentCancer of the Ovary / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
2CompletedTreatmentCancer of the Ovary / Sarcomas1
2CompletedTreatmentCancer of the Ovary / Sarcomas / Small Intestine Cancer2
2CompletedTreatmentCancer, Breast16
2CompletedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentCancer, Breast / Neoplasms, Breast1
2CompletedTreatmentCancer, Breast / Neutropenia, Febrile / Neutropenias1
2CompletedTreatmentCancer, Breast / Neutropenias1
2CompletedTreatmentCarcinoid tumour of the gastrointestinal tract / Extrahepatic Bile Duct Cancer / Liver Cancer / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Small Intestine Cancer1
2CompletedTreatmentCarcinoma of Head/Neck / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentCarcinoma of Unknown Primary / Lung Cancers1
2CompletedTreatmentCentral Nervous System Tumor, Pediatric1
2CompletedTreatmentCerebral Stroke1
2CompletedTreatmentCervical Cancers1
2CompletedTreatmentChemotherapy Induced Neutropenia1
2CompletedTreatmentChildhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / Stage I Childhood Large Cell Lymphoma / Stage I Childhood Small Noncleaved Cell Lymphoma / Stage II Childhood Large Cell Lymphoma / Stage II Childhood Small Noncleaved Cell Lymphoma / Stage III Childhood Large Cell Lymphoma / Stage III Childhood Small Noncleaved Cell Lymphoma / Stage IV Childhood Large Cell Lymphoma / Stage IV Childhood Small Noncleaved Cell Lymphoma / Untreated Childhood Acute Lymphoblastic Leukemia1
2CompletedTreatmentChildhood Extracranial Germ Cell Tumor / Childhood Extragonadal Germ Cell Tumor / Childhood Extragonadal Malignant Germ Cell Tumor / Childhood Malignant Ovarian Germ Cell Tumor / Childhood Malignant Testicular Germ Cell Tumor / Ovarian Choriocarcinoma / Ovarian Embryonal Carcinoma / Ovarian Yolk Sac Tumor / Recurrent Childhood Malignant Germ Cell Tumor / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Ovarian Germ Cell Tumor / Testicular Choriocarcinoma / Testicular Choriocarcinoma and Embryonal Carcinoma / Testicular Choriocarcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma / Testicular Embryonal Carcinoma and Yolk Sac Tumor / Testicular Mixed Choriocarcinoma and Embryonal Carcinoma / Testicular Mixed Choriocarcinoma and Yolk Sac Tumor / Testicular Mixed Embryonal Carcinoma and Yolk Sac Tumor / Testicular Yolk Sac Tumor1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias2
2CompletedTreatmentChronic Myeloproliferative Disorders1
2CompletedTreatmentColorectal Cancers / Metastatic Cancers1
2CompletedTreatmentCongenital Hypoplastic Anemia / Dyskeratosis Congenita / Shwachman Syndrome / Thrombocytopenias1
2CompletedTreatmentCongestive Cardiomyopathy2
2CompletedTreatmentContiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma1
2CompletedTreatmentContiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Stage I Mantle Cell Lymphoma / Stage III Mantle Cell Lymphoma / Stage IV Mantle Cell Lymphoma1
2CompletedTreatmentCytopenias / Human Immunodeficiency Virus (HIV) Infections1
2CompletedTreatmentDiamond Blackfan Anemia1
2CompletedTreatmentDisseminated Sclerosis / Relapsing Remitting Multiple Sclerosis (RRMS)1
2CompletedTreatmentDistal Urethral Cancer / Metastatic Bladder Cancer / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Proximal Urethral Cancer / Recurrent Bladder Cancer / Recurrent Transitional Cell Cancer of the Renal Pelvis and Ureter / Recurrent Urethral Cancer / Regional Transitional Cell Cancer of the Renal Pelvis and Ureter / Stage III Bladder Cancer / Transitional Cell Carcinoma of the Bladder / Urethral Cancer Associated With Invasive Bladder Cancer1
2CompletedTreatmentEsophageal Cancers1
2CompletedTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2CompletedTreatmentEstrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / Her2-Positive Breast Cancer / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer1
2CompletedTreatmentEstrogen Receptor-Positive Breast Cancer / Her2-Positive Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentEwing's Sarcoma (ES) / Neuroblastomas / Non-rhabdomyosarcoma Soft Tissue Sarcomas1
2CompletedTreatmentEwing's Sarcoma (ES) / Neuroblastomas / Rhabdomyosarcomas1
2CompletedTreatmentExtensive Stage Small Cell Lung Cancer1
2CompletedTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
2CompletedTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Myelodysplastic Syndromes1
2CompletedTreatmentHead and Neck Carcinoma3
2CompletedTreatmentHead and Neck Carcinoma / Lung Cancers1
2CompletedTreatmentHematological Neoplasms / Tumors1
2CompletedTreatmentHematology / Lymphoma, Hodgkins / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL) / Oncology1
2CompletedTreatmentHemoglobinuria, Paroxysmal Nocturnal (PNH) / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia Acute Myeloid Leukemia (AML) / Leukemia, Acute Lymphocytic (ALL) / Leukemia, Myeloid, Chronic(CML) / Lymphoma, Hodgkins / Lymphoma, Non-Hodgkin (NHL) / Myelodysplastic Syndromes (MDS)1
2CompletedTreatmentHodgkins Disease (HD)2
2CompletedTreatmentHodgkins Disease (HD) / Human Immunodeficiency Virus (HIV) Infections1
2CompletedTreatmentHodgkins Disease (HD) / Leukaemia, Lymphoblastic / Multiple Myeloma (MM) / Myelogenous Leukemia / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentHodgkins Disease (HD) / Malignant Lymphomas / Multiple Myeloma (MM) / Non Hodgkin Lymphoma (NHL)1
2CompletedTreatmentHodgkins Disease (HD) / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)2
2CompletedTreatmentHodgkins Disease (HD) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentHodgkins Disease (HD) / Pediatric1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Progressive Multifocal Leukoencephalopathy1
2CompletedTreatmentInflammatory carcinoma of the breast / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2CompletedTreatmentLeukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome1
2CompletedTreatmentLeukemia, Mast-Cell / Mantle Cell Lymphoma (MCL)1
2CompletedTreatmentLeukemia, Myelocytic, Acute1
2CompletedTreatmentLeukemias28
2CompletedTreatmentLeukemias / Lymphoproliferative Disorders / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
2CompletedTreatmentLeukemias / Malignant Lymphomas8
2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Myeloproliferative Neoplasms / Plasma Cell Neoplasms1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myleoma / Myelodysplastic Syndrome / Myeloproliferative Disorders1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic-Myeloproliferative Diseases1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms2
2CompletedTreatmentLeukemias / Malignant Lymphomas / Transplantation, Stem Cell1
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases2
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Neutropenias1
2CompletedTreatmentChronic Chronic myelogenous leukemia / Leukemias1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2CompletedTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2CompletedTreatmentLung Cancers5
2CompletedTreatmentLymphoma, B-Cell1
2CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Poor prognosis1
2CompletedTreatmentMale Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer1
2CompletedTreatmentMalignant Lymphoma, Stem Cell Type1
2CompletedTreatmentMalignant Lymphomas50
2CompletedTreatmentMalignant Lymphomas / Mantle Cell Lymphoma (MCL)1
2CompletedTreatmentMalignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm1
2CompletedTreatmentMalignant Lymphomas / Plasma Cell Myeloma2
2CompletedTreatmentMalignant Lymphomas / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedTreatmentMalignant Neoplasm of Pancreas1
2CompletedTreatmentMalignant Neoplasm of Stomach1
2CompletedTreatmentMelanoma (Skin)2
2CompletedTreatmentMelanoma (Skin) / Renal Cancers1
2CompletedTreatmentMelanoma / Neoplasms Metastasis1
2CompletedTreatmentMetastatic Bone Sarcomas1
2CompletedTreatmentMetastatic Breast Cancer (MBC)1
2CompletedTreatmentMetastatic Renal Cell Carcinoma / Renal Cell Carcinoma With Sarcomatoid Features1
2CompletedTreatmentMultiple Myeloma (MM)8
2CompletedTreatmentMultiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)5
2CompletedTreatmentMultiple Myeloma (MM) / Plasma Cell Myeloma2
2CompletedTreatmentMultiple Myeloma (MM) / Plasma Cell Neoplasms1
2CompletedTreatmentMultiple Myeloma (MM) / Refractory Multiple Myeloma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
2CompletedTreatmentLight chain amyloidosis / Multiple Myeloma (MM)1
2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm7
2CompletedTreatmentMyelodysplastic Syndrome1
2CompletedTreatmentMyeloid Leukemias1
2CompletedTreatmentMyocardial Infarction1
2CompletedTreatmentNasopharyngeal Carcinoma1
2CompletedTreatmentNeoplasms Metastasis / Neoplasms, Breast1
2CompletedTreatmentNeoplasms, Brain / Neuroblastomas / Tumors, Central Nervous System1
2CompletedTreatmentNeoplasms, Brain / Tumors, Central Nervous System1
2CompletedTreatmentNeoplasms, Breast2
2CompletedTreatmentNeoplasms, Ovarian1
2CompletedTreatmentNeuroblastomas7
2CompletedTreatmentNeurofibromatosis Type 1 / Sarcomas1
2CompletedTreatmentNeutropenias1
2CompletedTreatmentNeutropenias / Sarcomas1
2CompletedTreatmentNeutropenias / Tumors, Solid1
2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)4
2CompletedTreatmentPemphigus1
2CompletedTreatmentPeripheral T-Cell Lymphoma (PTCL)1
2CompletedTreatmentPlasma Cell Myeloma2
2CompletedTreatmentPrimary Central Nervous System Lymphoma (PCNSL)1
2CompletedTreatmentProstate Cancer2
2CompletedTreatmentRecurrent Uterine Corpus Sarcoma / Uterine Corpus Leiomyosarcoma1
2CompletedTreatmentRenal Cancers1
2CompletedTreatmentRetinoblastoma2
2CompletedTreatmentSarcomas10
2CompletedTreatmentStroke, Ischemic1
2CompletedTreatmentSystemic Lupus Erythematosus (SLE)1
2CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentWilms' tumor1
2CompletedTreatmentWomen With Primary Breast Cancer1
2Enrolling by InvitationTreatmentAcute Myocardial Infarction (AMI) / Acute Myocardial Ischemia / ST Elevation Myocardial Infarction (STEMI)1
2Enrolling by InvitationTreatmentChronic Chagasic Myocarditis1
2Not Yet RecruitingSupportive CareEndometriosis / Recurrent Implantation Failure (RIF)1
2Not Yet RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / B Acute Lymphoblastic Leukemia / CD22 Positive / Lymphocytic Neoplasm / Malignant Lymphomas1
2Not Yet RecruitingTreatmentAcute Myeloid Leukemia Recurrent / Acute Myeloid Leukemia, Relapsed, Adult / Adult Acute Myeloid Leukemia1
2Not Yet RecruitingTreatmentHNSCC / HPV-Related Squamous Cell Carcinoma / Human Papilloma Virus (HPV) / Squamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Not Yet RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
2Not Yet RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Malignancies1
2RecruitingPreventionCancer, Breast / Neutropenia, Febrile / Neutropenias1
2RecruitingPreventionMultiple Myeloma (MM)1
2RecruitingTreatmentAccelerated Phase Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Acute Lymphoblastic Leukaemia Recurrent / Acute Lymphoblastic Leukaemias (ALL) / Acute Myeloid Leukemia With BCR-ABL1 / Blast Phase Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Philadelphia Chromosome Positive / Refractory Acute Lymphoblastic Leukemia1
2RecruitingTreatmentAcute Biphenotypic Leukemia (ABL) / Acute Erythroid Leukemia in Remission / Acute Leukemia in Remission / Acute Lymphoblastic Leukemia in Remission / Acute Megakaryoblastic Leukemia / Acute myeloid leukaemia (in remission) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute Myeloid Leukemia With FLT3/ITD Mutation / Acute Myeloid Leukemia With Inv(3) (q21.3;q26.2) or t(3;3) (q21.3;q26.2); GATA2, MECOM / Acute Myeloid Leukemia With Inv(3) (q21.3;q26.2); GATA2, MECOM / Acute Myeloid Leukemia With Inv(3)(q21q26.2) or t(3;3)(q21;q26.2); RPN1-EVI1 / Acute Myeloid Leukemia With Inv(3)(q21q26.2); RPN1-EVI1 / Acute Myeloid Leukemia With Multilineage Dysplasia / Acute Myeloid Leukemia With t(6;9) (p23;q34.1); DEK-NUP214 / Acute Myeloid Leukemia With t(6;9)(p23;q34); DEK-NUP214 / Acute Undifferentiated Leukemia (AUL) / Adult Acute Lymphoblastic Leukemia in Complete Remission / B Acute Lymphoblastic Leukemia With t(1;19)(q23;p13.3); E2A-PBX1 (TCF3-PBX1) / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Blasts Under 5 Percent of Bone Marrow Nucleated Cells / Burkitt's Lymphoma / Childhood Acute Lymphoblastic Leukemia in Complete Remission / DS Stage II Plasma Cell Myeloma / DS Stage III Plasma Cell Myeloma / Hematopoietic Cell Transplant Recipient / Myelodysplastic Syndrome / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Hodgkin Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / T Lymphoblastic Lymphoma1
2RecruitingTreatmentAcute Leukemias of Ambiguous Lineage / Leukemia Acute Myeloid Leukemia (AML) / Myeloid Neoplasm1
2RecruitingTreatmentAcute Lymphoblastic Leukaemia Recurrent / Acute Lymphoblastic Leukaemias (ALL) / Burkitt Leukemia/Lymphoma / Burkitt's Lymphoma / Hematopoietic/Lymphoid Cancer / High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements / Lymphoblastic lymphoma (Precursor T-lymphoblastic lymphoma/leukemia) refractory / Lymphoma, Lymphoblastic / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Burkitt Leukemia / Recurrent Burkitt Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements / Refractory Acute Lymphoblastic Leukemia / Refractory Burkitt Leukemia / Refractory Burkitt Lymphoma / Refractory High Grade B-Cell Lymphoma With MYC and BCL2 or BCL6 Rearrangements1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Chronic Myeloid Leukemia (CML) / Granulocytic Sarcoma / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes (MDS) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Chronic Myeloid Leukemia (CML) / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia Acute Myeloid Leukemia (AML) / Lymphoma, Hodgkins / Myelodysplastic Syndromes (MDS) / NK-Cell Leukemia / Non Hodgkin Lymphoma (NHL)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemia Acute Myeloid Leukemia (AML)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemia Acute Myeloid Leukemia (AML) / Leukemia, Acute / Leukemias / Lymphoma, Hodgkins / Myelodysplastic Syndromes / Myelodysplastic-Myeloproliferative Diseases / Myeloproliferative Disorders / Non Hodgkin Lymphoma (NHL)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myelogenous Leukaemia (AML) / Chronic Chronic myelogenous leukemia / Chronic Lymphocytic Leukaemia (CLL) / Chronic, recurrent Lymphocytic Leukemia / Chronic, recurrent Myelogenous Leukemia / Leukemia, Lymphocytic / Leukemias / Lymphoma, Hodgkins / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Non Hodgkin Lymphoma (NHL) / Plasma Cell Myeloma / Recurrent Acute Myeloid Leukemia, Adult / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma1
2RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Biphenotypic/Undifferentiated Leukemia / Burkitt's Lymphoma / Chronic Chronic myelogenous leukemia / Leukemia Acute Myeloid Leukemia (AML) / Lymphoma, Hodgkins / Lymphoplasmacytic Lymphoma / Mantle Cell Lymphoma (MCL) / Myelodysplasia / Recurrent Cutaneous T-cell lymphoma / Relapsed Large Cell Lymphoma1
2RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myeloid Leukemia (CML) / Leukemia Acute Myeloid Leukemia (AML) / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Myeloproliferative Syndromes / Non-Hodgkin's Lymphoma (NHL) / Other Diseases of Blood and Blood-Forming Organs1
2RecruitingTreatmentAcute Myelogenous Leukaemia (AML) / Acute Myeloid Leukemia With Inv(16)(p13.1q22); CBFB-MYH11 / Acute Myeloid Leukemia With t(16;16)(p13.1;q22); CBFB-MYH11 / Acute Myeloid Leukemia With t(8;21); (q22; q22.1); RUNX1-RUNX1T1 / De Novo Myelodysplastic Syndrome / High Risk Myelodysplastic Syndrome / Inv(16) / Myelodysplastic Syndrome With Excess Blasts / T(16;16) / T(8;21) / Untreated Adult Acute Myeloid Leukemia1
2RecruitingTreatmentAcute Myelogenous Leukaemia (AML) / Congenital Hypoplastic Anemia / Myelodysplastic Syndromes (MDS)1
2RecruitingTreatmentAcute Myelogenous Leukaemia (AML) / Congenital Hypoplastic Anemia / Myelodysplastic Syndromes (MDS) / Severe Marrow Failure1
