Nivolumab

Identification

Name
Nivolumab
Accession Number
DB09035  (DB06132)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Nivolumab is a fully human IgG4 antibody targeting the immune checkpoint programmed death receptor-1 (PD-1).6 This antibody was produced entirely in mice and grafted onto human kappa and IgG4 Fc region with the mutation S228P for additional stability and reduced variability.5 It was developed by Bristol Myers Squibb.6

Nivolumab was granted FDA approval on 22 December 2014.6

Protein structure
Db09035
Protein chemical formula
C6362H9862N1712O1995S42
Protein average weight
143597.3811 Da
Sequences
>Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK
>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Nivolumab
External IDs
BMS 936558 / BMS-936558 / GTPL7335 / MDX 1106 / MDX-1106 / ONO 4538 / ONO-4538
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUs
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2017-12-08Not applicableUs
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUs
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Categories
UNII
31YO63LBSN
CAS number
946414-94-4

Pharmacology

Indication

Nivolumab is indicated to treat unresectable or metastatic melanoma, adjuvant treatment of melanoma, metastatic non-small cell lung cancer, small cell lung cancer, advanced renal cell carcinoma, classical Hodgkin lymphoma, squamous cell carcinoma of the head and neck, urothelial carcinoma, microsatellite instability-high or mismatch repair deficient metastatic colorectal cancer, and hepatocellular carcinoma.6

Associated Conditions
Associated Therapies
Pharmacodynamics

Nivolumab blocks PD-1 inhibitory signalling to T-cells.6 It has a long duration of action as it is administered every 2-4 weeks.6 Patients should be counselled regarding the risk of immune-mediated adverse effects, infusion-related adverse effects, complications of allogenic hematopoietic stem cell transplants, embryo-fetal toxicity.6

Mechanism of action

The ligands PD-L1 and PD-L2 bind to the PD-1 receptor on T-cells, inhibiting the action of these cells.6 Tumor cells express PD-L1 and PD-L2.6 Nivolumab binds to PD-1, preventing PD-L1 and PD-L2 from inhibiting the action of T-cells, restoring a patient's tumor-specific T-cell response.1

TargetActionsOrganism
AProgrammed cell death protein 1
antibody
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Pharmacokinetic studies have suggested that nivolumab presents linear pharmacokinetics with a dose-proportional increase in peak concentration and AUC. The time to peak plasma concentration ranges between 1-4 hours.1 The absorption pharmacokinetic properties respective to the administration of a dose of 10 mg/kg are reported to be Cmax, Tmax and AUC of 242 µg/kg, 2.99 hours and 68100 µg*h/mL respectively.3

Volume of distribution

The volume of distribution at steady state when a dose of 10 mg/kg of nivolumab is administered is reported to be 91.1 mL/kg.3 At doses ranging from 0.1 to 20 mg/kg the volume of distribution is reported to be 8L.4

Protein binding

There is no information regarding the plasma protein binding of nivolumab.7

Metabolism

There have not been formal studies regarding the specific metabolism of nivolumab but as a human monoclonal antibody, it has been suggested to be degraded to small peptides and individual amino acids.7

Route of elimination

There have not been studies regarding the specific route of elimination of nivolumab.7

Half life

The serum half life of nivolumab is approximately 20 days1 with an elimination half life of 26.7 days.4

Clearance

The estimated clearance rate of nivolumab is 9.4 mL/h.2 The clearance rate seems to be increased according to body weight.4

Toxicity

Data regarding overdoses of nivolumab are not readily available.6 Common adverse effects include Rash, pruritus, cough, upper respiratory tract infection, and peripheral edema.6

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Nivolumab.
AbituzumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Abrilumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Nivolumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Nivolumab.
AducanumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Nivolumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Nivolumab.
AlirocumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Amatuximab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
No interactions found.

