Nivolumab - DrugBank

ID Pharmacology Interactions References Trials Economics Properties Taxonomy

Targets (1)

Targets (1)Biointeractions (1)

Identification

Name

Nivolumab

Accession Number

DB09035 (DB06132)

Type

Biotech

Groups

Approved

Description

Nivolumab is a fully human IgG4 monoclonal antibody that acts as an immunomodulator by blocking ligand activation of programmed cell death 1 (PD-1) receptor on T cells. It is indicated for use in patients with unresectable (cannot be surgically removed) or metastatic melanoma who no longer respond to other drugs. Nivolumab is administered as an intravenous infusion over 60 minutes every 2 weeks.

Protein structure

Protein chemical formula

C₆₃₆₂H₉₈₆₂N₁₇₁₂O₁₉₉₅S₄₂

Protein average weight

143597.3811 Da

Sequences

>Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK

>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Download FASTA Format

Synonyms

Not Available

External IDs

BMS-936558 / GTPL7335 / MDX-1106 / ONO-4538

Product Ingredients

Not Available

Approved Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Opdivo	Solution	10 mg	Intravenous	Bristol Myers Squibb	2015-10-23	Not applicable	Canada
Opdivo	Injection	10 mg/mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2014-12-22	Not applicable	US
Opdivo	Solution	10 mg	Intravenous	Bristol Myers Squibb	2015-10-23	Not applicable	Canada
Opdivo	Injection	10 mg/mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2014-12-22	Not applicable	US

Approved Generic Prescription Products

Not Available

Approved Over the Counter Products

Not Available

Unapproved/Other Products

Not Available

International Brands

Not Available

Brand mixtures

Not Available

Categories

UNII

31YO63LBSN

CAS number

946414-94-4

Pharmacology

Indication

Nivolumab is indicated for the treatment of unresectable or metastatic melanoma for patients who no longer respond to treatment with other drugs. It is intended for use in patients who have been previously treated with ipilimumab and is used for melanoma patients after treatment with ipilimumab and a BRAF inhibitor in patients whose tumors express BRAF V600 gene mutations. Historically there have been very few effective treatments for advanced melanoma, which is why this product was approved under an FDA accelerated program to allow earlier patient access.

Structured Indications

Pharmacodynamics

Not Available

Mechanism of action

Nivolumab is a human immunoglobulin G4 (IgG4) monoclonal antibody that binds to the programmed cell death 1 (PD-1) receptor and selectively blocks interaction with its programmed death ligands PD-L1 and PD-L2. Upregulation of PD-1 ligands occurs in some tumors and signalling through this pathway can contribute to inhibition of active T-cell immune surveillance of tumour tissue. The inhibitory effect of PD-1 and its ligands occurs through the promotion of apoptosis in antigen specific T cells while simultaneously blocking apoptosis in suppressor T cells. Blocking PD-1 activity has been shown to lead to decreased tumour growth in mouse tumour models.

Target	Kind	Pharmacological action	Actions	Organism	UniProt ID
Programmed cell death protein 1	Protein	yes	antibody	Human	Q15116	details

Absorption

The intended route of administration is intravenous, therefore bioavailability is expected to be 100%.

Volume of distribution

8.0 L

Protein binding

Not Available

Metabolism

As nivolumab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of elimination

Renal clearance is negligible as vedolizumab is a high molecular weight protein.

Half life

26.7 days

Clearance

9.5 mL/hr

Toxicity

Based on data from animal studies, there is risk of fetal harm when administered to pregnant women. It is therefore advisable for pregnant women to use contraception during treatment and for 5 months afterwards. There have been reported cases of severe pneumonitis or interstitial lung disease, including fatal cases, with the use of nivolumab during clinical trials. Therefore, patients taking this drug should be monitored for signs and symptoms of pneumonitis. During clinical trials there have also been reports of the development of immune-mediated colitis, immune-mediated hepatitis with increased liver test abnormalities, immune-mediated nephritis and renal dysfunction, immune-mediated hypothyroidism and hyperthyroidism, and rare cases of other immune-mediated reactions such as pancreatitis, uveitis, demyelination, autoimmune neuropathy, adrenal insufficiency, and facial and abducens nerve paresis.

Affected organisms

Not Available

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

Drug	Interaction	Drug group
Acetyldigitoxin	Acetyldigitoxin may decrease the cardiotoxic activities of Nivolumab.	Approved
Belimumab	The risk or severity of adverse effects can be increased when Nivolumab is combined with Belimumab.	Approved
Bevacizumab	Bevacizumab may increase the cardiotoxic activities of Nivolumab.	Approved, Investigational
Cabazitaxel	The risk or severity of adverse effects can be increased when Cabazitaxel is combined with Nivolumab.	Approved
Cyclophosphamide	Cyclophosphamide may increase the cardiotoxic activities of Nivolumab.	Approved, Investigational
Deslanoside	Deslanoside may decrease the cardiotoxic activities of Nivolumab.	Approved
Digitoxin	Digitoxin may decrease the cardiotoxic activities of Nivolumab.	Approved
Digoxin	Digoxin may decrease the cardiotoxic activities of Nivolumab.	Approved
Docetaxel	The risk or severity of adverse effects can be increased when Docetaxel is combined with Nivolumab.	Approved, Investigational
G17DT	The therapeutic efficacy of G17DT can be decreased when used in combination with Nivolumab.	Investigational
INGN 201	The therapeutic efficacy of INGN 201 can be decreased when used in combination with Nivolumab.	Investigational
INGN 225	The therapeutic efficacy of INGN 225 can be decreased when used in combination with Nivolumab.	Investigational
Oleandrin	Anvirzel may decrease the cardiotoxic activities of Nivolumab.	Experimental
Ouabain	Ouabain may decrease the cardiotoxic activities of Nivolumab.	Approved
Paclitaxel	The risk or severity of adverse effects can be increased when Paclitaxel is combined with Nivolumab.	Approved, Vet Approved
Rindopepimut	The therapeutic efficacy of CDX-110 can be decreased when used in combination with Nivolumab.	Investigational
SRP 299	The therapeutic efficacy of SRP 299 can be decreased when used in combination with Nivolumab.	Investigational
Trastuzumab	Trastuzumab may increase the cardiotoxic activities of Nivolumab.	Approved, Investigational