2RecruitingTreatmentAplastic Anaemia (AA) / De Novo Myelodysplastic Syndrome / Leukemias / Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes1
2RecruitingTreatmentB-cell Non-Hodgkin's Lymphomas / Mantle Cell Lymphoma (MCL) / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Indolent Adult Non-Hodgkin Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Indolent Adult Non-Hodgkin Lymphoma1
2RecruitingTreatmentBladder Cancers1
2RecruitingTreatmentAcute, recurrent Myeloid Leukemia / Blasts 10 Percent or More of Bone Marrow Nucleated Cells / Chronic Myelomonocytic Leukemia-2 / High Grade Malignant Neoplasm / Myelodysplastic Syndrome / Myelodysplastic Syndrome With Excess Blasts-2 / Myeloid Neoplasm / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Refractory Acute Myeloid Leukemia1
2RecruitingTreatmentCancer of the Ovary / Childhood Germ Cell Tumor / Teratoma1
2RecruitingTreatmentCancer, Breast / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentCerebral Palsy (CP)1
2RecruitingTreatmentChemotherapy Induced Neutropenia1
2RecruitingTreatmentChildhood Acute Lymphoblastic Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission / Childhood Myelodysplastic Syndrome / De Novo Myelodysplastic Syndrome / Leukemias / Myelodysplastic Syndromes / Previously Treated Myelodysplastic Syndromes / Recurrent Childhood Acute Myeloid Leukemia / Refractory Anemia / Refractory Anemia With Excess Blasts / Refractory Anemia With Excess Blasts in Transformation / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Secondary Myelodysplastic Syndromes1
2RecruitingTreatmentCongenital Hypoplastic Anemia2
2RecruitingTreatmentCongenital Hypoplastic Anemia / Myelodysplastic Syndromes / Severe Aplastic Anemia (SAA)1
2RecruitingTreatmentCongestive Cardiomyopathy1
2RecruitingTreatmentDiffuse Sclerosis Systemic / Interstitial Lung Disease (ILD) / Pulmonary Hypertension (PH) / Sclerosis, Progressive Systemic1
2RecruitingTreatmentGraft Failure / Hematopoietic Stem Cell Transplantation (HSCT) / Wiskott-Aldrich Syndrome (WAS)1
2RecruitingTreatmentHHV-8 / Human Immunodeficiency Virus (HIV) / Lymphoproliferative Disorders / Malignancies1
2RecruitingTreatmentLarge B Cell Lymphoma1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)3
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Relapsed Leukemia1
2RecruitingTreatmentLeukemias / Malignant Lymphomas1
2RecruitingTreatmentLymphoma, AIDS Related / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
2RecruitingTreatmentLymphoma, Hodgkins1
2RecruitingTreatmentLymphoma, Hodgkins / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
2RecruitingTreatmentMalignant Lymphomas1
2RecruitingTreatmentMultiple Myeloma (MM)3
2RecruitingTreatmentMultiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)2
2RecruitingTreatmentNeuroblastomas2
2RecruitingTreatmentNeutropenias1
2RecruitingTreatmentNewly Diagnosed Ewing Sarcoma1
2RecruitingTreatmentRetinoblastoma1
2RecruitingTreatmentRhabdomyosarcomas1
2RecruitingTreatmentScleroderma, Systemic1
2RecruitingTreatmentSevere Aplastic Anemia (SAA)1
2RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2SuspendedTreatmentAnterior Myocardial Infarction / Heart Failure1
2TerminatedDiagnosticMalignant Lymphomas1
2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Chronic Chronic myelogenous leukemia / Granulocytic Sarcoma / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes (MDS) / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentAdult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Recurrent Adult Acute Myeloid Leukemia1
2TerminatedTreatmentB-cell Childhood Acute Lymphoblastic Leukemia / Childhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / L3 Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma1
2TerminatedTreatmentBladder Cancers1
2TerminatedTreatmentBlood and Marrow Transplant (BMT) / Diffuse Large B-Cell / Lymphoma, B-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Lymphomas: Non-Hodgkin / Malignant Lymphoma, Non-Hodgkin / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentBrain and Central Nervous System Tumors / Drug/Agent Toxicity by Tissue/Organ / Malignant Lymphomas / Thrombocytopenias1
2TerminatedTreatmentCancer of the Ovary1
2TerminatedTreatmentCancer of the Ovary / Childhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
2TerminatedTreatmentCancer, Breast1
2TerminatedTreatmentCarcinoma, Islet Cell / Gastro-enteropancreatic Neuroendocrine Tumor / Malignant Neoplasm of Pancreas / Neuroendocrine Carcinomas of Pancreas1
2TerminatedTreatmentCardiac Toxicity / Sarcomas1
2TerminatedTreatmentChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
2TerminatedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms / Unusual Cancers of Childhood1
2TerminatedTreatmentCytokines1
2TerminatedTreatmentEsophageal Diseases1
2TerminatedTreatmentHER2-Negative Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2TerminatedTreatmentHaematological Malignancies1
2TerminatedTreatmentHaemoglobinopathies congenital / Sickle Cell Disorders / Thalassaemic disorders1
2TerminatedTreatmentHead and Neck Carcinoma1
2TerminatedTreatmentHematologic Diseases1
2TerminatedTreatmentLeukemia Acute Myeloid Leukemia (AML)1
2TerminatedTreatmentLeukemias2
2TerminatedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Plasma Cell Neoplasms / Renal Cancers1
2TerminatedTreatmentLeukemias / Malignant Lymphomas / Myeloproliferative Disorders / Plasma Cell Myeloma1
2TerminatedTreatmentLeukemias / Myelodysplastic Syndromes1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2TerminatedTreatmentMalignant Lymphomas2
2TerminatedTreatmentMalignant Ovarian Mixed Epithelial Tumor / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Primary Peritoneal Carcinoma / Stage III Ovarian Cancer / Undifferentiated Ovarian Carcinoma1
2TerminatedTreatmentMelanoma (Skin)1
2TerminatedTreatmentMelanoma (Skin) / Renal Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
2TerminatedTreatmentMultiple Myeloma (MM)1
2TerminatedTreatmentMultiple Myeloma (MM) / Multiple Myeloma and Plasma Cell Neoplasm / Plasma Cell Neoplasms1
2TerminatedTreatmentMultiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2TerminatedTreatmentMyocardial Infarction1
2TerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentParkinson's Disease (PD)1
2TerminatedTreatmentRecurrent Adult Soft Tissue Sarcoma / Stage I Adult Soft Tissue Sarcoma / Stage I Adult Soft Tissue Sarcoma AJCC v7 / Stage II Adult Soft Tissue Sarcoma / Stage II Adult Soft Tissue Sarcoma AJCC v7 / Stage III Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma AJCC v71
2TerminatedTreatmentRecurrent Melanoma / Stage IV Melanoma1
2TerminatedTreatmentSarcomas2
2TerminatedTreatmentSevere Combined Immunodeficiency1
2TerminatedTreatmentT-Cell Non-Hodgkin Lymphoma1
2TerminatedTreatmentTransplantation, Kidney1
2TerminatedTreatmentAcute, relapsed Myelogenous Leukemia1
2Unknown StatusTreatmentAcquired Aplastic Anemia1
2Unknown StatusTreatmentBladder Cancers / Transitional Cell Cancer of the Renal Pelvis and Ureter1
2Unknown StatusTreatmentBortezomib / Cyclophosphamide / Dexamethasone / Granulocyte Colony-Stimulating Factor / Plasma Cell Myeloma1
2Unknown StatusTreatmentBrain and Central Nervous System Tumors1
2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
2Unknown StatusTreatmentCancer, Breast1
2Unknown StatusTreatmentCancer, Breast / Chemotherapy Induced Neutropenia1
2Unknown StatusTreatmentExtrahepatic Bile Duct Cancer / Gallbladder Cancer / Liver Cancer1
2Unknown StatusTreatmentGerm Cell Tumors1
2Unknown StatusTreatmentHead and Neck Carcinoma1
2Unknown StatusTreatmentLeukemias1
2Unknown StatusTreatmentLung Cancers3
2Unknown StatusTreatmentMalignant Lymphomas4
2Unknown StatusTreatmentMalignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm1
2Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm2
2Unknown StatusTreatmentNeuroblastomas2
2Unknown StatusTreatmentPain NOS / Prostate Cancer1
2WithdrawnTreatmentAdult Acute Myeloid Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission1