References

General References
  1. Brahmer JR, Hammers H, Lipson EJ: Nivolumab: targeting PD-1 to bolster antitumor immunity. Future Oncol. 2015;11(9):1307-26. doi: 10.2217/fon.15.52. Epub 2015 Mar 23. [PubMed:25798726]
  2. Bajaj G, Wang X, Agrawal S, Gupta M, Roy A, Feng Y: Model-Based Population Pharmacokinetic Analysis of Nivolumab in Patients With Solid Tumors. CPT Pharmacometrics Syst Pharmacol. 2017 Jan;6(1):58-66. doi: 10.1002/psp4.12143. Epub 2016 Dec 26. [PubMed:28019091]
  3. Lee KW, Lee DH, Kang JH, Park JO, Kim SH, Hong YS, Kim ST, Oh DY, Bang YJ: Phase I Pharmacokinetic Study of Nivolumab in Korean Patients with Advanced Solid Tumors. Oncologist. 2018 Feb;23(2):155-e17. doi: 10.1634/theoncologist.2017-0528. Epub 2017 Nov 20. [PubMed:29158363]
  4. Solimando DA Jr, Waddell JA: Nivolumab and Olaparib. Hosp Pharm. 2015 May;50(5):356-66. doi: 10.1310/hpj5005-356. [PubMed:26405320]
  5. Mashima E, Inoue A, Sakuragi Y, Yamaguchi T, Sasaki N, Hara Y, Omoto D, Ohmori S, Haruyama S, Sawada Y, Yoshioka M, Nishio D, Nakamura M: Nivolumab in the treatment of malignant melanoma: review of the literature. Onco Targets Ther. 2015 Aug 6;8:2045-51. doi: 10.2147/OTT.S62102. eCollection 2015. [PubMed:26273207]
  6. FDA Approved Drug Products: Opvido Nivolumab Intravenous Injection [Link]
  7. BC Cancer Agency: Opdivo Monograph [Link]
External Links
KEGG Drug
D10316
PubChem Substance
347910393
RxNav
1597876
ChEMBL
CHEMBL2108738
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Nivolumab
ATC Codes
L01XC17 — Nivolumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (2.51 MB)
MSDS
Download (1.26 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Kidney Carcinoma / Metastatic Renal Cell Cancer / Renal Cancers / Stage IV Renal Cell Cancer AJCC V71
0Active Not RecruitingTreatmentHepatocellular,Carcinoma1
0Active Not RecruitingTreatmentLarynx / Lip, Oral Cavity and Pharynx2
0Active Not RecruitingTreatmentMalignant Melanoma of Skin / Melanoma (Skin) / Skin Cancers1
0CompletedTreatmentMetastatic Non-Small Cell Lung Cancer1
0Enrolling by InvitationBasic ScienceLung Cancer Non-Small Cell Cancer (NSCLC)1
0Not Yet RecruitingBasic ScienceHNSCC1
0Not Yet RecruitingBasic ScienceMelanoma, Malignant1
0Not Yet RecruitingTreatmentMalignant Neoplasm of Pancreas1
0RecruitingTreatmentHuman Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS) / Immunosuppression / Kaposi s Sarcoma (KS)1
0RecruitingTreatmentLiver Cancer1
0RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
0RecruitingTreatmentMetastatic Melanoma1
0RecruitingTreatmentRefractory Hodgkin Lymphoma / Relapsed Hodgkin Lymphoma1
0RecruitingTreatmentSarcomas1
0RecruitingTreatmentSquamous Cell Carcinoma Mouth / Squamous Cell Carcinoma of the Oral Cavity / Squamous Cell Carcinoma, Head And Neck1
1Active Not RecruitingTreatmentALK Gene Rearrangement / EGFR Gene Mutations / Locally Advanced Lung Non-Small Cell Carcinoma / Lung Non-Small Cell Carcinoma / Stage II Lung Cancer AJCC v8 / Stage IIA Lung Cancer AJCC v8 / Stage IIB Lung Cancer AJCC v8 / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Unresectable Lung Non-Small Cell Carcinoma1
1Active Not RecruitingTreatmentALK-positive NSCLC1
1Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemia Recurrent / Acute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplant Recipient / Chronic, recurrent Lymphocytic Leukemia / Myeloproliferative Neoplasms / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hematologic Malignancy / Recurrent Hodgkin Lymphoma / Recurrent Myelodysplastic Syndrome / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma1
1Active Not RecruitingTreatmentAdenocarcinomas / Advanced Non Small Cell Lung Cancer / Carcinoma, Adenosquamous / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Squamous Cell Carcinoma (SCC)1
1Active Not RecruitingTreatmentAdvanced Hepatocellular Carcinoma1
1Active Not RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
1Active Not RecruitingTreatmentAdvanced Solid Tumors, Including But Not Limited to Lung Cancer / Colorectal Cancers / Glioblastoma Multiforme (GBM) / Gliomas, Malignant / Head and Neck Carcinoma / Head and Neck Squamous Cell Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Melanoma / Ovarian Cancer / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentAdvanced Solid Tumors / Solid Tumor, Recurrent1
1Active Not RecruitingTreatmentAggressive Non-Hodgkin Lymphoma / Neoplasms, Advanced Solid / Recurrent Solid Neoplasm / Refractory Mantle Cell Lymphoma / T-Cell Non-Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1Active Not RecruitingTreatmentBRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
1Active Not RecruitingTreatmentBladder Cancer TNM Staging Distant Metastasis (M) M0 / Bladder Cancer TNM Staging Primary Tumor (T) T2 / Bladder Cancer TNM Staging Primary Tumor (T) T2A / Bladder Cancer TNM Staging Primary Tumor (T) T2B / Bladder Cancer TNM Staging Primary Tumor (T) T3 / Bladder Cancer TNM Staging Primary Tumor (T) T3A / Bladder Cancer TNM Staging Primary Tumor (T) T3B / Bladder Cancer TNM Staging Regional Lymph Node (N) N0 / Bladder Cancer TNM Staging Regional Lymph Node (N) N11
1Active Not RecruitingTreatmentBladder Tumors / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Melanoma / Melanoma, Malignant / Skin Cancers / Transitional Cell Carcinoma of the Bladder / Urinary Bladder Cancer1
1Active Not RecruitingTreatmentBlasts 30 Percent or Less of Bone Marrow Nucleated Cells / Chronic Myelomonocytic Leukemia / High Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Refractory Anemia1
1Active Not RecruitingTreatmentBreast Adenocarcinoma / Invasive Breast Carcinoma / Metastatic Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm1
1Active Not RecruitingTreatmentBreast Cancer / Carcinoma, Colorectal / Carcinoma, Pancreatic / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Ovarian Cancer / Prostate Cancer / Renal Cell Adenocarcinoma / Tumors, Solid1
1Active Not RecruitingTreatmentCancer, Advanced1
1Active Not RecruitingTreatmentChordomas1
1Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1Active Not RecruitingTreatmentCcRCC / Clear Cell Renal Cell Carcinoma / RCC / Renal Cancers / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentDisorders, Lymphoproliferative / EBV Related Hodgkin's Lymphoma / EBV Related Lymphoma / EBV Related Non-Hodgkin's Lymphoma / EBV-Related PTLD / Lymphoma, Hodgkins / NonHodgkin Lymphoma1
1Active Not RecruitingTreatmentFallopian Tubes / Ovarian Cancer / Primary Peritoneal Cancer / Recurrent Ovarian Cancer1
1Active Not RecruitingTreatmentGlioblastoma Multiforme (GBM) / Glioblastomas1
1Active Not RecruitingTreatmentGlioblastomas1
1Active Not RecruitingTreatmentGlioblastomas / Gliosarcoma / Recurrent Brain Neoplasm1
1Active Not RecruitingTreatmentGliosarcoma / Supratentorial Glioblastoma1
1Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1Active Not RecruitingTreatmentHepatocellular,Carcinoma2
1Active Not RecruitingTreatmentLocally Advanced Hepatocellular Carcinoma1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Cancers / Recurrent Cancer / Renal Cell Adenocarcinoma / Squamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Transitional Cell Carcinoma / Tumors, Solid1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Castration-resistant Prostrate Cancer / Metastatic Castration-resistant Prostrate Cancer (mCRPC) / Metastatic Melanoma / Metastatic Melanoma (MEL) / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentMalignancies3
1Active Not RecruitingTreatmentMalignancies / Novel Coronavirus Infectious Disease (COVID-19)1
1Active Not RecruitingTreatmentMalignant Melanoma of Skin / Melanoma (Skin)2
1Active Not RecruitingTreatmentMelanoma1
1Active Not RecruitingTreatmentMelanoma, Uveal1
1Active Not RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
1Active Not RecruitingTreatmentMetastatic Malignant Neoplasm in the Brain / Metastatic Malignant Neoplasm in the Spine / Stage IV Skin Melanoma1
1Active Not RecruitingTreatmentMetastatic Malignant Solid Neoplasm1
1Active Not RecruitingTreatmentMetastatic Melanoma1