Food Interactions

Not Available

References

Synthesis Reference

Not Available

General References

Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116 ]
Tsai KK, Zarzoso I, Daud AI: PD-1 and PD-L1 antibodies for melanoma. Hum Vaccin Immunother. 2014;10(11):3111-6. doi: 10.4161/21645515.2014.983409. [PubMed:25625924 ]
Topalian SL, Sznol M, McDermott DF, Kluger HM, Carvajal RD, Sharfman WH, Brahmer JR, Lawrence DP, Atkins MB, Powderly JD, Leming PD, Lipson EJ, Puzanov I, Smith DC, Taube JM, Wigginton JM, Kollia GD, Gupta A, Pardoll DM, Sosman JA, Hodi FS: Survival, durable tumor remission, and long-term safety in patients with advanced melanoma receiving nivolumab. J Clin Oncol. 2014 Apr 1;32(10):1020-30. doi: 10.1200/JCO.2013.53.0105. Epub 2014 Mar 3. [PubMed:24590637 ]

External Links

Resource	Link
Drug Product Database	22643
RxList	http://www.rxlist.com/opdivo-drug.htm
Drugs.com	http://www.drugs.com/opdivo.html
Wikipedia	Nivolumab

ATC Codes

L01XC17 — Nivolumab

AHFS Codes

10:00

PDB Entries

Not Available

FDA label

Download (315 KB)