2WithdrawnTreatmentAnemias / Chronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2WithdrawnTreatmentAnterior Urethral Cancer / Localized Transitional Cell Cancer of the Renal Pelvis and Ureter / Posterior Urethral Cancer / Recurrent Bladder Cancer / Recurrent Urethral Cancer / Regional Transitional Cell Cancer of the Renal Pelvis and Ureter / Stage III Bladder Cancer / Transitional Cell Carcinoma of the Bladder / Ureteral Cancer / Urethral Cancer Associated With Invasive Bladder Cancer1
2WithdrawnTreatmentB Acute Lymphoblastic Leukemia / B Lymphoblastic Lymphoma / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent B Lymphoblastic Lymphoma / Recurrent T Lymphoblastic Leukemia/Lymphoma / Refractory B Lymphoblastic Lymphoma / Refractory T Lymphoblastic Lymphoma / T Acute Lymphoblastic Leukemia / T Lymphoblastic Lymphoma1
2WithdrawnTreatmentBrain and Central Nervous System Tumors1
2WithdrawnTreatmentBrain and Central Nervous System Tumors / Neuroblastomas / Retinoblastoma / Sarcomas1
2WithdrawnTreatmentCastrate-resistant Metastatic Prostate Cancer1
2WithdrawnTreatmentChronic Myeloid Leukemia, Blast Crisis / Leukemia Acute Myeloid Leukemia (AML)1
2WithdrawnTreatmentCrohn's Disease (CD)1
2WithdrawnTreatmentFibrolamellar Hepatocellular Carcinoma / Hepatocellular Carcinoma (Fibrolamellar Variant) / Hepatocellular,Carcinoma1
2WithdrawnTreatmentHematopoietic Stem Cells / Malignant Lymphomas / Multiple Myeloma (MM) / Transplantation, Bone Marrow1
2WithdrawnTreatmentLeukemias1
2WithdrawnTreatmentLung Cancers1
2WithdrawnTreatmentMalignant Lymphomas3
2WithdrawnTreatmentRecurrent Adult Soft Tissue Sarcoma / Stage IIB Adult Soft Tissue Sarcoma / Stage IIC Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage IVA Adult Soft Tissue Sarcoma1
2WithdrawnTreatmentSystemic Lupus Erythematosus (SLE)1
2WithdrawnTreatmentTumors, Solid1
2, 3Active Not RecruitingSupportive CareChemotherapy Induced Neutropenia2
2, 3Active Not RecruitingTreatmentCongenital Hypoplastic Anemia / Severe Congenital Neutropenia / Shwachman-Diamond Syndrome / Sickle Cell Disorders / Thalassaemic disorders1
2, 3Active Not RecruitingTreatmentHypogammaglobulinemia / Infection NOS / Myelokathexis / Neutropenias / Warts / WHIMS1
2, 3Active Not RecruitingTreatmentMultiple Myeloma (MM)1
2, 3Active Not RecruitingTreatmentScleroderma / Sclerosis, Progressive Systemic1
2, 3CompletedTreatmentAcute Respiratory Failure / Critically-ill Patients1
2, 3CompletedTreatmentAdult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Childhood B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
2, 3CompletedTreatmentAmyotrophic Lateral Sclerosis (ALS)1
2, 3CompletedTreatmentChronic Ischaemic Heart Failure1
2, 3CompletedTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Myelodysplastic Syndromes1
2, 3CompletedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes1
2, 3CompletedTreatmentLiver Cirrhosis1
2, 3CompletedTreatmentMalignant Lymphomas1
2, 3Not Yet RecruitingSupportive CareWomen Infertility1
2, 3RecruitingSupportive CareGranu1ocyte Colony-stimu1ating Factor / Granulocyte Colony-Stimulating Factor / Leukemia Acute Myeloid Leukemia (AML) / Minimal Residual Disease1
2, 3RecruitingSupportive CareLeukemia Acute Myeloid Leukemia (AML)1
2, 3RecruitingTreatmentAllogeneic peripheral haematopoietic stem cell transplant / Conditioning / Myelodysplastic Syndrome1
2, 3RecruitingTreatmentDecompensated Cirrhosis of Liver1
2, 3RecruitingTreatmentLeukemias1
2, 3RecruitingTreatmentLiver Cirrhosis1
2, 3RecruitingTreatmentMature B-Cell Lymphoma1
2, 3RecruitingTreatmentNeuromyelitis Optica / NMO Spectrum Disorder1
2, 3TerminatedTreatmentFollicular Lymphoma (FL) / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma1
2, 3TerminatedTreatmentLeukemia Acute Myeloid Leukemia (AML) / Leukemia, Lymphocytic, Acute / Smith-Magenis Syndrome1
2, 3TerminatedTreatmentMetastatic Breast Cancer (MBC)1
2, 3Unknown StatusTreatmentAcute Myocardial Infarction (AMI)1
2, 3Unknown StatusTreatmentDe Novo Akute Myeloid Leukemia (AML) / Refractory Anemia With Excess of Blasts in Transformation / Secondary Acute Myeloid Leukemia (Secondary AML, sAML)1
2, 3Unknown StatusTreatmentExtragonadal Germ Cell Tumor / Teratoma / Testicular germ cell tumour1
2, 3Unknown StatusTreatmentMyocardial Infarction1
3Active Not RecruitingSupportive CareChildhood Choroid Plexus Tumor / Childhood Pineoblastoma / Childhood Soft Tissue Sarcoma / Childhood Supratentorial Primitive Neuroectodermal Tumor / Medulloblastoma, Childhood / Neuroblastomas / Recurrent/Refractory Childhood Hodgkin Lymphoma / Retinoblastoma / Sarcoma, Osteogenic / Unspecified Childhood Solid Tumor, Protocol Specific / Wilms Tumor and Other Childhood Kidney Tumors1
3Active Not RecruitingTreatmentAnaplastic Medulloblastoma / Medulloblastomas / Untreated Childhood Medulloblastoma / Untreated Childhood Pineoblastoma / Untreated Childhood Supratentorial Primitive Neuroectodermal Tumor1
3Active Not RecruitingTreatmentB-cell Childhood Acute Lymphoblastic Leukemia / Intermediate Risk Recurrent Childhood Acute Lymphoblastic Leukemia / L1 Childhood Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia1
3Active Not RecruitingTreatmentBrain and Central Nervous System Tumors1
3Active Not RecruitingTreatmentChildhood Acute Lymphoblastic Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission / Childhood Chronic Myelogenous Leukemia / Childhood Myelodysplastic Syndromes / Chronic Phase Chronic Myelogenous Leukemia / De Novo Myelodysplastic Syndromes / Juvenile Myelomonocytic Leukemia / Previously Treated Myelodysplastic Syndromes / Recurrent Childhood Acute Lymphoblastic Leukemia / Secondary Myelodysplastic Syndromes1
3Active Not RecruitingTreatmentChildhood Atypical Teratoid/Rhabdoid Tumor1
3Active Not RecruitingTreatmentChildhood Favorable Prognosis Hodgkin Lymphoma / Childhood Lymphocyte Depletion Hodgkin Lymphoma / Childhood Mixed Cellularity Hodgkin Lymphoma / Childhood Nodular Sclerosis Hodgkin Lymphoma / Stage I Childhood Hodgkin Lymphoma / Stage II Childhood Hodgkin Lymphoma1
3Active Not RecruitingTreatmentChildhood Nodular Lymphocyte Predominant Hodgkin Lymphoma / Stage III Childhood Hodgkin Lymphoma / Stage IV Childhood Hodgkin Lymphoma1
3Active Not RecruitingTreatmentEndometrial Cancers / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIA Uterine Corpus Cancer AJCC v7 / Stage IIIB Uterine Corpus Cancer / Stage IIIB Uterine Corpus Cancer AJCC v7 / Stage IIIC Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer AJCC v7 / Stage IVA Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer AJCC v7 / Stage IVB Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer AJCC v71
3Active Not RecruitingTreatmentExtraocular Retinoblastoma1
3Active Not RecruitingTreatmentLarge B Cell Lymphoma1
3Active Not RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
3Active Not RecruitingTreatmentLocally Advanced or Metastatic Non Small Cell Lung Cancer Stage IIIb - IV1
3Active Not RecruitingTreatmentMalignant Lymphomas2
3Active Not RecruitingTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
3Active Not RecruitingTreatmentScleroderma / Scleroderma, Systemic1
3Active Not RecruitingTreatmentStage I Adrenocortical Carcinoma / Stage II Adrenocortical Carcinoma / Stage III Adrenocortical Carcinoma / Stage IV Adrenocortical Carcinoma1
3Active Not RecruitingTreatmentStage I Uterine Sarcoma / Stage I Uterine Sarcoma AJCC v7 / Uterine Corpus Leiomyosarcoma1
3Active Not RecruitingTreatmentTriple Negative Breast Neoplasms1
3CompletedPreventionChemotherapy Induced Neutropenia1
3CompletedPreventionNeutropenia in Breast Cancer1
3CompletedPreventionNeutropenia in Prematures1
3CompletedSupportive CareCancer, Breast / Chemotherapy Associated Neutropenia1
3CompletedSupportive CareChemotherapeutic Agent Toxicity / Neutropenias / Unspecified Adult Solid Tumor, Protocol Specific1
3CompletedSupportive CareChemotherapy Induced Neutropenia1
3CompletedSupportive CareDrug/Agent Toxicity by Tissue/Organ / Lung Cancers / Oral Complications / Radiation Toxicity1
3CompletedSupportive CareFever, Sweats, and Hot Flashes / Neutropenias / Unspecified Childhood Solid Tumor, Protocol Specific1
3CompletedSupportive CareMalignancies1
3CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
3CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Undifferentiated Leukemia (AUL) / Childhood T Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult T Acute Lymphoblastic Leukemia / Ann Arbor Stage II Adult T-Cell Leukemia/Lymphoma / Ann Arbor Stage II Childhood Lymphoblastic Lymphoma / Ann Arbor Stage II Contiguous Adult Lymphoblastic Lymphoma / Ann Arbor Stage II Non-Contiguous Adult Lymphoblastic Lymphoma / Ann Arbor Stage III Adult Lymphoblastic Lymphoma / Ann Arbor Stage III Adult T-Cell Leukemia/Lymphoma / Ann Arbor Stage III Childhood Lymphoblastic Lymphoma / Ann Arbor Stage IV Adult Lymphoblastic Lymphoma / Ann Arbor Stage IV Adult T-Cell Leukemia/Lymphoma / Ann Arbor Stage IV Childhood Lymphoblastic Lymphoma / Childhood T Acute Lymphoblastic Leukemia / Stage II Adult T-Cell Leukemia/Lymphoma / Stage II Childhood Lymphoblastic Lymphoma / Stage II Contiguous Adult Lymphoblastic Lymphoma / Stage II Non-Contiguous Adult Lymphoblastic Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Adult T-Cell Leukemia/Lymphoma / Stage III Childhood Lymphoblastic Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Adult T-Cell Leukemia/Lymphoma / Stage IV Childhood Lymphoblastic Lymphoma / T Acute Lymphoblastic Leukemia / T Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3CompletedTreatmentAcute on Chronic Hepatic Failure1
3CompletedTreatmentAdult Acute Basophilic Leukemia / Adult Acute Eosinophilic Leukemia / Adult Acute Erythroid Leukemia (M6) / Adult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monoblastic Leukemia and Acute Monocytic Leukemia (M5) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Myelomonocytic Leukemia (M4) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Childhood Acute Basophilic Leukemia / Childhood Acute Eosinophilic Leukemia / Childhood Acute Erythroleukemia (M6) / Childhood Acute Megakaryocytic Leukemia (M7) / Childhood Acute Minimally Differentiated Myeloid Leukemia (M0) / Childhood Acute Monoblastic Leukemia (M5a) / Childhood Acute Monoblastic Leukemia and Acute Monocytic Leukemia (M5) / Childhood Acute Monocytic Leukemia (M5b) / Childhood Acute Myeloblastic Leukemia With Maturation (M2) / Childhood Acute Myeloblastic Leukemia Without Maturation (M1) / Childhood Acute Myelomonocytic Leukemia (M4) / Childhood Myelodysplastic Syndromes / De Novo Myelodysplastic Syndromes / Untreated Adult Acute Myeloid Leukemia / Untreated Childhood Acute Myeloid Leukemia and Other Myeloid Malignancies1
3CompletedTreatmentAdult Malignant Mesenchymoma / Adult Rhabdomyosarcoma / Alveolar Childhood Rhabdomyosarcoma / Childhood Malignant Mesenchymoma / Embryonal Childhood Rhabdomyosarcoma / Embryonal-botryoid Childhood Rhabdomyosarcoma / Nonmetastatic Childhood Soft Tissue Sarcoma / Previously Untreated Childhood Rhabdomyosarcoma / Stage I Adult Soft Tissue Sarcoma / Stage II Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma1
3CompletedTreatmentAmyloidosis1
3CompletedTreatmentAnemias / Myelodysplastic Syndromes1
3CompletedTreatmentBladder Cancers1
3CompletedTreatmentCancer of the Ovary1
3CompletedTreatmentCancer of the Ovary / Endometrial Cancers / Metastatic Cancers / Pheochromocytomas / Renal Cancers / Sarcomas1
3CompletedTreatmentCancer of the Ovary / Endometrial Cancers / Pheochromocytomas / Renal Cancers / Sarcomas1
3CompletedTreatmentCancer, Breast10
3CompletedTreatmentCancer, Breast / Cyclophosphamide / Doxorubicin / High Risk / Positive Nodes1
3CompletedTreatmentCardiac Toxicity / Malignant Lymphomas2
3CompletedTreatmentChemotherapy Induced Neutropenia1
3CompletedTreatmentChemotherapy-Induced Febrile Neutropenia / Neoplasms, Breast1
3CompletedTreatmentChildhood Acute Erythroleukemia (M6) / Childhood Acute Megakaryocytic Leukemia (M7) / Childhood Acute Monoblastic Leukemia (M5a) / Childhood Acute Monocytic Leukemia (M5b) / Childhood Acute Myeloblastic Leukemia With Maturation (M2) / Childhood Acute Myeloblastic Leukemia Without Maturation (M1) / Childhood Acute Myelomonocytic Leukemia (M4) / Childhood Myelodysplastic Syndromes / Chronic Myelomonocytic Leukemia / De Novo Myelodysplastic Syndromes / Refractory Anemia / Refractory Anemia With Excess Blasts / Refractory Anemia With Excess Blasts in Transformation / Refractory Anemia With Ringed Sideroblasts / Secondary Myelodysplastic Syndromes / Untreated Childhood Acute Myeloid Leukemia and Other Myeloid Malignancies1
3CompletedTreatmentChildhood Acute Lymphoblastic Leukemia in Remission / Recurrent Childhood Acute Lymphoblastic Leukemia1
3CompletedTreatmentChildhood Germ Cell Tumor / Extragonadal Germ Cell Tumor / Testicular germ cell tumour1
3CompletedTreatmentChildhood Lymphocyte-Depleted Classical Hodgkin Lymphoma / Childhood Mixed Cellularity Classical Hodgkin Lymphoma / Childhood Nodular Lymphocyte Predominant Hodgkin Lymphoma / Childhood Nodular Sclerosis Classical Hodgkin Lymphoma / Malignant Lymphomas / Stage I Childhood Hodgkin Lymphoma / Stage II Childhood Hodgkin Lymphoma / Stage III Childhood Hodgkin Lymphoma / Stage IV Childhood Hodgkin Lymphoma1
3CompletedTreatmentChronic Liver Diseases (CLD)1
3CompletedTreatmentChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Secondary Myelofibrosis1
3CompletedTreatmentElderly Patients (>65 Years) / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
3CompletedTreatmentEndometrial Adenocarcinomas / Endometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Endometrioid Adenocarcinoma, Variant With Squamous Differentiation / Endometrial Serous Adenocarcinoma / Stage III Uterine Corpus Cancer1
3CompletedTreatmentEndometrial Cancers1
3CompletedTreatmentGranulocytic Sarcoma / Leukaemia cutis / Leukemia Acute Myeloid Leukemia (AML) / Myeloid Neoplasm / Untreated Adult Acute Myeloid Leukemia / Untreated Childhood Myeloid Neoplasm1
3CompletedTreatmentHodgkins Disease (HD)1
3CompletedTreatmentInfection NOS / Neutropenias1
3CompletedTreatmentLeukemia Acute Myeloid Leukemia (AML)2
3CompletedTreatmentLeukemia, Adult T-Cell / Malignant Lymphomas1
3CompletedTreatmentLeukemias3
3CompletedTreatmentLeukemias / Malignant Lymphomas2
3CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
3CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
3CompletedTreatmentLeukemias / Neutropenias1
3CompletedTreatmentLiver Cirrhosis1
3CompletedTreatmentLocalized Resectable Neuroblastoma / Localized Unresectable Neuroblastoma / Recurrent Neuroblastoma / Regional Neuroblastoma / Stage 4 Neuroblastoma / Stage 4S Neuroblastoma1
3CompletedTreatmentLymphoma, T-Cell, Peripheral1
3CompletedTreatmentMalignant Lymphomas8
3CompletedTreatmentMediastinal Cancer / Metastatic Cancers / Testicular germ cell tumour1
3CompletedTreatmentMelanoma (Skin)2
3CompletedTreatmentMetastatic Bladder Cancer / Stage III Bladder Cancer / Transitional Cell Carcinoma of the Bladder1
3CompletedTreatmentMultiple Myeloma (MM)5
3CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm3
3CompletedTreatmentNeoplasms, Brain / Tumors, Central Nervous System3
3CompletedTreatmentNeuroblastomas4
3CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)2
3CompletedTreatmentPlasma Cell Myeloma1
3CompletedTreatmentRecurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma1
3CompletedTreatmentRenal Cancers2
3CompletedTreatmentSarcomas5
3CompletedTreatmentSickle Cell Trait1
3CompletedTreatmentUntreated Childhood Medulloblastoma / Untreated Childhood Supratentorial Primitive Neuroectodermal Tumor1
3CompletedTreatmentWomen With Recurrent Implantation Failure (Three Previous IVF Attempts Failed and at Least 8 Good Embryos Replaced1
3Not Yet RecruitingTreatmentAcute Myeloid Leukemia, in Relapse1
3RecruitingOtherHealthy Volunteers1
3RecruitingPreventionCancer, Breast1
3RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / BCR-ABL1 Fusion Protein Expression / Minimal Residual Disease / Philadelphia Chromosome Positive / T Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3RecruitingTreatmentAcute Myeloid Leukemia With FMS-like Tyrosine Kinase (FLT3) Mutation1