1Active Not RecruitingTreatmentStages III Skin Melanoma1
1Active Not RecruitingTreatmentTumors, Solid1
1CompletedBasic ScienceAdvanced Melanoma / Metastatic Melanoma1
1CompletedBasic ScienceRenal Cell Adenocarcinoma1
1CompletedOtherSevere Sepsis1
1CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
1CompletedTreatmentAdult Solid Neoplasm / Childhood Solid Neoplasm / Neoplasms, Metastatic1
1CompletedTreatmentAdvanced Malignancies1
1CompletedTreatmentAdvanced Solid Tumors1
1CompletedTreatmentAdvanced Solid Tumors / Advanced Solid Tumors Cancer1
1CompletedTreatmentAdvanced Solid Tumors / Solid Tumor, Recurrent1
1CompletedTreatmentAstrocytomas / Glioblastomas / Gliomas, Malignant1
1CompletedTreatmentCancer, Advanced2
1CompletedTreatmentChronic Myeloid Leukemia (CML)1
1CompletedTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma, Malignant / Prostate Cancer / Renal Cancers1
1CompletedTreatmentEsophageal Cancers / Lung Cancers / Malignant Neoplasm of Stomach / Oral Cancers / Renal Cancers1
1CompletedTreatmentHepatitis C Viral Infection1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic or Advanced Non-Small Cell Lung Cancer (NSCLC)1
1CompletedTreatmentMalignant Lymphomas / Malignant Solid Tumours1
1CompletedTreatmentMalignant Solid Tumours1
1CompletedTreatmentMelanoma, Malignant2
1CompletedTreatmentNeoplasms Malignant1
1CompletedTreatmentNeoplasms by Site1
1CompletedTreatmentNeoplasms, Breast / Neoplasms, Pancreatic1
1CompletedTreatmentTumors, Solid1
1Enrolling by InvitationOtherOncology1
1Not Yet RecruitingTreatmentAdvanced Malignant Skin Neoplasm / Metastatic Malignant Skin Neoplasm1
1Not Yet RecruitingTreatmentAdvanced Melanoma1
1Not Yet RecruitingTreatmentCancer, Advanced1
1Not Yet RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1Not Yet RecruitingTreatmentFibrolamellar Hepatocellular Carcinoma (FLC)1
1Not Yet RecruitingTreatmentGlioblastomas / Gliomas, Malignant / Grade III Glioma / Recurrent Glioblastoma / Recurrent Grade III Glioma / Recurrent Malignant Gliomas1
1Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1Not Yet RecruitingTreatmentMelanoma1
1Not Yet RecruitingTreatmentMetastatic Adenocarcinoma1
1Not Yet RecruitingTreatmentMetastatic Cancers1
1Not Yet RecruitingTreatmentOvarian Cancer1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingTreatmentAcral lentiginous melanoma / Central nervous system melanoma / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Leptomeningeal Disease / Leptomeningeal Neoplasm / Melanocytoma / Melanoma and Other Malignant Neoplasms of Skin / Metastatic Melanoma / Metastatic Uveal Melanoma / Mucosal Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v81
1RecruitingTreatmentAcute Myeloid Leukemia and Myelodysplastic Syndrome1
1RecruitingTreatmentAdenocarcinoma of the Pancreas / Colon Carcinoma Metastatic in the Liver / Colorectal Adenocarcinoma / Resectable Pancreatic Carcinoma / Stage I Pancreatic Cancer / Stage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage II Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Hepatocellular,Carcinoma / Malignant Neoplasm of Stomach / Tumors, Solid1
1RecruitingTreatmentAdrenocortical Carcinoma (Part G) / Advanced Solid Tumors (Part A/B/C/D) / High-circulating Myeloid-derived Suppressor Cells (Part H) / Melanoma (Part E) / Mesothelioma (Part G) / Non-small Cell Lung Cancer (NSCLC) and Melanoma (Part E) / Non-small Cell Lung Cancer (Part E) / Squamous Cell Cancer of the Head and Neck (Part E) / Triple Negative Breast Cancer (Part F)1
1RecruitingTreatmentAdult Acute Myeloid Leukemia / Leukemia Acute Myeloid Leukemia (AML)1
1RecruitingTreatmentAdvanced Clear Cell Renal Cell Carcinoma / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Kidney Small Cell Carcinoma / Metastatic Bladder Small Cell Carcinoma / Metastatic Bladder Squamous Cell Carcinoma / Metastatic Bladder Urothelial Carcinoma / Metastatic Kidney Medullary Carcinoma / Metastatic Malignant Genitourinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Renal Cell Carcinoma / Metastatic Renal Pelvis Urothelial Carcinoma / Metastatic Sarcomatoid Renal Cell Carcinoma / Metastatic Ureter Urothelial Carcinoma / Metastatic Urethral Urothelial Carcinoma / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma AJCC v6 and v7 / Stage III Bladder Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Penile Cancer AJCC v7 / Stage III Renal Cell Cancer AJCC v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer AJCC v7 / Stage IIIa Penile Cancer AJCC v7 / Stage IIIb Penile Cancer AJCC v7 / Stage IV Bladder Adenocarcinoma AJCC v7 / Stage IV Bladder Squamous Cell Carcinoma AJCC v7 / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Penile Cancer AJCC v7 / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer AJCC v71
1RecruitingTreatmentAdvanced Colon Adenocarcinoma / Metastatic Colon Adenocarcinoma / Metastatic Colorectal Adenocarcinoma / Metastatic Colorectal Carcinoma / Metastatic Rectal Adenocarcinoma / Stage III Colon Cancer AJCC v8 / Stage III Rectal Cancer AJCC v8 / Stage IIIA Colon Cancer AJCC v8 / Stage IIIA Rectal Cancer AJCC v8 / Stage IIIB Colon Cancer AJCC v8 / Stage IIIB Rectal Cancer AJCC v8 / Stage IIIC Colon Cancer AJCC v8 / Stage IIIC Rectal Cancer AJCC v8 / Stage IV Colon Cancer AJCC v8 / Stage IV Colorectal Cancer AJCC v8 / Stage IV Rectal Cancer AJCC v8 / Stage IVA Colon Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVA Rectal Cancer AJCC v8 / Stage IVB Colon Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVB Rectal Cancer AJCC v8 / Stage IVC Colon Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v8 / Stage IVC Rectal Cancer AJCC v81
1RecruitingTreatmentAdvanced Malignant Neoplasm / Autoimmune Diseases / Crohn's Disease (CD) / Dermatomyositis / Disseminated Sclerosis / Inflammatory Bowel Diseases (IBD) / Metastatic Malignant Neoplasm / Rheumatoid Arthritis / Scleroderma, Systemic / Sjögren's Syndrome / Systemic Lupus Erythematosus (SLE) / Ulcerative Colitis / Unresectable Malignant Neoplasm1
1RecruitingTreatmentAdvanced Malignant Neoplasm / Recurrent Malignant Neoplasm / Refractory Malignant Neoplasm1
1RecruitingTreatmentAdvanced Melanoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Renal Cell Adenocarcinoma1
1RecruitingTreatmentAdvanced Renal Cell Carcinoma / Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma / Stage III Renal Cell Cancer AJCC v8 / Stage III Renal Cell Cancer American Joint Committee on Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer American Joint Committee on Cancer AJCC v8 / Unresectable Renal Cell Carcinoma1
1RecruitingTreatmentAdvanced Solid Cancers1
1RecruitingTreatmentAdvanced Solid Tumors2
1RecruitingTreatmentAdvanced Solid Tumors / Advanced Solid Tumors Cancer / Malignancies1
1RecruitingTreatmentAdvanced Solid Tumors / Cervical Cancers / Colorectal Cancers / EGFR Positive Solid Tumor / Head and Neck Carcinoma / Hepatocellular,Carcinoma / HER2 Positive Breast Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Lymphomas / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Melanoma / Microsatellite Instability / Neuroendocrine Carcinoma of the Skin / Renal Cell Adenocarcinoma / Small Cell Lung Cancer (SCLC) / Squamous Cell Carcinoma (SCC) / Transitional Cell Carcinoma1
1RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1RecruitingTreatmentAcute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / Myelodysplastic Syndrome / Refractory Acute Myelogenous Leukemia (AML)1
1RecruitingTreatmentAnatomic Stage 0 Breast Cancer AJCC v8 / Anatomic Stage I Breast Cancer AJCC v8 / Anatomic Stage IA Breast Cancer AJCC v8 / Anatomic Stage IB Breast Cancer AJCC v8 / Anatomic Stage II Breast Cancer AJCC v8 / Anatomic Stage IIA Breast Cancer AJCC v8 / Anatomic Stage IIB Breast Cancer AJCC v8 / Anatomic Stage IIIA Breast Cancer AJCC v8 / Anatomic Stage IIIB Breast Cancer AJCC v8 / HER2/Neu Negative / Invasive Ductal Carcinoma, Not Otherwise Specified / Progesterone Receptor Negative / Prognostic Stage 0 Breast Cancer AJCC v8 / Prognostic Stage I Breast Cancer AJCC v8 / Prognostic Stage IA Breast Cancer AJCC v8 / Prognostic Stage IB Breast Cancer AJCC v8 / Prognostic Stage II Breast Cancer AJCC v8 / Prognostic Stage IIA Breast Cancer AJCC v8 / Prognostic Stage IIB Breast Cancer AJCC v8 / Prognostic Stage IIIA Breast Cancer AJCC v8 / Prognostic Stage IIIB Breast Cancer AJCC v8 / Triple-Negative Breast Carcinoma1