MSDS

Not Available

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Recruiting	Treatment	Melanoma (Skin) / Skin Cancers	1
0	Recruiting	Treatment	Renal Cancers	1
1	Active Not Recruiting	Basic Science	Advanced Melanoma / Metastatic Melanoma	1
1	Active Not Recruiting	Basic Science	Neoplasms, Colorectal	1
1	Active Not Recruiting	Basic Science	Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Cancer, Breast / Cancer, Ovarian / Carcinoma, Colorectal / Carcinoma, Pancreatic / Malignant Neoplasm of Prostate / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma / Tumors, Solid	1
1	Active Not Recruiting	Treatment	Chronic Myeloid Leukemia (CML)	1
1	Active Not Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Malignant Lymphomas / Malignant Solid Tumours	1
1	Active Not Recruiting	Treatment	Malignant Melanoma	1
1	Active Not Recruiting	Treatment	Melanoma (Skin)	2
1	Active Not Recruiting	Treatment	Metastatic Castration-resistant Prostrate Cancer (mCRPC) / Metastatic Melanoma (MEL) / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	2
1	Active Not Recruiting	Treatment	Tumors, Solid	1
1	Completed	Treatment	Advanced Solid Tumors / Recurrent Solid Tumors	1
1	Completed	Treatment	Colorectal Cancers / Malignant Melanoma / Malignant Neoplasm of Prostate / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cancers	1
1	Completed	Treatment	Malignant Solid Tumours	1
1	Completed	Treatment	Neoplasms by Site	1
1	Not Yet Recruiting	Treatment	Acute Myeloid Leukemia and Myelodysplastic Syndrome	1
1	Not Yet Recruiting	Treatment	Advanced Malignancies	1
1	Not Yet Recruiting	Treatment	Advanced Solid Tumors	1
1	Not Yet Recruiting	Treatment	Bladder Cancers	1
1	Not Yet Recruiting	Treatment	Cancer, Advanced	2
1	Not Yet Recruiting	Treatment	Follicular Lymphoma (FL)	1
1	Not Yet Recruiting	Treatment	Hepatocellular,Carcinoma	1
1	Not Yet Recruiting	Treatment	Leptomeningeal Disease / Melanoma and Other Malignant Neoplasms of Skin	1
1	Not Yet Recruiting	Treatment	Multiple Myeloma (MM)	1
1	Not Yet Recruiting	Treatment	Neuroblastomas	1
1	Not Yet Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	1
1	Not Yet Recruiting	Treatment	Recurrent Non-small Cell Lung Cancer	1
1	Not Yet Recruiting	Treatment	Tumors, Solid	1
1	Recruiting	Other	Melanoma	1
1	Recruiting	Other	Severe Sepsis	1
1	Recruiting	Treatment	ALK-positive NSCLC	1
1	Recruiting	Treatment	Adult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Adult Solid Neoplasm / Childhood Solid Neoplasm / Neoplasms, Metastatic	1
1	Recruiting	Treatment	Advanced Cancers	1
1	Recruiting	Treatment	Advanced Solid Tumors	3
1	Recruiting	Treatment	Advanced Solid Tumors (Part A/B/C/D) / Melanoma (Part E) / Non-small Cell Lung Cancer (NSCLC) and Melanoma (Part E) / Non-small Cell Lung Cancer (Part E) / Squamous Cell Cancer of the Head and Neck (Part E)	1
1	Recruiting	Treatment	Advanced Solid Tumors, Including But Not Limited to Lung Cancer / Cancer, Ovarian / Colorectal Cancers / Glioblastoma Multiforme / Head and Neck Carcinoma / Head and Neck Squamous Cell Cancer / Malignant Gliomas / Malignant Neoplasm of Pancreas / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma	1
1	Recruiting	Treatment	Advanced Solid Tumors / Cancers	1
1	Recruiting	Treatment	Advanced Solid Tumors / Head and Neck Carcinoma, Squamous Cell / Non-Small-Cell Lung Carcinoma (NSCLC) / Triple-Negative Breast Neoplasms	1
1	Recruiting	Treatment	Advanced or Metastatic Solid Tumors	2
1	Recruiting	Treatment	Aggressive Non-Hodgkin Lymphoma / Neoplasms, Advanced Solid / Recurrent Solid Neoplasm / Refractory Mantle Cell Lymphoma / T-Cell Non-Hodgkin Lymphoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Astrocytomas / Glioblastomas / Malignant Gliomas	1
1	Recruiting	Treatment	B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Refractory Adult Acute Lymphoblastic Leukemia / Refractory Childhood Acute Lymphoblastic Leukemia	1
1	Recruiting	Treatment	B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1	1
1	Recruiting	Treatment	BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
1	Recruiting	Treatment	Bladder Carcinoma / Colorectal Cancers / Salivary Gland Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1	Recruiting	Treatment	Bladder Tumors / Lung Cancers / Malignant Melanoma / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC) / Skin Cancers / Transitional Cell Carcinoma of the Bladder / Urinary Bladder Cancer	1
1	Recruiting	Treatment	Breast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Cancer, Advanced Solid Tumors	1
1	Recruiting	Treatment	Cancer, Ovarian / Fallopian Tubes / Primary Peritoneal Cancer / Recurrent Ovarian Cancer	1
1	Recruiting	Treatment	Cancers	1
1	Recruiting	Treatment	Chordomas	1
1	Recruiting	Treatment	Classical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
1	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma	1
1	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Solid Neoplasms / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Urothelial Carcinoma / Stage III Penile Cancer / Stage III Renal Cell Cancer / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Urethral Cancer / Stage IIIa Penile Cancer / Stage IIIb Penile Cancer / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Urothelial Carcinoma / Stage IV Penile Cancer / Stage IV Renal Cell Cancer / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Urethral Cancer / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma	1
1	Recruiting	Treatment	CcRCC / Clear Cell Renal Cell Carcinoma / RCC / Renal Cancers / Renal Cell Adenocarcinoma	1
1	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Stage I Renal Cell Cancer / Stage II Renal Cell Cancer / Stage III Renal Cell Cancer	1