3RecruitingTreatmentAdverse Events / Colony Stimulating Factors / Cost-Effectiveness / Myelosuppression Adult / Neutropenia, Febrile / Ovarian Epithelial Cancer1
3RecruitingTreatmentAgnogenic Myeloid Metaplasia / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myeloid Leukemia (CML) / Leukemia Acute Myeloid Leukemia (AML) / Malignant Lymphomas / Myelodysplasia / Myeloproliferative Disorders / Non-Hodgkin's Lymphoma (NHL) / Plasma Cell Dyscrasia1
3RecruitingTreatmentAlcoholic Hepatitis (AH)1
3RecruitingTreatmentAnn Arbor Stage III Hodgkin Lymphoma / Ann Arbor Stage III Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage III Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage III Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IIIA Hodgkin Lymphoma / Ann Arbor Stage IIIB Hodgkin Lymphoma / Ann Arbor Stage IV Hodgkin Lymphoma / Ann Arbor Stage IV Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage IV Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage IV Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IVA Hodgkin Lymphoma / Ann Arbor Stage IVB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Lymphocyte-Rich Classic Hodgkin Lymphoma1
3RecruitingTreatmentB Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia1
3RecruitingTreatmentBladder Cancers1
3RecruitingTreatmentBlasts 5 Percent or More of Bone Marrow Nucleated Cells / Childhood Acute Myeloid Leukemia / Childhood Myelodysplastic Syndrome / Cytopenias / Down Syndrome (DS) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Myeloid Leukemia Associated With Down Syndrome / Myeloproliferative Neoplasms / Trisomy 21 Mosaicism1
3RecruitingTreatmentChildhood Teratoma / Choriocarcinoma / Extragonadal Seminoma / Germ Cell Tumors / Germinoma / Malignant Germ Cell Neoplasm / Mixed Germ Cell Tumor / Non-seminomatous Germ Cell Tumors / Seminoma / Teratoma / Yolk Sac Tumor1
3RecruitingTreatmentGerm Cell Tumors1
3RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)2
3RecruitingTreatmentInduction chemotherapy / Leukemia Acute Myeloid Leukemia (AML)1
3RecruitingTreatmentLymphoma, Hodgkins / Non-Hodgkin's Lymphoma (NHL)1
3RecruitingTreatmentMetastatic Hormone Refractory Prostate Cancer1
3RecruitingTreatmentMultiple Myeloma (MM)1
3RecruitingTreatmentNeuroblastomas1
3RecruitingTreatmentRelapsed/Refractory Acute Myeloid Leukemia With FLT3 Activating Mutations1
3RecruitingTreatmentTriple-Negative Breast Cancer (TNBC)1
3SuspendedTreatmentPhiladelphia Chromosome Positive Adult Acute Lymphoblastic Leukemia1
3SuspendedTreatmentRepeated Embryo Implantation Failure1
3TerminatedTreatmentAL Amyloidosis1
3TerminatedTreatmentAnterior Acute Myocardial Infarction / Left Ventricular Systolic Dysfunction1
3TerminatedTreatmentAplastic Anaemia (AA)1
3TerminatedTreatmentBladder Cancers1
3TerminatedTreatmentCancer, Breast1
3TerminatedTreatmentChagas Cardiomyopathy1
3TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
3TerminatedTreatmentEfficacy / Healthy Participants / Pharmacokinetics / Safety1
3TerminatedTreatmentEndometrial Cancers1
3TerminatedTreatmentHead and Neck Carcinoma1
3TerminatedTreatmentIntraocular Retinoblastoma1
3TerminatedTreatmentLung Cancers1
3TerminatedTreatmentMalignant Lymphomas2
3TerminatedTreatmentMultiple Myeloma (MM)1
3TerminatedTreatmentRecurrent Uterine Corpus Sarcoma / Stage IIIA Uterine Sarcoma / Stage IIIB Uterine Sarcoma / Stage IIIC Uterine Sarcoma / Stage IVA Uterine Sarcoma / Stage IVB Uterine Sarcoma / Uterine Corpus Leiomyosarcoma1
3TerminatedTreatmentRefractory Multiple Myeloma1
3Unknown StatusNot AvailableMyelodysplastic Syndrome1
3Unknown StatusPreventionG-CSF, Multiple Myeloma, Febrile Episode, Filgrastim, Leograstim1
3Unknown StatusTreatmentCancer, Breast1
3Unknown StatusTreatmentGraft Versus Host Disease (GVHD)1
3Unknown StatusTreatmentLeukemias3
3Unknown StatusTreatmentLeukemias / Neutropenias1
3Unknown StatusTreatmentLung Cancers1
3Unknown StatusTreatmentMalignant Lymphomas5
3Unknown StatusTreatmentMantle Cell Lymphoma (MCL)1
3Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm2
3Unknown StatusTreatmentNeuroblastomas3
4Active Not RecruitingTreatmentPremature Ovarian Failure (POF)1
4CompletedDiagnosticDiabetes Mellitus (DM)1
4CompletedPreventionCancer, Breast1
4CompletedPreventionMycoses1
4CompletedSupportive CareCancer, Breast1
4CompletedTreatmentAcute Myeloblastic Leukemia / Myelodysplastic Syndrome1
4CompletedTreatmentAdult Acute Lymphocytic Leukemia2
4CompletedTreatmentAnemias / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
4CompletedTreatmentAsherman's Syndrome / Endometrium; Atrophy, Cervix1
4CompletedTreatmentBurkitt's Lymphoma / Large Cell Anaplastic Lymphoma / Lymphoma, Lymphoblastic / Mediastinal Neoplasms1
4CompletedTreatmentEarly Stage Breast Cancer1
4CompletedTreatmentLymphoma, Lymphoblastic1
4CompletedTreatmentMultiple Myeloma (MM)1
4CompletedTreatmentMyocardial Infarction1
4CompletedTreatmentNeonatal Sepsis1
4CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
4CompletedTreatmentProstate Cancer1
4CompletedTreatmentRecurrent Abortion1
4CompletedTreatmentType 2 Diabetes Mellitus1
4Not Yet RecruitingSupportive CareChemotherapy Induced Neutropenia / Chemotherapy-Induced Febrile Neutropenia / Granulocyte Colony-Stimulating Factor / Pediatric Cancer1
4Not Yet RecruitingTreatmentLeukemias1
4Not Yet RecruitingTreatmentPremature Ovarian Failure (POF)1
4RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Hepatoblastomas / Leukemia Acute Myeloid Leukemia (AML) / Malignant Lymphomas / Neuroblastomas / Retinoblastoma1
4RecruitingTreatmentAlcoholic Hepatitis (AH)1
4RecruitingTreatmentChemotherapy Induced Neutropenia / Gynecologic Cancers / Myelosuppression Adult / Neutropenia, Febrile1
4RecruitingTreatmentEarly Stage Breast Cancer1
4RecruitingTreatmentHepatic Failure / Severe alcoholic liver disease / Viral Hepatitis B1
4RecruitingTreatmentInfertilities1
4RecruitingTreatmentLymphoma, Hodgkins1
4RecruitingTreatmentStevens - Johnson Syndrome1
4TerminatedTreatmentLeukemias1
4TerminatedTreatmentNeutropenia, Severe Chronic1
4Unknown StatusSupportive CareCancer, Breast / Neutropenias1
4Unknown StatusTreatmentAcute Lymphoblastic Leukaemias (ALL) / Non-Hodgkin's Lymphoma (NHL)1
4Unknown StatusTreatmentAdult Acute Lymphocytic Leukemia2
4Unknown StatusTreatmentLeukemia Acute Myeloid Leukemia (AML)1
4WithdrawnTreatmentLower Limb Ischemia1
Not AvailableActive Not RecruitingNot AvailableBlood Diseases1
Not AvailableActive Not RecruitingNot AvailableCancer, Breast / Lung Cancers1
Not AvailableActive Not RecruitingNot AvailableStage I Ovarian Cancer / Stage I Ovarian Cancer AJCC v6 and v7 / Stage IA Fallopian Tube Cancer / Stage IA Fallopian Tube Cancer AJCC v6 and v7 / Stage IB Fallopian Tube Cancer / Stage IB Fallopian Tube Cancer AJCC v6 and v7 / Stage IC Fallopian Tube Cancer / Stage IC Fallopian Tube Cancer AJCC v6 and v7 / Stage II Ovarian Cancer / Stage II Ovarian Cancer AJCC v6 and v7 / Stage IIA Fallopian Tube Cancer / Stage IIA Fallopian Tube Cancer AJCC v6 and v7 / Stage IIB Fallopian Tube Cancer / Stage IIB Fallopian Tube Cancer AJCC v6 and v7 / Stage IIC Fallopian Tube Cancer / Stage IIC Fallopian Tube Cancer AJCC v6 and v7 / Stage III Ovarian Cancer / Stage III Ovarian Cancer AJCC v6 and v7 / Stage III Primary Peritoneal Cancer / Stage III Primary Peritoneal Cancer AJCC v7 / Stage IIIA Fallopian Tube Cancer / Stage IIIA Fallopian Tube Cancer AJCC v7 / Stage IIIB Fallopian Tube Cancer / Stage IIIB Fallopian Tube Cancer AJCC v7 / Stage IIIC Fallopian Tube Cancer / Stage IIIC Fallopian Tube Cancer AJCC v7 / Stage IV Fallopian Tube Cancer / Stage IV Fallopian Tube Cancer AJCC v6 and v7 / Stage IV Ovarian Cancer / Stage IV Ovarian Cancer AJCC v6 and v7 / Stage IV Primary Peritoneal Cancer / Stage IV Primary Peritoneal Cancer AJCC v71