1RecruitingTreatmentAnn Arbor Stage III Lymphoma / Ann Arbor Stage IV Lymphoma / Metastatic Malignant Solid Neoplasm1
1RecruitingTreatmentAutoimmune Diseases / Crohn's Disease (CD) / Disseminated Sclerosis / Giant Cell Arteritis (GCA) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Polymyalgia Rheumatica / Psoriasis / Rheumatoid Arthritis / Systemic Lupus Erythematosus (SLE) / Ulcerative Colitis1
1RecruitingTreatmentBladder Carcinoma / Colorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Salivary Gland Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentBrain and Nervous System / Eye and Orbit1
1RecruitingTreatmentBreast Cancer1
1RecruitingTreatmentBreast Cancer / Cancer, Advanced / Colo-rectal Cancer / Endometrial Cancer / Lung Cancers / Neoplasms Malignant / Neoplasms, Lung / Neoplasms, Ovarian / Ovarian Cancer / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentBreast Cancer / Leukemia Acute Myeloid Leukemia (AML) / Malignant Neoplasm of Pancreas / Prostate Cancer1
1RecruitingTreatmentBreast Cancer / Transitional Cell Carcinoma1
1RecruitingTreatmentCancer, Advanced2
1RecruitingTreatmentCancer, Bladder1
1RecruitingTreatmentCancer, Bladder / Cholangiocarcinomas / Malignant Neoplasm of Colon / Malignant Neoplasm of Stomach / Melanoma / Ovarian Cancer / Palpable Subcutaneous Malignant Lesions / Renal Cell Adenocarcinoma / Tumors, Solid1
1RecruitingTreatmentCholangiocarcinomas / Colorectal Cancers / Gastroesophageal Cancer (GC) / Hepatocellular,Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Metastatic Castration Resistant Prostate Cancer / Renal Cell Adenocarcinoma / Sarcomas / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC) / Triple-Negative Breast Cancer (TNBC)1
1RecruitingTreatmentChronic Leukemias / Leukemia, Acute / Malignant Lymphomas / Myelodysplastic Syndromes1
1RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Follicular Lymphoma (FL) / Indolent Non-Hodgkin's Lymphomas / Loss of Chromosome 17p / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Lymphoplasmacytic Lymphoma / Marginal Zone Lymphoma (MZL) / Richter's Syndrome / TP53 Gene Mutation1
1RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Recurrent Diffuse Large B-Cell Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Richter's Syndrome / Small Lymphocytic Lymphoma / Transformed Chronic Lymphocytic Leukemia to Diffuse Large B-Cell Lymphoma / Transformed Follicular Lymphoma to Diffuse Large B-Cell Lymphoma / Transformed Small Lymphocytic Lymphoma to Diffuse Large B-Cell Lymphoma1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma / Stage I Renal Cell Cancer AJCC v6 and v7 / Stage II Renal Cell Cancer AJCC v7 / Stage III Renal Cell Cancer AJCC v7 / Stage IV Renal Cell Cancer AJCC V71
1RecruitingTreatmentClinical Stage III Cutaneous Melanoma AJCC v8 / Clinical Stage III Merkel Cell Carcinoma AJCC v8 / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Clinical Stage IV Merkel Cell Carcinoma AJCC v8 / High-Frequency Microsatellite Instability / Metastatic Basal cell carcinoma / Metastatic Melanoma / Metastatic Merkel Cell Carcinoma / Metastatic Skin Squamous Cell Carcinoma / Pathologic Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage III Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIA Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIA Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIB Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v8 / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Pathologic Stage IV Merkel Cell Carcinoma AJCC v8 / Unresectable Basal Cell Carcinoma / Unresectable Melanoma / Unresectable Merkel Cell Carcinoma1
1RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Colon / Metastatic Colorectal Cancer (MCRC)1
1RecruitingTreatmentColorectal neoplasms malignant / Hepatic Metastases1
1RecruitingTreatmentEsophageal Cancers / Gastroesophageal Cancer (GC) / Malignant Neoplasm of Stomach1
1RecruitingTreatmentFallopian Tubes / High Grade Serous Ovarian / Primary Peritoneal Cancer1
1RecruitingTreatmentFollicular Lymphoma (FL)2
1RecruitingTreatmentGlioblastomas4
1RecruitingTreatmentGliomas, Malignant2
1RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Melanoma / Tumors, Solid1
1RecruitingTreatmentHigh-Risk Resectable NSCLC1
1RecruitingTreatmentHuman Papillomavirus Positive Anal Carcinoma / Human Papillomavirus Positive Cervical Carcinoma / Human Papillomavirus Positive Oropharyngeal Carcinoma / Human Papillomavirus Positive Penile Carcinoma / Human Papillomavirus Positive Vulvar Carcinoma / Human Papillomavirus-Related Carcinoma1
1RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome Acute Myeloid Leukemia / Myelodysplastic Syndromes1
1RecruitingTreatmentLocally Advanced Esophageal Squamous Cell Carcinoma1
1RecruitingTreatmentLymphoma, B Cell / Lymphoma, B-Cell1
1RecruitingTreatmentLymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignant Lymphomas1
1RecruitingTreatmentMalignancies1
1RecruitingTreatmentMalignancies, Hematologic1
1RecruitingTreatmentMalignancies, Hematologic / Tumors, Solid1
1RecruitingTreatmentMalignant Neoplasm of Stomach1
1RecruitingTreatmentMalignant Peritoneal Neoplasm / Malignant Retroperitoneal Neoplasm / Peritoneal Carcinomatosis / Platinum-Resistant Fallopian Tube Carcinoma / Platinum-Resistant Ovarian Carcinoma / Platinum-Resistant Primary Peritoneal Carcinoma / Recurrent Cervical Carcinoma / Recurrent Endometrial Carcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Stage IV Cervical Cancer AJCC v8 / Stage IV Fallopian Tube Cancer AJCC v8 / Stage IV Ovarian Cancer AJCC v8 / Stage IV Primary Peritoneal Cancer AJCC v8 / Stage IVA Cervical Cancer AJCC v8 / Stage IVA Fallopian Tube Cancer AJCC v8 / Stage IVA Ovarian Cancer AJCC v8 / Stage IVA Primary Peritoneal Cancer AJCC v8 / Stage IVB Cervical Cancer AJCC v8 / Stage IVB Fallopian Tube Cancer AJCC v8 / Stage IVB Ovarian Cancer AJCC v8 / Stage IVB Primary Peritoneal Cancer AJCC v81
1RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
1RecruitingTreatmentMelanoma1
1RecruitingTreatmentMelanoma, Malignant1
1RecruitingTreatmentMesothelioma / Pleural Mesotheliomas / Wilms' tumor1
1RecruitingTreatmentMetastases to soft tissue / Tumors, Solid1
1RecruitingTreatmentMetastatic Breast Cancer / Tumors Metastatic to Brain1
1RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer1
1RecruitingTreatmentMetastatic Hormone-sensitive Prostate Cancer1
1RecruitingTreatmentMetastatic Melanoma2
1RecruitingTreatmentMetastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
1RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
1RecruitingTreatmentMetastatic Solid Tumors / Treatment-Refractory Cancers1
1RecruitingTreatmentNK/T Cell Lymphoma1
1RecruitingTreatmentNeoplasms, Malignant1
1RecruitingTreatmentNeuroblastomas1
1RecruitingTreatmentNeuroblastomas / Pediatric Solid Tumors1
1RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Pathologic Stage IIIA Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIB Merkel Cell Carcinoma AJCC v81
1RecruitingTreatmentNewly Diagnosed Glioblastoma / Newly Diagnosed High Grade Glioma1
1RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL) / Tumors, Solid1
1RecruitingTreatmentOral Cavity Squamous Cell Carcinoma1
1RecruitingTreatmentPancreatic Adenocarcinoma Metastatic / Refractory Pancreatic Adenocarcinoma / Stage IV Pancreatic Cancer AJCC v81
1RecruitingTreatmentPathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v81
1RecruitingTreatmentRecurrent B Acute Lymphoblastic Leukemia / Recurrent Mixed Phenotype Acute Leukemia / Refractory B Acute Lymphoblastic Leukemia / Refractory Mixed Phenotype Acute Leukemia1
1RecruitingTreatmentRecurrent Central Nervous System Neoplasm / Recurrent Nervous System Lymphoma / Recurrent Primary Vitreoretinal DLBCL / Refractory Central Nervous System Neoplasm / Refractory Nervous System Lymphoma / Refractory Primary Vitreoretinal DLBCL1