1	Recruiting	Treatment	Colo-rectal Cancer / Malignant Neoplasm of Stomach / Metastatic Cancers / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma / Squamous-cell Carcinomas of the Head and Neck / Tumors, Solid	1
1	Recruiting	Treatment	EBV Related Hodgkin's Lymphoma / EBV Related Lymphoma / EBV Related Non-Hodgkin's Lymphoma / EBV-Related PTLD / Lymphoma, Hodgkins / Lymphoproliferative Disorders / NonHodgkin Lymphoma	1
1	Recruiting	Treatment	Esophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Stomach	1
1	Recruiting	Treatment	Esophageal Cancers / Lung Cancers / Malignant Neoplasm of Stomach / Renal Cancers	1
1	Recruiting	Treatment	Glioblastomas	1
1	Recruiting	Treatment	Glioblastomas / Gliosarcoma / Recurrent Brain Neoplasm	1
1	Recruiting	Treatment	Glioblastomas / Gliosarcoma / Supratentorial Glioblastoma	1
1	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1	Recruiting	Treatment	Hematopoietic Cell Transplantation Recipient / Myeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Lymphocytic Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma	1
1	Recruiting	Treatment	Human Papillomavirus Positive Anal Carcinoma / Human Papillomavirus Positive Cervical Carcinoma / Human Papillomavirus Positive Oropharyngeal Carcinoma / Human Papillomavirus Positive Penile Carcinoma / Human Papillomavirus Positive Vulvar Carcinoma / Human Papillomavirus-Related Carcinoma	1
1	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC)	1
1	Recruiting	Treatment	Lymphoma, Hodgkins	1
1	Recruiting	Treatment	Lymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
1	Recruiting	Treatment	Malignancies, Hematologic	1
1	Recruiting	Treatment	Malignant Gliomas	1
1	Recruiting	Treatment	Malignant Melanoma	1
1	Recruiting	Treatment	Melanoma	2
1	Recruiting	Treatment	Metastatic Colorectal Cancers	1
1	Recruiting	Treatment	Metastatic Malignant Neoplasm in the Brain / Metastatic Malignant Neoplasm in the Spine / Stage IV Skin Melanoma	1
1	Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
1	Recruiting	Treatment	Neoplasms Malignant	1
1	Recruiting	Treatment	Neoplasms, Breast / Neoplasms, Pancreatic	1
1	Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	1
1	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1	Recruiting	Treatment	Stage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma	1
1	Unknown Status	Treatment	Advanced Solid Tumors / Recurrent Solid Tumors	1
1	Withdrawn	Treatment	Metastatic Melanoma	1
1, 2	Active Not Recruiting	Treatment	Cancer, Advanced	1
1, 2	Active Not Recruiting	Treatment	Cancer, Breast / Triple-Negative Breast Cancer (TNBC)	1
1, 2	Active Not Recruiting	Treatment	Metastatic Cancers	1
1, 2	Not Yet Recruiting	Treatment	Adenocarcinoma of the Lung / Lung Cancers	1
1, 2	Not Yet Recruiting	Treatment	Antibodies, Neoplasm	1
1, 2	Not Yet Recruiting	Treatment	Chondrosarcomas / Ewing's Sarcoma (ES) / Liposarcoma / Sarcoma, Osteogenic / Undifferentiated Pleomorphic Sarcoma	1
1, 2	Not Yet Recruiting	Treatment	Colorectal Cancers	1
1, 2	Not Yet Recruiting	Treatment	Colorectal Cancers / Malignant Neoplasm of Pancreas	1
1, 2	Not Yet Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1, 2	Not Yet Recruiting	Treatment	Immunotherapy / Neoplasms, Head and Neck	1
1, 2	Not Yet Recruiting	Treatment	Melanoma	1
1, 2	Not Yet Recruiting	Treatment	Metastatic Melanoma	1
1, 2	Not Yet Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	1
1, 2	Recruiting	Prevention	Stage IIIC Skin Melanoma / Stage IV Skin Melanoma	1
1, 2	Recruiting	Treatment	ALK Gene Mutation / EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
1, 2	Recruiting	Treatment	ALK Gene Translocation / EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Translocation / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
1, 2	Recruiting	Treatment	Acute Myeloid Leukaemias (AML) / Leukemias / Myelodysplastic Syndrome	1
1, 2	Recruiting	Treatment	Advanced B-cell NHL / Advanced Solid Tumors	1
1, 2	Recruiting	Treatment	Advanced Malignancies / Metastatic Malignancy	1
1, 2	Recruiting	Treatment	Advanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma	1
1, 2	Recruiting	Treatment	Advanced or Metastatic Colorectal Cancer (CRC) / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Ligand 1 (PD-L1) Inhibitor / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Protein 1 (PD-1) Inhibitor / Advanced or Metastatic Solid Tumors / Non-Small Cell Lung Cancer (NSCLC; Squamous or Nonsquamous) / Pancreatic Ductal Adenocarcinoma (PDAC)	1
1, 2	Recruiting	Treatment	Advanced or Metastatic Solid Tumors	1
1, 2	Recruiting	Treatment	B Cell NHL Including DLBCL / Carcinoma, Squamous Cell of Head and Neck / Glioblastomas / HL / Melanoma / Neoplasms, Colorectal / Neoplasms, Ovarian / Non-Small-Cell Lung Carcinoma (NSCLC)	1
1, 2	Recruiting	Treatment	Biallelic Mismatch Repair Deficiency (bMMRD) Positive Patients / Refractory or Recurrent Hypermutated Malignancies	1
1, 2	Recruiting	Treatment	Broad Solid Tumor	1
1, 2	Recruiting	Treatment	CANCER,NOS	1
1, 2	Recruiting	Treatment	Cancer of Rectum	1
1, 2	Recruiting	Treatment	Cancer, Advanced	3
1, 2	Recruiting	Treatment	Cancer, Advanced / Carcinoma, Colorectal / Endometrial / Malignant Neoplasm of Pancreas / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma / Uterine	1
1, 2	Recruiting	Treatment	Cancer, Advanced / Hepatocellular,Carcinoma	1
1, 2	Recruiting	Treatment	Cancer, Advanced / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC)	1
1, 2	Recruiting	Treatment	Cancers	3
1, 2	Recruiting	Treatment	Cancers / Carcinoma NOS / Tumors, Solid	1
1, 2	Recruiting	Treatment	Cancers / Melanoma / Metastatic Melanoma / Neoplasm of Lung / Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Carcinoma，Non-Small-Cell Lung / Melanoma / Renal Cell Adenocarcinoma	1