Not AvailableActive Not RecruitingTreatmentAdult Grade III Lymphomatoid Granulomatosis / B-Cell Chronic Lymphocytic Leukemia / Contiguous Stage II Adult Burkitt Lymphoma / Contiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Contiguous Stage II Adult Lymphoblastic Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Progressive Hairy Cell Leukemia, Initial Treatment / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Refractory Multiple Myeloma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Adult Burkitt Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Mixed Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Adult Immunoblastic Large Cell Lymphoma / Stage I Adult Lymphoblastic Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Multiple Myeloma / Stage I Small Lymphocytic Lymphoma / Stage II Multiple Myeloma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Multiple Myeloma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Untreated Hairy Cell Leukemia / Waldenström's Macroglobulinemia (WM)1
Not AvailableActive Not RecruitingTreatmentDS Stage I Plasma Cell Myeloma / DS Stage II Plasma Cell Myeloma / DS Stage III Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
Not AvailableActive Not RecruitingTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes1
Not AvailableActive Not RecruitingTreatmentMalignancies, Hematologic1
Not AvailableApproved for MarketingNot AvailableAutologous Stem Cell Transplant1
Not AvailableAvailableNot AvailableChronic Myeloid Leukemia (CML) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome1
Not AvailableCompletedNot AvailableChemotherapy-induced Febrile Neutropenia (FN) / Malignant Hemopathies / Tumors, Solid1
Not AvailableCompletedNot AvailableHealthy Apheresis Donors / Mononuclear (MNC) Cell Donors1
Not AvailableCompletedNot AvailableLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableCompletedNot AvailableMultiple Myeloma (MM) / Transplantation, Autologous1
Not AvailableCompletedNot AvailableNon-Hodgkin's Lymphoma (NHL) / Transplantation, Autologous1
Not AvailableCompletedNot AvailableNormal PBPC Donors1
Not AvailableCompletedSupportive CareInfertilities1
Not AvailableCompletedTreatmentAdult Acute Lymphoblastic Leukemia / Childhood Acute Lymphoblastic Leukemia1
Not AvailableCompletedTreatmentAmyotrophic Lateral Sclerosis (ALS) / Brain Injury / Cerebral Palsy (CP) / Parkinson's Disease (PD)1
Not AvailableCompletedTreatmentAntiphospholipid Antibody Syndrome / Systemic Lupus Erythematosus (SLE)1
Not AvailableCompletedTreatmentBeta-Thalassemia1
Not AvailableCompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas1
Not AvailableCompletedTreatmentCancer, Breast1
Not AvailableCompletedTreatmentChildhood Germ Cell Tumor / Extragonadal Germ Cell Tumor1
Not AvailableCompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
Not AvailableCompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Myelodysplastic Syndromes1
Not AvailableCompletedTreatmentCirrhosis, Decompensated1
Not AvailableCompletedTreatmentCoronary Artery Disease1
Not AvailableCompletedTreatmentCytopenias / Human Immunodeficiency Virus (HIV) Infections1
Not AvailableCompletedTreatmentDystrophic Epidermolysis Bullosa1
Not AvailableCompletedTreatmentEwing Sarcoma of Bone / Localized Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor1
Not AvailableCompletedTreatmentFertility Disorders1
Not AvailableCompletedTreatmentHematologic Diseases / Malignancies, Hematologic1
Not AvailableCompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
Not AvailableCompletedTreatmentL1 Childhood Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia / Non-T, Non-B Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia1
Not AvailableCompletedTreatmentLeukemias1
Not AvailableCompletedTreatmentMalignant Lymphomas2
Not AvailableCompletedTreatmentMyocardial Infarction1
Not AvailableCompletedTreatmentPeripheral Stem Cell/Marrow Transplant1
Not AvailableCompletedTreatmentSevere Alcoholic Hepatitis1
Not AvailableNot Yet RecruitingTreatmentCritical Limb Ischemia (CLI)1
Not AvailableRecruitingNot AvailableAcute Lymphoblastic Leukaemias (ALL)1
Not AvailableRecruitingBasic ScienceHead and Neck Carcinoma / Malignant Melanoma1
Not AvailableRecruitingPreventionIntrauterine Adhesions1
Not AvailableRecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome1
Not AvailableRecruitingTreatmentAcute-On-Chronic Liver Failure1
Not AvailableRecruitingTreatmentAtypical Teratoid/Rhabdoid Tumor (AT/RT) / CNS Tumors / Ewing's Family Tumors / Germ Cell Tumors / Hepatoblastomas / Medulloblastomas / Primary Malignant Brain Neoplasms / Renal Tumors / Retinoblastoma / Rhabdomyosarcomas / Soft Tissue Sarcoma (STS) / Supra-tentorial Primative Neuro-Ectodermal Tumor (PNET)1
Not AvailableRecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)2
Not AvailableRecruitingTreatmentMalignancies, Hematologic1
Not AvailableRecruitingTreatmentMetastatic Pheochromocytoma / Relapsed Neuroblastoma1
Not AvailableRecruitingTreatmentNeuroblastomas2
Not AvailableSuspendedTreatmentDisseminated Neuroblastoma / Localized Resectable Neuroblastoma / Localized Unresectable Neuroblastoma / Regional Neuroblastoma / Stage 4S Neuroblastoma1
Not AvailableTerminatedNot AvailableChemotherapy Induced Neutropenia1
Not AvailableTerminatedNot AvailableHealthy Stem Cell Donor / Healthy, no Evidence of Disease1
Not AvailableTerminatedOtherLeukemia Acute Myeloid Leukemia (AML)1
Not AvailableTerminatedTreatmentAccelerated Phase Chronic Myelogenous Leukemia / Adult Acute Lymphoblastic Leukemia in Remission / Adult Acute Myeloid Leukemia in Remission / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL Negative / Blastic Phase Chronic Myelogenous Leukemia / Chronic Lymphocytic Leukemia (CLL) - Refractory / Chronic Phase Chronic Myelogenous Leukemia / De Novo Myelodysplastic Syndromes / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Secondary Myelodysplastic Syndromes / Splenic Marginal Zone Lymphoma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Multiple Myeloma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma1
Not AvailableTerminatedTreatmentAdult Acute Lymphoblastic Leukemia in Remission / Adult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Chronic Lymphocytic Leukemia (CLL) - Refractory / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)1
Not AvailableTerminatedTreatmentAdult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Myelomonocytic Leukemia (M4) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Recurrent Adult Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia1
Not AvailableTerminatedTreatmentChronic Myeloproliferative Disorders / Congenital Hypoplastic Anemia / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
Not AvailableTerminatedTreatmentChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases / Sarcomas1
Not AvailableTerminatedTreatmentGraft Versus Host Disease (GVHD)1
Not AvailableTerminatedTreatmentLeukemias / Malignant Lymphomas1
Not AvailableTerminatedTreatmentMalignancies, Hematologic1
Not AvailableTerminatedTreatmentNon Hodgkin Lymphoma (NHL)1
Not AvailableUnknown StatusTreatmentAcute on Chronic Liver Failure1
Not AvailableUnknown StatusTreatmentAnemia, Hemolytic, Autoimmune / Autoimmune Thrombocytopenic Purpura / Churg-Strauss Syndrome (CSS) / Giant Cells Arteritis / Graft Versus Host Disease (GVHD) / Granulomatosis With Polyangiitis / Polyarteritis Nodosa / Pure Red Cell Aplasia / Purpura, Schoenlein-Henoch / Rheumatoid Arthritis / Rheumatoid Arthritis, Juvenile / Systemic Lupus Erythematosus (SLE) / Takayasu's Disease / Vasculitis, Hypersensitivity1
Not AvailableUnknown StatusTreatmentChediak-Higashi Syndrome / Familial Erythrophagocytic Lymphohistiocytosis / Graft Versus Host Disease (GVHD) / Lymphohistiocytosis, Hemophagocytic / Virus-Associated Hemophagocytic Syndrome / X-Linked Lymphoproliferative Syndrome1
Not AvailableUnknown StatusTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms / Renal Cancers1
Not AvailableUnknown StatusTreatmentLymphoproliferative Disorders / Malignant Lymphomas / Multiple Myeloma (MM) / Plasma Cell Dyscrasia1
Not AvailableUnknown StatusTreatmentMalignant Lymphomas1
Not AvailableUnknown StatusTreatmentAcute fulminant liver failure1
Not AvailableWithdrawnTreatmentAgnogenic Myeloid Metaplasia / MF1
Not AvailableWithdrawnTreatmentHuman Immunodeficiency Virus (HIV) Infections1
Not AvailableWithdrawnTreatmentRetinoblastoma1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Amgen Inc.