1RecruitingTreatmentRecurrent Glioblastoma / Refractory Glioblastoma1
1RecruitingTreatmentRecurrent Hepatocellular Carcinoma / Refractory Liver Carcinoma / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v81
1RecruitingTreatmentRecurrent Plasma Cell Myeloma1
1RecruitingTreatmentSmall Cell Lung Cancer (SCLC)1
1RecruitingTreatmentSolid Tumor, Adult1
1RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
1RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentStage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma1
1RecruitingTreatmentStage IV Melanoma / Stage IV Non-Small Cell Lung Cancer / Stage IV Renal Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentStage IV Small Cell Lung Cancer1
1RecruitingTreatmentTransitional Cell Carcinoma1
1RecruitingTreatmentTumors, Solid1
1SuspendedTreatmentAdvanced Malignant Solid Neoplasm / Cancer, Anal / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Recurrent Classic Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1SuspendedTreatmentBreast Adenocarcinoma / Recurrent Breast Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Mycosis Fungoides / Recurrent Non-Hodgkin Lymphoma / Recurrent Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Nodal Marginal Zone Lymphoma / Refractory Non-Hodgkin's lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Breast Cancer AJCC v6 and v71
1SuspendedTreatmentGlioblastomas1
1SuspendedTreatmentMelanoma1
1TerminatedBasic ScienceNeoplasms, Colorectal1
1TerminatedOtherAdvanced Solid Tumors / Head and Neck Carcinoma, Squamous Cell / Lung Cancer Non-Small Cell Cancer (NSCLC) / Triple-Negative Breast Neoplasms1
1TerminatedOtherMelanoma1
1TerminatedTreatmentB Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Refractory Adult Acute Lymphoblastic Leukemia / Refractory Childhood Acute Lymphoblastic Leukemia1
1TerminatedTreatmentCancer, Bladder1
1TerminatedTreatmentHepatocellular,Carcinoma1
1TerminatedTreatmentLocally Advanced Cancer / Metastatic Cancers1
1TerminatedTreatmentMelanoma1
1TerminatedTreatmentMultiple Myeloma (MM)1
1TerminatedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1WithdrawnTreatmentHuman Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Stage II Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Squamous Cell Carcinoma AJCC v6 and v71
1WithdrawnTreatmentMalignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)1
1WithdrawnTreatmentMelanoma1
1WithdrawnTreatmentMetastatic Colorectal Cancer (MCRC)1
1WithdrawnTreatmentMetastatic Melanoma1
1WithdrawnTreatmentMetastatic Squamous Cell Carcinoma of the Head or Neck / Platinum- and Cetuximab-Refractory Squamous Cell Carcinoma of the Head or Neck / Recurrent Squamous Cell Carcinoma of the Head or Neck / Squamous Cell Carcinoma (SCC)1
1, 2Active Not RecruitingTreatmentAdvanced Malignancies / Clear Cell Renal Cell Carcinoma / Renal Cancers / Select Advanced Malignancies1
1, 2Active Not RecruitingTreatmentAdvanced and Metastatic Solid Tumor1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors / Tumors, Solid1
1, 2Active Not RecruitingTreatmentB Cell NHL Including DLBCL / B-Cell Malignancies / Carcinoma, Squamous Cell of Head and Neck / Colorectal Cancer (CRC) / CRC (Colorectal Cancer) / Glioblastomas / Head and Neck Carcinoma / HL / HNSCC (Head and Neck Squamous Cell Cancer / Hodgkin Lymphona (B-cell Malignancies) / I/O naïve Melanoma (MEL) / I/O Refractory MEL / I/O Relapsed MEL / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Lymphomas / Melanoma / Neoplasms, Colorectal / Neoplasms, Ovarian / Ovarian Cancer1
1, 2Active Not RecruitingTreatmentCancer, Advanced3
1, 2Active Not RecruitingTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
1, 2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1, 2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Kidney Carcinoma / Stage III Renal Cell Cancer AJCC v7 / Stage IV Renal Cell Cancer AJCC V71
1, 2Active Not RecruitingTreatmentColorectal neoplasms malignant1
1, 2Active Not RecruitingTreatmentCutaneous Melanoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Renal Cell Adenocarcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Transitional Cell Carcinoma1
1, 2Active Not RecruitingTreatmentEndometrial Cancer / Prostate Cancer1
1, 2Active Not RecruitingTreatmentEsophageal Squamous Cell Carcinoma (ESCC)1
1, 2Active Not RecruitingTreatmentExtensive-Stage Small Cell Lung Cancer / Small Cell Lung Cancer (SCLC)1
1, 2Active Not RecruitingTreatmentHepatocellular Carcinoma (HCC)1
1, 2Active Not RecruitingTreatmentHepatocellular,Carcinoma1
1, 2Active Not RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Leukemias / Myelodysplastic Syndrome1
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Tumors, Solid1
1, 2Active Not RecruitingTreatmentLymphoma, Hodgkins2
1, 2Active Not RecruitingTreatmentLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1, 2Active Not RecruitingTreatmentMSS / RAS-mutant Colorectal Cancer1
1, 2Active Not RecruitingTreatmentMalignancies5
1, 2Active Not RecruitingTreatmentMetastatic Melanoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Refractory Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Melanoma / Refractory Neuroblastoma / Refractory Non-Hodgkin's lymphoma / Refractory Osteosarcoma / Refractory Rhabdomyosarcoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Melanoma1
1, 2Active Not RecruitingTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2Active Not RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic1
1, 2Active Not RecruitingTreatmentNeoplasms, Hematologic2
1, 2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
1, 2Active Not RecruitingTreatmentNon-Small Cell Lung Cancer Recurrent / Recurrent Hepatocellular Carcinoma / Tumors, Solid1
1, 2Active Not RecruitingTreatmentOvarian Cancer Metastatic1
1, 2Active Not RecruitingTreatmentPancreatic Adenocarcinoma Metastatic1
1, 2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma2
1, 2Active Not RecruitingTreatmentSmall Cell Lung Cancer (SCLC)1
1, 2Active Not RecruitingTreatmentSmall Cell Lung Cancer (SCLC) / Small Cell Lung Cancer Extensive Stage1
1, 2Active Not RecruitingTreatmentTumors, Solid1
1, 2Active Not RecruitingTreatmentVarious Advanced Cancer1
1, 2CompletedPreventionStage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2CompletedTreatmentAdvanced B-cell NHL / Advanced Solid Tumors1
1, 2CompletedTreatmentAdvanced Malignancies / Advanced or Metastatic Malignancies1
1, 2CompletedTreatmentCancer,NOS1
1, 2CompletedTreatmentCarcinoma NOS / HCC / Hepatocellular,Carcinoma / Malignancies / Tumors, Solid1
1, 2CompletedTreatmentClear Cell Renal Cell Carcinoma1
1, 2CompletedTreatmentColorectal Cancer (CRC) / Colorectal Cancer (CRC)-Enrollment Completed / Glioblastoma (GBM) (Phase ll Only) / Glioblastoma (GBM) (Phase ll Only)-Enrollment Completed / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma of Head and Neck / Malignant Neoplasm of Colon / Melanoma / Ovarian Carcinoma / Ovarian Carcinoma-Enrollment Completed / Renal Cell Carcinoma (RCC) (Phase ll Only) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2CompletedTreatmentGastroesophageal Junction Region (GEJ) Cancer / Malignant Neoplasm of Stomach1
1, 2CompletedTreatmentHepatocellular,Carcinoma1
1, 2CompletedTreatmentLymphoma, Hodgkins1
1, 2CompletedTreatmentMalignant Solid Tumours1
1, 2CompletedTreatmentMelanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma1
1, 2CompletedTreatmentSmall Cell Lung Cancer (SCLC)1
1, 2Not Yet RecruitingTreatmentAdenocarcinomas / Lung Cancer Non-Small Cell Cancer (NSCLC) / Stage IV1
1, 2Not Yet RecruitingTreatmentAdvanced Malignant Solid Neoplasm / Metastatic Malignant Solid Neoplasm / Unresectable Malignant Solid Neoplasm1
1, 2Not Yet RecruitingTreatmentAdvanced Solid Tumors1
1, 2Not Yet RecruitingTreatmentAntibodies, Neoplasm1
1, 2Not Yet RecruitingTreatmentCarcinoma, Non-small Cell Lung Cancer1
1, 2Not Yet RecruitingTreatmentColon Cancer With MSI-H or dMMR / Metastatic Melanoma / Renal Cell Adenocarcinoma1