1, 2	Recruiting	Treatment	Childhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Non-Hodgkin's lymphoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
1, 2	Recruiting	Treatment	Children, Adolescents and Young Adults With Refractory or Recurrent Malignancies	1
1, 2	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma	1
1, 2	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC)	1
1, 2	Recruiting	Treatment	Colorectal Cancer (CRC) / Glioblastoma (GBM) (Phase ll Only) / Malignant Melanoma of Head and Neck / Malignant Neoplasm of Colon / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC) / Ovarian Carcinoma / Renal Cell Carcinoma (RCC) (Phase ll Only) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1, 2	Recruiting	Treatment	EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
1, 2	Recruiting	Treatment	Extensive-Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)	1
1, 2	Recruiting	Treatment	Gastroesophageal Junction Region (GEJ) Cancer / Malignant Neoplasm of Stomach	1
1, 2	Recruiting	Treatment	Glioblastomas / Hepatocellular Carcinoma Recurrent / Non-Small Cell Lung Cancer Recurrent / Tumors, Solid	1
1, 2	Recruiting	Treatment	Grade 3a Follicular Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma	1
1, 2	Recruiting	Treatment	Hepatic Metastases / Uveal Melanoma	1
1, 2	Recruiting	Treatment	Hepatocellular Carcinoma (HCC)	1
1, 2	Recruiting	Treatment	Hepatocellular,Carcinoma	2
1, 2	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC)	1
1, 2	Recruiting	Treatment	Lymphoma, Hodgkins	1
1, 2	Recruiting	Treatment	Malignant Lymphomas / Multiple Myeloma (MM)	1
1, 2	Recruiting	Treatment	Malignant Neoplasm of Pancreas	1
1, 2	Recruiting	Treatment	Malignant Neoplasm of Prostate	1
1, 2	Recruiting	Treatment	Malignant Neoplasms of Urinary Tract / Other Disorders of Kidney and Ureter / Renal Cell Adenocarcinoma	1
1, 2	Recruiting	Treatment	Malignant Solid Tumours	2
1, 2	Recruiting	Treatment	Melanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma	1
1, 2	Recruiting	Treatment	Metastatic Brain Cancer	1
1, 2	Recruiting	Treatment	Metastatic Melanoma / Stage III Melanoma / Stage IV Melanoma	1
1, 2	Recruiting	Treatment	Metastatic Renal Cell Cancer / Stage IV Renal Cell Cancer	1
1, 2	Recruiting	Treatment	Neoplasms by Site	1
1, 2	Recruiting	Treatment	Neoplasms, Hematologic	2
1, 2	Recruiting	Treatment	Non-Hodgkin's Disease	1
1, 2	Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	4
1, 2	Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC) / Tumors, Solid	1
1, 2	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
1, 2	Recruiting	Treatment	Stage III/IV Melanoma	1
1, 2	Recruiting	Treatment	Tumors, Solid	1
1, 2	Recruiting	Treatment	Various Advanced Cancer	1
1, 2	Terminated	Other	Tumors, Solid	1
1, 2	Withdrawn	Treatment	Squamous Non-Small Cell Lung Cancer	1
2	Active Not Recruiting	Other	Non-Small-Cell Lung Carcinoma (NSCLC)	1
2	Active Not Recruiting	Treatment	Adenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Stage IV Cervical Cancer / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer	1
2	Active Not Recruiting	Treatment	Advanced Non-Small Cell Lung Cancer	2
2	Active Not Recruiting	Treatment	Advanced or Metastatic Melanoma	1
2	Active Not Recruiting	Treatment	Anal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Recurrent Anal Canal Carcinoma / Stage IV Anal Canal Cancer	1
2	Active Not Recruiting	Treatment	Gastric Adenocarcinoma / Gastroesophageal Junction Adenocarcinoma	1
2	Active Not Recruiting	Treatment	Hodgkins Disease (HD)	1
2	Active Not Recruiting	Treatment	Malignant Lymphomas	1
2	Active Not Recruiting	Treatment	Malignant Neoplasm of Prostate / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma	1
2	Active Not Recruiting	Treatment	Malignant Pleural Mesothelioma (MPM)	1
2	Active Not Recruiting	Treatment	Melanoma	1
2	Active Not Recruiting	Treatment	Melanoma / Metastatic Brain Tumors	1
2	Active Not Recruiting	Treatment	Mesothelioma	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Unresectable Melanoma	1
2	Active Not Recruiting	Treatment	Nasopharyngeal Nonkeratinizing Carcinoma / Recurrent Nasopharyngeal Undifferentiated Carcinoma / Recurrent Nasopharynx Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Nasopharyngeal Undifferentiated Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Nasopharyngeal Undifferentiated Carcinoma / Stage IVA Nasopharyngeal Carcinoma / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma / Stage IVC Nasopharyngeal Carcinoma AJCC v7	1
2	Active Not Recruiting	Treatment	Non-Hodgkin's Lymphoma (NHL)	1
2	Active Not Recruiting	Treatment	Previously Treated Metastatic Adenocarcinoma of the Pancreas	1
2	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	1
2	Active Not Recruiting	Treatment	Squamous Cell Non-small Cell Lung Cancer	1
2	Active Not Recruiting	Treatment	Tumors, Solid	1
2	Active Not Recruiting	Treatment	Various Advanced Cancer	1
2	Completed	Treatment	Glioblastoma Multiforme	1
2	Enrolling by Invitation	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC) / Small Cell Lung Carcinoma	1