  • Physicians Total Care Inc.
Dosage forms
FormRouteStrength
Injection, solutionIntravenous; Subcutaneous30000000 [units of filgrastim]/0.5ml
Injection, solutionIntravenous; Subcutaneous48000000 [units of filgrastim]/0.5ml
Injection, solutionIntravenous; Subcutaneous30 MIU
Injection, solutionIntravenous; Subcutaneous48 MIU
Injection, solutionSubcutaneous300 ug/1mL
Injection, solutionSubcutaneous480 ug/1.6mL
SolutionIntravenous; Subcutaneous
Injection, solutionIntravenous300 ug/1mL
Injection, solutionIntravenous300 ug/0.5mL
Injection, solutionIntravenous480 ug/0.8mL
Injection, solutionIntravenous; Subcutaneous300 ug/1mL
Injection, solutionIntravenous; Subcutaneous480 ug/1.6mL
SolutionIntravenous; Subcutaneous300 mcg
SolutionIntravenous; Subcutaneous600 mcg
Injection, solutionIntravenous; Subcutaneous12000000 [units of filgrastim]/0.2mL
Injection, solutionSubcutaneous300 ug/0.5mL
Injection, solutionSubcutaneous480 ug/0.8mL
Injection, solutionIntravenous; Subcutaneous300 ug/0.5mL
Injection, solutionIntravenous; Subcutaneous480 ug/0.8mL
Prices
Unit descriptionCostUnit
Neupogen 480 mcg/0.8ml Solution 1 Box Contains Ten 0.8ml Syringes4998.24USD box
Neupogen 480 mcg/1.6ml Solution 1 Box Contains Ten 1.6ml Syringes4554.58USD box
Neupogen 300 mcg/0.5ml Solution 1 Box Contains Ten 0.5ml Syringes3138.1USD box
Neupogen 480 mcg/1.6 ml vial437.94USD ml
Neupogen 300 mcg/ml vial286.04USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1341537No2007-07-312024-07-31Canada
CA1339071No1997-07-292014-07-29Canada
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)4MSDS
boiling point (°C)100MSDS
hydrophobicity0.209Not Available
isoelectric point5.65Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Stimulator
General Function
Receptor activity
Specific Function
Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutroph...
Gene Name
CSF3R
Uniprot ID
Q99062
Uniprot Name
Granulocyte colony-stimulating factor receptor
Molecular Weight
92155.615 Da
References
  1. Erkeland SJ, Aarts LH, Irandoust M, Roovers O, Klomp A, Valkhof M, Gits J, Eyckerman S, Tavernier J, Touw IP: Novel role of WD40 and SOCS box protein-2 in steady-state distribution of granulocyte colony-stimulating factor receptor and G-CSF-controlled proliferation and differentiation signaling. Oncogene. 2007 Mar 29;26(14):1985-94. Epub 2006 Sep 25. [PubMed:17001306]
  2. Link DC, Kunter G, Kasai Y, Zhao Y, Miner T, McLellan MD, Ries RE, Kapur D, Nagarajan R, Dale DC, Bolyard AA, Boxer LA, Welte K, Zeidler C, Donadieu J, Bellanne-Chantelot C, Vardiman JW, Caligiuri MA, Bloomfield CD, DiPersio JF, Tomasson MH, Graubert TA, Westervelt P, Watson M, Shannon W, Baty J, Mardis ER, Wilson RK, Ley TJ: Distinct patterns of mutations occurring in de novo AML versus AML arising in the setting of severe congenital neutropenia. Blood. 2007 Sep 1;110(5):1648-55. Epub 2007 May 9. [PubMed:17494858]
  3. Cao YR, Shao ZH, Liu H, Shi J, Bai J, Tu MF, Wang HQ, Xing LM, Cui ZZ, Sun J, Jia HR, Yang TY: [The response of bone marrow hematopoietic cells to G-CSF in paroxysmal nocturnal hemoglobinuria patients]. Zhonghua Xue Ye Xue Za Zhi. 2005 Apr;26(4):235-8. [PubMed:15949269]
  4. Ward AC: The role of the granulocyte colony-stimulating factor receptor (G-CSF-R) in disease. Front Biosci. 2007 Jan 1;12:608-18. [PubMed:17127322]
  5. Zhuang D, Qiu Y, Haque SJ, Dong F: Tyrosine 729 of the G-CSF receptor controls the duration of receptor signaling: involvement of SOCS3 and SOCS1. J Leukoc Biol. 2005 Oct;78(4):1008-15. Epub 2005 Jul 20. [PubMed:16033816]
  6. EMA label [File]
  7. TBO filgrastim [File]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Other/unknown
General Function
Serine-type endopeptidase activity
Specific Function
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis.
Gene Name
ELANE
Uniprot ID
P08246
Uniprot Name
Neutrophil elastase
Molecular Weight
28517.81 Da
References
  1. Carter CR, Whitmore KM, Thorpe R: The significance of carbohydrates on G-CSF: differential sensitivity of G-CSFs to human neutrophil elastase degradation. J Leukoc Biol. 2004 Mar;75(3):515-22. Epub 2003 Dec 4. [PubMed:14657210]
  2. Jian MY, Koizumi T, Tsushima K, Fujimoto K, Kubo K: Effects of granulocyte colony-stimulating factor (G-CSF) and neutrophil elastase inhibitor (ONO-5046) on acid-induced lung injury in rats. Inflammation. 2004 Dec;28(6):327-36. [PubMed:16245075]
  3. Donini M, Fontana S, Savoldi G, Vermi W, Tassone L, Gentili F, Zenaro E, Ferrari D, Notarangelo LD, Porta F, Facchetti F, Notarangelo LD, Dusi S, Badolato R: G-CSF treatment of severe congenital neutropenia reverses neutropenia but does not correct the underlying functional deficiency of the neutrophil in defending against microorganisms. Blood. 2007 Jun 1;109(11):4716-23. Epub 2007 Feb 20. [PubMed:17311988]
  4. Schepers H, Wierenga AT, van Gosliga D, Eggen BJ, Vellenga E, Schuringa JJ: Reintroduction of C/EBPalpha in leukemic CD34+ stem/progenitor cells impairs self-renewal and partially restores myelopoiesis. Blood. 2007 Aug 15;110(4):1317-25. Epub 2007 May 2. [PubMed:17475913]
  5. Druhan LJ, Ai J, Massullo P, Kindwall-Keller T, Ranalli MA, Avalos BR: Novel mechanism of G-CSF refractoriness in patients with severe congenital neutropenia. Blood. 2005 Jan 15;105(2):584-91. Epub 2004 Sep 7. [PubMed:15353486]
  6. El Ouriaghli F, Fujiwara H, Melenhorst JJ, Sconocchia G, Hensel N, Barrett AJ: Neutrophil elastase enzymatically antagonizes the in vitro action of G-CSF: implications for the regulation of granulopoiesis. Blood. 2003 Mar 1;101(5):1752-8. Epub 2002 Oct 17. [PubMed:12393522]

Drug created on June 13, 2005 07:24 / Updated on September 21, 2019 03:42