1, 2Not Yet RecruitingTreatmentLocally Advanced Pancreatic Cancer (LAPC)1
1, 2Not Yet RecruitingTreatmentMalignant Melanoma Stage III1
1, 2Not Yet RecruitingTreatmentMelanoma / Metastatic Melanoma1
1, 2Not Yet RecruitingTreatmentMelanoma / Renal Cell Adenocarcinoma / Tumors, Solid1
1, 2Not Yet RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer1
1, 2Not Yet RecruitingTreatmentNeoplasms1
1, 2Not Yet RecruitingTreatmentOvarian Cancer1
1, 2Not Yet RecruitingTreatmentStage III Hepatocellular Carcinoma AJCC v8 / Stage IIIA Hepatocellular Carcinoma AJCC v8 / Stage IIIB Hepatocellular Carcinoma AJCC v8 / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v8 / Unresectable Fibrolamellar Carcinoma1
1, 2Not Yet RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1, 2Not Yet RecruitingTreatmentTumors1
1, 2RecruitingOtherMalignant Melanoma of Skin / Melanoma (Skin)1
1, 2RecruitingTreatmentAML, Childhood1
1, 2RecruitingTreatmentAdenocarcinoma of the Pancreas1
1, 2RecruitingTreatmentAdenocarcinoma of the Prostate / Prostate Cancer1
1, 2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Cervical Cancers / Colorectal Cancers / Fallopian Tube Cancer / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular Carcinoma (HCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Melanoma / Microsatellite Instability-high or Mismatch Repair Deficient (MSI-H/dMMR) / Neoplasms / Platinum-resistant Ovarian Cancer (PROC) / Primary Peritoneal Cancer / Renal Cell Adenocarcinoma / Serous Epithelial Ovarian Cancer / Urothelial Neoplasm1
1, 2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Colorectal Cancers / Malignant Neoplasm of Stomach / Melanoma / Metastatic Cancers1
1, 2RecruitingTreatmentAdvanced Head and Neck Squamous Cell Carcinoma / Lung Non-Small Cell Carcinoma / Metastatic Lung Non-Small Cell Carcinoma / PD-L1 positive / Recurrent Head and Neck Squamous Cell Carcinoma / Stage III Cutaneous Squamous Cell Carcinoma of the Head and Neck AJCC v8 / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Stage IV Cutaneous Squamous Cell Carcinoma of the Head and Neck AJCC v8 / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v8 / Unresectable Lung Non-Small Cell Carcinoma1
1, 2RecruitingTreatmentAdvanced Malignancies / Metastatic Cancers / Metastatic Malignancy1
1, 2RecruitingTreatmentAdvanced Malignant Solid Neoplasm / Metastatic Carcinoma in the Liver / Metastatic Carcinoma in the Lung / Metastatic Malignant Neoplasm in the Thoracic Cavity / Metastatic Malignant Solid Neoplasm1
1, 2RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
1, 2RecruitingTreatmentAdvanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma1
1, 2RecruitingTreatmentAdvanced Solid Tumors / Gynecologic Cancers1
1, 2RecruitingTreatmentAdvanced Tumors1
1, 2RecruitingTreatmentAggressive Non-Hodgkin Lymphoma / B-Cell Non-Hodgkin Lymphomas(NHL) / CD20 Positive / Diffuse Large B-Cell Lymphoma Unclassifiable / Intravascular Large B-Cell Lymphoma / Primary Mediastinal (Thymic) Large B-cell Lymphoma / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma / Transformed Follicular Lymphoma to Diffuse Large B-Cell Lymphoma1
1, 2RecruitingTreatmentBRAF NP_004324.2:p.V600E / Metastatic Colon Adenocarcinoma / Metastatic Microsatellite Stable Colorectal Carcinoma / Metastatic Rectal Adenocarcinoma / Progressive Disease / Recurrent Colorectal Carcinoma / Stage III Colorectal Cancer AJCC v8 / Stage IIIA Colorectal Cancer AJCC v8 / Stage IIIB Colorectal Cancer AJCC v8 / Stage IIIC Colorectal Cancer AJCC v8 / Stage IV Colorectal Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v8 / Unresectable Colon Adenocarcinoma / Unresectable Rectal Adenocarcinoma1
1, 2RecruitingTreatmentBiallelic Mismatch Repair Deficiency (bMMRD) Positive Patients / Refractory or Recurrent Hypermutated Malignancies1
1, 2RecruitingTreatmentBiliary Tract Cancer1
1, 2RecruitingTreatmentBorderline Resectable Pancreatic Adenocarcinoma / Resectable Pancreatic Ductal Adenocarcinoma1
1, 2RecruitingTreatmentBroad Solid Tumor1
1, 2RecruitingTreatmentCancer of Rectum1
1, 2RecruitingTreatmentCancer, Advanced7
1, 2RecruitingTreatmentCancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1, 2RecruitingTreatmentCancer, Advanced / Solid Tumors and Hematologic Malignancy1
1, 2RecruitingTreatmentCancer, Bladder / Malignancies / Malignant Melanoma of Skin / Melanoma (Skin) / Melanoma, Uveal / Microsatellite Instability / Mismatch Repair Deficiency / Non-Melanoma Skin Cancer (NMSC) / Ocular Melanoma1
1, 2RecruitingTreatmentCarcinoma,Non-Small-Cell Lung / Colorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Metastatic Breast Cancer / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentCastration-Resistant Prostate Cancer (CRPC) / Intermediate Risk Prostate Cancer1
1, 2RecruitingTreatmentCervical Cancers / Locally Advanced Cervical Cancer1
1, 2RecruitingTreatmentChildhood Lymphoma / Childhood Solid Tumors1
1, 2RecruitingTreatmentChildren, Adolescents and Young Adults With Refractory or Recurrent Malignancies1
1, 2RecruitingTreatmentChondrosarcomas / Chordomas / Classical Hodgkin's Lymphoma / Colorectal Cancers / Desmoid Tumors / Epithelioid Sarcoma / Ewing's Sarcoma (ES) / Hepatocellular,Carcinoma / Liposarcoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / MTOR Activating Mutation / PEComa / Renal Cell Adenocarcinoma / Sarcoma, Osteogenic / Squamous Cell Carcinoma (SCC) / Transitional Cell Carcinoma / Undifferentiated Pleomorphic Sarcoma1
1, 2RecruitingTreatmentClassical Hodgkin's Lymphoma / Lymphoma, Hodgkins / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
1, 2RecruitingTreatmentClinical Stage 0 Gastric Cancer AJCC v8 / Clinical Stage 0 Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage I Gastric Cancer AJCC v8 / Clinical Stage I Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastric Cancer AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IVA Gastric Cancer AJCC v8 / Clinical Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Gastric Adenocarcinoma / Localized Gastric Carcinoma / Localized Gastroesophageal Junction Adenocarcinoma / Pathologic Stage 0 Gastric Cancer AJCC v8 / Pathologic Stage 0 Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage I Gastric Cancer AJCC v8 / Pathologic Stage IA Gastric Cancer AJCC v8 / Pathologic Stage IA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IB Gastric Cancer AJCC v8 / Pathologic Stage IB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastric Cancer AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastric Cancer AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Gastric Cancer AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v81
1, 2RecruitingTreatmentCohort 1a and 1b: Glioblastoma Multiforme / Cohort 1a and 1b: Glioma / Cohort 2a and 2b: Hepatobiliary Tumors (Hepatocellular Carcinoma, Bile Duct Carcinoma, Intrahepatic Cholangiocarcinoma, Other Hepatobiliary Carcinomas) / Cohort 3a and 3b: Chondrosarcoma / Cohort 4a and 4b: Intrahepatic Cholangiocarcinoma / Cohort 5a: Other Solid Tumors With IDH1 Mutations1
1, 2RecruitingTreatmentColorectal Adenocarcinoma / CpG Island Methylator Phenotype / Metastatic Microsatellite Stable Colorectal Carcinoma / Refractory Colorectal Carcinoma / Stage IV Colorectal Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v81
1, 2RecruitingTreatmentColorectal Cancer (CRC) / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular Carcinoma (HCC) / Lung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2RecruitingTreatmentColorectal Cancers / Gastroesophageal Adenocarcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Transitional Cell Carcinoma / Tumors, Solid1
1, 2RecruitingTreatmentColorectal Cancers / Head and Neck Squamous Cell Carcinoma (HNSCC) / Melanoma / Neuroendocrine Carcinoma of the Skin / Ovarian Cancer / Renal Cell Adenocarcinoma / Sarcomas / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Shared Neoantigen-Positive Solid Tumors / Tumors, Solid1
1, 2RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentCombinations of Drugs; Dependence / HCC / Metastatic Hepatocellular Carcinoma1