2	Not Yet Recruiting	Treatment	Activated B-Cell-Like Diffuse Large B-Cell Lymphoma / ALK-Positive Large B-Cell Lymphoma / Atypical Burkitt/Burkitt-Like Lymphoma / Diffuse Large B-Cell Lymphoma Associated With Chronic Inflammation / Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / Epstein-Barr Virus Positive Diffuse Large B-Cell Lymphoma of the Elderly / Epstein-Barr Virus-Positive Mucocutaneous Ulcer / Epstein-Barr Virus-Positive Neoplastic Cells Present / Germinal Center B-Cell-Like Diffuse Large B-Cell Lymphoma / High-Grade B-Cell Lymphoma With MYC and BCL2 and/or BCL6 Rearrangements / Human Herpes Virus 8-Related Malignant Neoplasm / Human Herpesvirus-8-Positive Neoplastic Cells Present / Intravascular Large B-Cell Lymphoma / Large B-Cell Lymphoma With IRF4 Rearrangement / MYC-Negative B-Cell Lymphoma With 11q Aberration Resembling Burkitt Lymphoma / Plasmablastic Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma, Leg Type / Primary Diffuse Large B-Cell Lymphoma of the Central Nervous System / Primary Effusion Lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Lymphomatoid Granulomatosis / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Skin Ulcers / Small Intestinal B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Burkitt Lymphoma / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma	1
2	Not Yet Recruiting	Treatment	Acral lentiginous melanoma / Mucosal Melanoma	1
2	Not Yet Recruiting	Treatment	Adenocarcinoma of the Pancreas	1
2	Not Yet Recruiting	Treatment	Adnexal Carcinoma / Apocrine Carcinoma / Carcinoma, Adenoid Cystic / Eccrine Porocarcinoma / Extraocular Cutaneous Sebaceous Carcinoma / Hidradenocarcinoma / Keratoacanthoma / Malignant sweat gland neoplasm / Microcystic Adnexal Carcinoma / Neuroendocrine Carcinoma of the Skin / NK-Cell Lymphoma, Unclassifiable / Non-Melanomatous Lesion / Paget's Disease / Papillary Adenocarcinoma / Primary Cutaneous Mucinous Carcinoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Refractory Mycosis Fungoides / Refractory T-Cell Non-Hodgkin Lymphoma / Sezary Syndrome / Signet Ring Cell Carcinoma / Skin Basal Cell Carcinoma / Skin Basosquamous Cell Carcinoma / Skin Squamous Cell Carcinoma / Spiradenocarcinoma / Squamous Cell Carcinoma of Unknown Primary Origin / Stage III Skin Cancer / Stage IV Skin Cancer / Sweat Gland Carcinoma / Trichilemmocarcinoma / Vulvar Squamous Cell Carcinoma	1
2	Not Yet Recruiting	Treatment	Advanced Non-Small Cell Lung Cancer / Lung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)	1
2	Not Yet Recruiting	Treatment	Advanced Renal Cell Carcinoma	1
2	Not Yet Recruiting	Treatment	Bladder Cancers / Transitional Cell Carcinoma	1
2	Not Yet Recruiting	Treatment	Carcinoma，Non-Small-Cell Lung / Large Cell Lung Carcinoma Metastatic / Lung adenocarcinoma metastatic / Metastatic Lung Cancer / Nonsmall Cell Lung Cancer	1
2	Not Yet Recruiting	Treatment	Chondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)	1
2	Not Yet Recruiting	Treatment	Chromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma	1
2	Not Yet Recruiting	Treatment	Clear Cell Metastatic Renal Cell Carcinoma	1
2	Not Yet Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
2	Not Yet Recruiting	Treatment	Gastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours	1
2	Not Yet Recruiting	Treatment	Giant Cell Glioblastoma / Gliosarcoma / Oligodendrogliomas / Recurrent Glioblastoma / Small Cell Glioblastoma	1
2	Not Yet Recruiting	Treatment	HER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma	1
2	Not Yet Recruiting	Treatment	Malignant Neoplasm of Pancreas	2
2	Not Yet Recruiting	Treatment	Malignant Neoplasm of Prostate	2
2	Not Yet Recruiting	Treatment	Melanoma	2
2	Not Yet Recruiting	Treatment	Melanoma / Metastatic Melanoma	1
2	Not Yet Recruiting	Treatment	Microsatellite Instability / Neoplasms, Head and Neck / Penile Neoplasms / Renal Cell Adenocarcinoma / Skin Neoplasms	1
2	Not Yet Recruiting	Treatment	Non Small Cell Lung Cancer Recurrent / Non-Small Cell Carcinoma of Lung, TNM Stage 4 / Non-Small-Cell Lung Cancer Metastatic / Nonsmall Cell Lung Cancer	1
2	Not Yet Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	1
2	Not Yet Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
2	Not Yet Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer	2
2	Not Yet Recruiting	Treatment	Renal Cancers	1
2	Not Yet Recruiting	Treatment	Renal Cell Adenocarcinoma	1
2	Not Yet Recruiting	Treatment	Soft Tissue Sarcoma (STS)	1
2	Not Yet Recruiting	Treatment	Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
2	Not Yet Recruiting	Treatment	Type B3 Thymoma and Thymic Carcinoma	1
2	Not Yet Recruiting	Treatment	Various Advanced Cancer	1
2	Recruiting	Diagnostic	Brain Metastasis / Melanoma	1
2	Recruiting	Treatment	Acinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Endometrial Adenocarcinomas / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metastatic Malignant Neoplasm of Unknown Primary Origin / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Acute Adult T-Cell Leukemia/Lymphoma / Adult T-Cell Leukemia/Lymphoma / CD3 Positive / CD4-Positive Neoplastic Cells Present / Chronic Adult T-Cell Leukemia/Lymphoma / HTLV-1 Infection / Hypercalcemia / Lymphomatous Adult T-Cell Leukemia/Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Smoldering Adult T-Cell Leukemia/Lymphoma	1
2	Recruiting	Treatment	Acute Myeloid Leukaemias (AML) / Leukemias	1
2	Recruiting	Treatment	Adenocarcinoma of the Lung / Lung Cancers / Non-Squamous Non-Small Cell Lung Cancer (NSCLC)	1
2	Recruiting	Treatment	Adenocarcinomas	1
2	Recruiting	Treatment	Adult Acute Myeloid Leukemia in Remission	1
2	Recruiting	Treatment	Advanced Malignant Neoplasm / Advanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Neoplasm of Prostate / Malignant Uterine Neoplasm / Melanoma / Oesophageal Carcinoma / Ovarian Carcinoma / Plasma Cell Myeloma / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Solid Neoplasm / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Neoplasm / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Solid Neoplasms / Thyroid Gland Carcinoma / Uterine Corpus Cancer	1
2	Recruiting	Treatment	Advanced Stage Non-small Cell Lung Cancer	1
2	Recruiting	Treatment	Biliary Tract Cancer / Biliary Tract Neoplasms	1
2	Recruiting	Treatment	Bladder Cancers / Melanoma	1
2	Recruiting	Treatment	Blastic Plasmacytoid Dendritic Cell Neoplasm (BPDCN) / Hepatosplenic T-Cell Lymphoma / HTLV-1 Infection / NK-Cell Lymphoma, Unclassifiable / Primary Systemic Anaplastic Large Cell Lymphoma, ALK-Negative / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Angioimmunoblastic T-cell Lymphoma / Recurrent Enteropathy-Associated T-Cell Lymphoma / Recurrent Mycosis Fungoides / Refractory Adult T-Cell Leukemia/Lymphoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Angioimmunoblastic T-cell Lymphoma / Refractory Enteropathy-Associated T-Cell Lymphoma / Refractory Mycosis Fungoides / Refractory Nasal Type Extranodal NK/T-Cell Lymphoma / Refractory Peripheral T-Cell Lymphoma, Not Otherwise Specified	1
2	Recruiting	Treatment	Brain Metastases, Adult / Clear-cell Metastatic Renal Cell Carcinoma / Non Small Cell Lung Cancer Metastatic	1
2	Recruiting	Treatment	CD (Cluster of Differentiation) 30-Positive Neoplastic Cells Present / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
2	Recruiting	Treatment	Cancer, Advanced	2
2	Recruiting	Treatment	Cancer, Breast	1
2	Recruiting	Treatment	Cancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cancer	1
2	Recruiting	Treatment	Cancers	1
2	Recruiting	Treatment	Cancers / Neoplasia / Neoplasms / Tumors	1
2	Recruiting	Treatment	Chordomas / Ependymomas / Meningiomas	1
2	Recruiting	Treatment	Chronic Lymphocytic Leukaemia (CLL) / Leukemias	1
2	Recruiting	Treatment	Classical Hodgkin Lymphoma	2
2	Recruiting	Treatment	Classical Hodgkin Lymphoma / Hematopoietic Cell Transplantation Recipient / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
2	Recruiting	Treatment	Classical Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma / Stage III Hodgkin Lymphoma / Stage IIIA Hodgkin Lymphoma / Stage IIIB Hodgkin Lymphoma / Stage IV Hodgkin Lymphoma / Stage IVA Hodgkin Lymphoma / Stage IVB Hodgkin Lymphoma	1
2	Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
2	Recruiting	Treatment	Colon Carcinoma	1
2	Recruiting	Treatment	Documented Stage III NSCLC, Amenable to Concomitant or Sequential Chemoradiotherapy / Locally Advanced Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Gastric cancer stage IV	1
2	Recruiting	Treatment	Gastrointestinal Stromal Tumors	1
2	Recruiting	Treatment	Haematological Malignancies	1
2	Recruiting	Treatment	Head and Neck Carcinoma	2
2	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
2	Recruiting	Treatment	Hepatocellular,Carcinoma	1
2	Recruiting	Treatment	Hodgkins Disease (HD)	2
2	Recruiting	Treatment	Kidney Cancer Metastatic / Kidney Cancer, Stage IV / Renal Cancers	1
2	Recruiting	Treatment	Leptomeningeal Carcinomatosis / Melanoma	1
2	Recruiting	Treatment	Leukemias	2
2	Recruiting	Treatment	Leukemias / Myelodysplastic Syndrome	1
2	Recruiting	Treatment	Limited Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)	1
2	Recruiting	Treatment	Lung Cancers / Metastatic Lung Cancer / Non-Small-Cell Lung Carcinoma (NSCLC)	1
2	Recruiting	Treatment	Lung Squamous Cell Carcinoma Stage IV / Nonsquamous Nonsmall Cell Neoplasm of Lung	1
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer	1
2	Recruiting	Treatment	Microsatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer	1
2	Recruiting	Treatment	Major Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma	1
2	Recruiting	Treatment	Malignant Lymphomas	1
2	Recruiting	Treatment	Malignant Melanoma	1
2	Recruiting	Treatment	Malignant Melanoma Stage III	1
2	Recruiting	Treatment	Malignant Neoplasm of Prostate	1
2	Recruiting	Treatment	Malignant Neoplasms of Respiratory and Intrathoracic Organs / Non-Small-Cell Lung Carcinoma (NSCLC)	1
2	Recruiting	Treatment	Malignant Pleural Mesothelioma (MPM)	1
2	Recruiting	Treatment	Melanoma	4
2	Recruiting	Treatment	Melanoma / Oligometastatic Melanoma	1
2	Recruiting	Treatment	Melanoma / Uveal Melanoma	1
2	Recruiting	Treatment	Meningiomas	1
2	Recruiting	Treatment	Metastatic Cancers / Recurrent Cancer / Salivary Gland Carcinoma	1
2	Recruiting	Treatment	Metastatic Carcinoma in the Adrenal Cortex / Recurrent Adrenal Cortex Carcinoma / Stage III Adrenal Cortex Carcinoma / Stage IV Adrenal Cortex Carcinoma	1
2	Recruiting	Treatment	Metastatic Clear Cell Renal Cell Carcinoma	1
2	Recruiting	Treatment	Metastatic Melanoma	2
2	Recruiting	Treatment	Metastatic Melanoma / Stage IV Melanoma	1
2	Recruiting	Treatment	Metastatic Renal Cell Cancer / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Non-Small Cell Lung Cancer / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma	1
2	Recruiting	Treatment	Metastatic Renal Cell Carcinoma	2
2	Recruiting	Treatment	Metastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic	1
2	Recruiting	Treatment	Metastatic or Advanced Non-Small Cell Lung Cancer (NSCLC)	1
2	Recruiting	Treatment	Multiple Myeloma (MM)	1
2	Recruiting	Treatment	Myeloproliferative Diseases	1
2	Recruiting	Treatment	Nasopharyngeal Carcinoma	1
2	Recruiting	Treatment	Neoplasms, Brain	1
2	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin / Skin Cancers	1
2	Recruiting	Treatment	Non-Small Lung Cancer, Epigenetic Therapy	1
2	Recruiting	Treatment	Non-Small-Cell Lung Cancer (NSCLC)	1
2	Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	7
2	Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC) / Non-squamous Cell Lung Cancer / Squamous Cell Carcinoma of Lung	1
2	Recruiting	Treatment	Oral Cavity SCC	1
2	Recruiting	Treatment	Pancreatic Cancer Metastatic	1
2	Recruiting	Treatment	Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma	1
2	Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
2	Recruiting	Treatment	Salivary Gland Cancers	1