1, 2RecruitingTreatmentDiffuse Intrinsic Pontine Glioma (DIPG) / Diffuse Midline Glioma, H3 K27M-Mutant / Gliomas1
1, 2RecruitingTreatmentEGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1, 2RecruitingTreatmentEsophageal Cancers1
1, 2RecruitingTreatmentEsophagus Cancer, Adenocarcinoma / Stomach Cancer, Adenocarcinoma1
1, 2RecruitingTreatmentGastroesophageal Cancer (GC) / Immune Checkpoint Inhibition1
1, 2RecruitingTreatmentGrade 3a Follicular Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory Burkitt Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma1
1, 2RecruitingTreatmentGrade II Meningioma / Grade III Meningioma / Recurrent Meningiomas1
1, 2RecruitingTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2RecruitingTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / Squamous Cell Cancer / Squamous Cell Carcinoma of the Hypopharynx / Squamous Cell Carcinoma of the Larynx / Squamous Cell Carcinoma of the Oral Cavity / Squamous Cell Carcinoma of the Oropharynx / Squamous Cell Carcinoma of the Paranasal Sinus1
1, 2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)2
1, 2RecruitingTreatmentHepatic Metastases / Melanoma, Uveal1
1, 2RecruitingTreatmentHepatocellular,Carcinoma3
1, 2RecruitingTreatmentHepatocellular,Carcinoma / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentHigh Grade Glioma (HGG)1
1, 2RecruitingTreatmentImmunotherapy / Neoplasms, Head and Neck1
1, 2RecruitingTreatmentIn-Transit Metastasis / Melanoma1
1, 2RecruitingTreatmentInvasive Bladder Cancer / Urinary Bladder Cancer1
1, 2RecruitingTreatmentLarynx / LIP / Oral Cavity Cancer / Pharynx Cancer1
1, 2RecruitingTreatmentLocally Advanced Pancreatic Ductal Adenocarcinoma (PDAC) / Pancreatic Ductal Adenocarcinoma1
1, 2RecruitingTreatmentLocally Advanced Unresectable Pancreatic Adenocarcinoma1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Ovarian Cancer / Triple Negative Breast Cancer (TNBC) / Urothelial Cancer1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Refractory Thoracic Tumors / Small Cell Lung Cancer (SCLC) / Thymic Carcinoma1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Cancer (SCLC) / Soft Tissue Sarcoma (STS) / Solid Tumor, Adult1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Stage II / Non-small Cell Lung Cancer Stage I1
1, 2RecruitingTreatmentLung Cancers / Malignant Pleural Effusions / Stage IV Metastatic Cancer1
1, 2RecruitingTreatmentLung Cancers / Small Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentLymphoma, Hodgkins2
1, 2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
1, 2RecruitingTreatmentMalignancies2
1, 2RecruitingTreatmentMalignancies / Melanoma / Metastatic Melanoma / Metastatic Non-Small Cell Lung Cancer / Neoplasm of Lung / Non Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentMalignancies / Neoplasms / Tumors1
1, 2RecruitingTreatmentMalignant Lymphomas / Multiple Myeloma (MM)1
1, 2RecruitingTreatmentMalignant Neoplasm of Colon / Unresectable or Metastatic Microsatellite Stable (MSS) Solid Tumor Along With Microsatellite Stable (MSS) Colon Cancer1
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentMalignant Solid Tumours1
1, 2RecruitingTreatmentMelanoma3
1, 2RecruitingTreatmentMelanoma / Melanoma Stage Iii / Melanoma Stage Iv1
1, 2RecruitingTreatmentMesothelioma1
1, 2RecruitingTreatmentMetastatic Breast Cancer1
1, 2RecruitingTreatmentMetastatic Colon Adenocarcinoma / Metastatic Colon Cancer / Metastatic Colorectal Adenocarcinoma / Metastatic Microsatellite Stable Colorectal Carcinoma / Metastatic Rectal Adenocarcinoma / Stage III Colon Cancer / Stage III Colorectal Cancer / Stage III Rectal Cancer / Stage IIIA Colon Cancer / Stage IIIA Colorectal Cancer / Stage IIIA Rectal Cancer / Stage IIIB Colon Cancer / Stage IIIB Colorectal Cancer / Stage IIIB Rectal Cancer / Stage IIIC Colon Cancer / Stage IIIC Colorectal Cancer / Stage IIIC Rectal Cancer / Stage IV Colorectal Cancer / Stage IV Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Colorectal Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Colorectal Cancer / Stage IVB Rectal Cancer / Stage IVC Colon Cancer / Stage IVC Colorectal Cancer / Stage IVC Rectal Cancer1
1, 2RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
1, 2RecruitingTreatmentMetastatic Colorectal Cancer (MCRC) / Metastatic Solid Tumor Cancer / Recurrent Head and Neck Cancer1
1, 2RecruitingTreatmentMetastatic Hepatocellular Carcinoma / Stage III Hepatocellular Carcinoma AJCC v8 / Stage IIIA Hepatocellular Carcinoma AJCC v8 / Stage IIIB Hepatocellular Carcinoma AJCC v8 / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v8 / Unresectable Hepatocellular Carcinoma1
1, 2RecruitingTreatmentMetastatic Malignant Neoplasm in the Brain / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Tumors Metastatic to Brain1
1, 2RecruitingTreatmentMetastatic Melanoma1
1, 2RecruitingTreatmentMetastatic Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2RecruitingTreatmentMultiple Myeloma (MM)1
1, 2RecruitingTreatmentNeoplasms by Site2
1, 2RecruitingTreatmentOsteosarcoma in Children / Recurrent Osteosarcoma / Sarcoma, Osteogenic / Sarcomas1
1, 2RecruitingTreatmentOvarian Epithelial Cancer1
1, 2RecruitingTreatmentPancreatic Adenocarcinoma Metastatic / Recurrent Pancreatic Adenocarcinoma / Stage II Pancreatic Cancer AJCC v8 / Stage IIA Pancreatic Cancer AJCC v8 / Stage IIB Pancreatic Cancer AJCC v8 / Stage III Pancreatic Cancer AJCC v8 / Stage IV Pancreatic Cancer AJCC v8 / Unresectable Pancreatic Carcinoma1
1, 2RecruitingTreatmentPancreatic Ductal Adenocarcinoma1
1, 2RecruitingTreatmentPeripheral T Cell Lymphoma (PTCL) / Peripheral T-Cell Lymphoma (PTCL)1
1, 2RecruitingTreatmentProstate Cancer1
1, 2RecruitingTreatmentProstate Cancer / Prostate Disease1
1, 2RecruitingTreatmentRecurrent Central Nervous System Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Refractory Central Nervous System Lymphoma / Refractory Diffuse Large B Cell Lymphoma1
1, 2RecruitingTreatmentRecurrent Classic Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma1
1, 2RecruitingTreatmentRefractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma1
1, 2RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2RecruitingTreatmentSarcoma, Bone / Soft Tissue Sarcoma (STS)1
1, 2RecruitingTreatmentSarcomas / Solid Tumor, Adult / Solid Tumor, Childhood1
1, 2RecruitingTreatmentSmall Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentSolid Cancers1
1, 2RecruitingTreatmentSolid Neoplasms1
1, 2RecruitingTreatmentStage III/IV Melanoma1
1, 2RecruitingTreatmentTumors of the Central Nervous System / Tumors, Solid1
1, 2RecruitingTreatmentTumors, Solid2
1, 2RecruitingTreatmentUveal Melanoma, Metastatic1
1, 2SuspendedTreatmentBiliary Tract Cancer1
1, 2SuspendedTreatmentBreast Cancer / Triple Negative Breast Cancer (TNBC) / Triple-Negative Breast Cancer (TNBC)1
1, 2SuspendedTreatmentMelanoma1
1, 2TerminatedOtherTumors, Solid1
1, 2TerminatedTreatmentALK Gene Translocation / EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Translocation / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v71
1, 2TerminatedTreatmentAdenocarcinoma of the Lung1
1, 2TerminatedTreatmentCancer, Advanced / Carcinoma, Colorectal / Endometrial / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Renal Cell Adenocarcinoma / Uterine1
1, 2TerminatedTreatmentCancer, Advanced / Hepatocellular,Carcinoma1
1, 2TerminatedTreatmentMalignancies1
1, 2TerminatedTreatmentMelanoma1
1, 2TerminatedTreatmentMetastatic Cancers1
1, 2TerminatedTreatmentMyelodysplastic Syndromes1
1, 2WithdrawnTreatmentAdenocarcinoma of the Lung / Lung Cancers1
1, 2WithdrawnTreatmentAdvanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage III Uveal Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm1
1, 2WithdrawnTreatmentColorectal Cancers1
1, 2WithdrawnTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2WithdrawnTreatmentMelanoma1
1, 2WithdrawnTreatmentMetastatic Colorectal Cancer (MCRC)1
1, 2WithdrawnTreatmentMetastatic Renal Cell Carcinoma1
1, 2WithdrawnTreatmentSquamous Non-Small Cell Lung Cancer1