2	Recruiting	Treatment	Smoldering Multiple Myeloma (SMM)	1
2	Recruiting	Treatment	Solid Tumors Induced by Prior Radiation Exposure	1
2	Recruiting	Treatment	Untreated Metastatic Pancreatic Ductal Adenocarcinoma	1
2	Recruiting	Treatment	Uterine Corpus Leiomyosarcoma	1
2	Recruiting	Treatment	Uveal Melanoma	1
2	Recruiting	Treatment	Various Advanced Cancer	1
2	Recruiting	Treatment	Refractory, metastatic Colorectal cancer	1
2	Suspended	Treatment	Gastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Metastatic Liposarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Soft Tissue Sarcoma / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Soft Tissue Sarcoma / Stage IVA Bone Sarcoma / Stage IVB Bone Sarcoma / Unresectable Liposarcoma	1
2	Withdrawn	Treatment	Advanced Non-Small Cell Lung Cancer / Metastatic Non-Small Cell Lung Cancer / Neoplasms, Lung	1
2	Withdrawn	Treatment	Lung Cancer, Nonsmall Cell, Stage I	1
2	Withdrawn	Treatment	Melanoma	1
2, 3	Not Yet Recruiting	Treatment	Adult Myelodysplastic Syndrome / Myelodysplastic Syndrome With Excess Blasts-2 / Untreated Adult Acute Myeloid Leukemia	1
2, 3	Recruiting	Treatment	Malignant Neoplasm of Stomach	1
2, 3	Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma	1
2, 3	Suspended	Treatment	Recurrent Melanoma of the Skin / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
3	Active Not Recruiting	Treatment	Advanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
3	Active Not Recruiting	Treatment	Advanced or Metastatic (Medically or Surgically Unresectable) Clear-cell Renal Cell Carcinoma	1
3	Active Not Recruiting	Treatment	Lung Cancers	1
3	Active Not Recruiting	Treatment	Malignant Neoplasm of Stomach	1
3	Active Not Recruiting	Treatment	Melanoma	4
3	Active Not Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	2
3	Active Not Recruiting	Treatment	Non-Squamous Cell Non-small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Recurrent Glioblastoma	1
3	Active Not Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
3	Active Not Recruiting	Treatment	Squamous Cell Non-small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Stage IV or Recurrent Non-Small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Unresectable or Metastatic Melanoma	2
3	Not Yet Recruiting	Treatment	Lung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)	1
3	Not Yet Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	1
3	Not Yet Recruiting	Treatment	Renal Cell Adenocarcinoma	1
3	Recruiting	Treatment	BRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
3	Recruiting	Treatment	Brain Cancer	1
3	Recruiting	Treatment	Cancer, Advanced	1
3	Recruiting	Treatment	Esophageal Cancers	1
3	Recruiting	Treatment	Gastroesophageal Junction Cancer / Malignant Neoplasm of Stomach	1
3	Recruiting	Treatment	Head and Neck Carcinoma	1
3	Recruiting	Treatment	Hepatocellular,Carcinoma / I.V Advanced Cancer	1
3	Recruiting	Treatment	Hodgkins Disease (HD)	1
3	Recruiting	Treatment	Lung Cancers	3
3	Recruiting	Treatment	Malignant Neoplasm of Stomach	1
3	Recruiting	Treatment	Melanoma	2
3	Recruiting	Treatment	Mesothelioma	2
3	Recruiting	Treatment	Metastatic Brain Tumors	1
3	Recruiting	Treatment	Multiple Myeloma (MM)	1
3	Recruiting	Treatment	Non-Small-Cell Lung Carcinoma (NSCLC)	4
3	Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma	1
3	Recruiting	Treatment	Renal Cell Adenocarcinoma	1
3	Recruiting	Treatment	Sarcomatoid Renal Cell Carcinoma / Stage II Renal Cell Cancer / Stage III Renal Cell Cancer / Unclassified Renal Cell Carcinoma	1
3	Recruiting	Treatment	Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7	1
3	Recruiting	Treatment	Urothelial Cancer	1
3	Recruiting	Treatment	Various Advanced Cancer	2
4	Active Not Recruiting	Other	Renal Cell Adenocarcinoma	1
4	Recruiting	Not Available	Metastatic Melanoma	1
4	Recruiting	Treatment	Renal Cell Adenocarcinoma	1
Not Available	Active Not Recruiting	Not Available	Inflammation, Brain	1
Not Available	Active Not Recruiting	Not Available	Melanoma	1
Not Available	No Longer Available	Not Available	Malignant Melanoma	1
Not Available	No Longer Available	Not Available	Non-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer	1
Not Available	No Longer Available	Not Available	Stage III (Unresectable) or Stage IV Advanced Melanoma	1
Not Available	Not Yet Recruiting	Not Available	Nivolumab Treatment in Expanded Use in Real World	1
Not Available	Recruiting	Treatment	Cancer, Breast	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage forms

Form	Route	Strength
Injection	Intravenous	10 mg/mL
Solution	Intravenous	10 mg

Prices

Not Available

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
US2013173223	No	2013-05-13	2033-05-13	US

Properties

State

Solid

Experimental Properties

Not Available

Taxonomy

Description

Not Available

Kingdom

Organic Compounds

Super Class

Organic Acids

Class

Carboxylic Acids and Derivatives

Sub Class

Amino Acids, Peptides, and Analogues

Direct Parent

Peptides

Alternative Parents

Not Available

Substituents

Not Available

Molecular Framework

Not Available

External Descriptors

Not Available

Targets

Details

1. Programmed cell death protein 1

Kind: Protein
Organism: Human
Pharmacological action: yes
Actions: antibody

General Function:: Signal transducer activity
Specific Function:: Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. Possible cell death inducer, in association with other factors.
Gene Name:: PDCD1
Uniprot ID:: Q15116
Molecular Weight:: 31646.635 Da

References

Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116 ]

Drug created on February 24, 2015 16:02 / Updated on June 07, 2017 15:17

Get DrugBank to go!

Targets

References