2Active Not RecruitingOtherLung Cancer Non-Small Cell Cancer (NSCLC)1
2Active Not RecruitingPreventionColon Adenomas / Colon Carcinoma / Lynch Syndrome / MLH1 Gene Mutation / MSH2 Gene Mutation1
2Active Not RecruitingSupportive CareMultiple Myeloma (MM)1
2Active Not RecruitingTreatmentAcral lentiginous melanoma / Mucosal Melanoma1
2Active Not RecruitingTreatmentAcute myeloid leukaemia (in remission) / Adult Acute Myeloid Leukemia in Remission / Leukemia Acute Myeloid Leukemia (AML)1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Recurrent, IV-B Cervical cancer / Stage IV Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v71
2Active Not RecruitingTreatmentAdenocarcinoma of the Stomach / Gastroesophageal Cancer (GC)1
2Active Not RecruitingTreatmentAdenocarcinomas1
2Active Not RecruitingTreatmentAdvanced Cutaneous Squamous Cell Carcinoma1
2Active Not RecruitingTreatmentAdvanced Melanoma / Metastatic Melanoma / Metastatic Melanoma Stratified by MHC-II Expression1
2Active Not RecruitingTreatmentAdvanced Non Small Cell Lung Cancer2
2Active Not RecruitingTreatmentAdvanced Pancreatic Cancer1
2Active Not RecruitingTreatmentAdvanced Solid Tumors1
2Active Not RecruitingTreatmentAdvanced or Metastatic Melanoma1
2Active Not RecruitingTreatmentAnn Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Ann Arbor Stage III Hodgkin Lymphoma / Ann Arbor Stage IIIA Hodgkin Lymphoma / Ann Arbor Stage IIIB Hodgkin Lymphoma / Ann Arbor Stage IV Hodgkin Lymphoma / Ann Arbor Stage IVA Hodgkin Lymphoma / Ann Arbor Stage IVB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Classical Hodgkin's Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma / Stage III Hodgkin Lymphoma / Stage IIIA Hodgkin Lymphoma / Stage IIIB Hodgkin Lymphoma / Stage IV Hodgkin Lymphoma / Stage IVA Hodgkin Lymphoma / Stage IVB Hodgkin Lymphoma1
2Active Not RecruitingTreatmentBiliary Tract Cancer / Biliary Tract Neoplasms1
2Active Not RecruitingTreatmentBiliary Tract Neoplasms1
2Active Not RecruitingTreatmentBreast Cancer2
2Active Not RecruitingTreatmentBreast Cancer / Triple Negative Breast Neoplasms1
2Active Not RecruitingTreatmentCancer of the Stomach / Esophagogastric Junction / Malignant Neoplasm of Stomach1
2Active Not RecruitingTreatmentCancer, Advanced1
2Active Not RecruitingTreatmentCancer, Bladder / Melanoma1
2Active Not RecruitingTreatmentCarcinoma NOS / Hepatocellular / Hepatocellular,Carcinoma / Lung Cancers / Malignant Neoplasm of Stomach / Neoplasms, Colorectal1
2Active Not RecruitingTreatmentCarcinoma,Non-Small-Cell Lung / Large Cell Lung Carcinoma Metastatic / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Lung Adenocarcinoma / Metastatic Lung Cancer1
2Active Not RecruitingTreatmentChromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukemia (CLL) - Refractory / Chronic, recurrent Lymphocytic Leukemia / Loss of Chromosome 17p / Recurrent Small Lymphocytic Lymphoma / Refractory Small Lymphocytic Lymphoma / Richter's Syndrome1
2Active Not RecruitingTreatmentClassical Hodgkin's Lymphoma1
2Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
2Active Not RecruitingTreatmentColorectal Cancers1
2Active Not RecruitingTreatmentDocumented Stage III NSCLC, Amenable to Concomitant or Sequential Chemoradiotherapy / Locally Advanced Non-Small Cell Lung Cancer1
2Active Not RecruitingTreatmentEGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2Active Not RecruitingTreatmentExtensive Stage Lung Small Cell Carcinoma / Recurrent Lung Small Cell Carcinoma1
2Active Not RecruitingTreatmentGastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours1
2Active Not RecruitingTreatmentGastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Locally Advanced Bone Sarcoma / Locally Advanced Soft Tissue Sarcoma / Metastatic Bone Sarcomas / Metastatic Liposarcoma / Metastatic Soft Tissue Sarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Metastatic Unresectable Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Bone Sarcoma / Unresectable Liposarcoma / Unresectable Soft Tissue Sarcoma1
2Active Not RecruitingTreatmentGlioblastomas1
2Active Not RecruitingTreatmentHead and Neck Carcinoma2
2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Active Not RecruitingTreatmentHepatocellular,Carcinoma1
2Active Not RecruitingTreatmentHodgkins Disease (HD)1
2Active Not RecruitingTreatmentHuman Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS) / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic / Non Small Cell Lung Cancer Stage IIIB / Non-Small Cell Lung Cancer Stage IIIB1
2Active Not RecruitingTreatmentLeptomeningeal Carcinomatosis / Melanoma1
2Active Not RecruitingTreatmentLimited Stage Small Cell Lung Cancer / Small Cell Lung Cancer (SCLC)1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Non-Small Cell Carcinoma of Lung, TNM Stage 4 / Non-Small Cell Lung Cancer Recurrent / Non-Small-Cell Lung Cancer Metastatic / Recurrent Non Small Cell Lung Cancer1
2Active Not RecruitingTreatmentMicrosatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer1
2Active Not RecruitingTreatmentMajor Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma1
2Active Not RecruitingTreatmentMalignancies1
2Active Not RecruitingTreatmentMalignant Lymphomas2
2Active Not RecruitingTreatmentMalignant Melanoma of Skin / Melanoma (Skin)1
2Active Not RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2Active Not RecruitingTreatmentMelanoma4
2Active Not RecruitingTreatmentMelanoma, Malignant1
2Active Not RecruitingTreatmentMelanoma, Uveal1
2Active Not RecruitingTreatmentMelanoma / Melanoma Stage Iii1
2Active Not RecruitingTreatmentMelanoma / Melanoma, Uveal / Metastatic Uveal Melanoma / Stage IV Uveal Melanoma AJCC v71
2Active Not RecruitingTreatmentMelanoma / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentMesothelioma1
2Active Not RecruitingTreatmentMetastatic Cancer Colorectal1
2Active Not RecruitingTreatmentMetastatic Cancers / Recurrent Cancer / Salivary Gland Carcinoma1
2Active Not RecruitingTreatmentMetastatic Clear Cell Renal Cell Carcinoma1
2Active Not RecruitingTreatmentMetastatic Leiomyosarcoma / Unresectable Leiomyosarcoma / Uterine Corpus Leiomyosarcoma1
2Active Not RecruitingTreatmentMetastatic Lung Non-Squamous Non-Small Cell Carcinoma / Recurrent Lung Non-Squamous Non-Small Cell Carcinoma / Stage IV Lung Non-Small Cell Cancer AJCC v71
2Active Not RecruitingTreatmentMetastatic Melanoma2
2Active Not RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Unresectable Melanoma1
2Active Not RecruitingTreatmentMetastatic Renal Cell Carcinoma1
2Active Not RecruitingTreatmentMetastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)2
2Active Not RecruitingTreatmentMuscle Invasive Bladder Cancer1
2Active Not RecruitingTreatmentNon-Squamous Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage I Non-Small Cell Lung Cancer AJCC v7 / Stage IA Non-Small Cell Lung Carcinoma / Stage IA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v71
2Active Not RecruitingTreatmentPeripheral T Cell Lymphoma (PTCL) / Peripheral T-Cell Lymphoma (PTCL)1
2Active Not RecruitingTreatmentPlasma Cell Myeloma1
2Active Not RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2Active Not RecruitingTreatmentRecurrent and/or Metastatic Platinum-refractory SCCHN1
2Active Not RecruitingTreatmentRenal Cancers1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma3
2Active Not RecruitingTreatmentSarcomas1
2Active Not RecruitingTreatmentSquamous Cell Non-small Cell Lung Cancer1
2Active Not RecruitingTreatmentTumors, Solid1
2Active Not RecruitingTreatmentVarious Advanced Cancer2
2CompletedTreatmentAcute Adult T-Cell Leukemia/Lymphoma / Adult T-Cell Leukemia/Lymphoma / CD3 Positive / CD4-Positive Neoplastic Cells Present / Chronic Adult T-Cell Leukemia/Lymphoma / HTLV-1 Infection / Hypercalcemia / Lymphomatous Adult T-Cell Leukemia/Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Smoldering Adult T-Cell Leukemia/Lymphoma1
2CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
2CompletedTreatmentAdvanced Non Small Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
2CompletedTreatmentColon Cancer Stage II/III1
2CompletedTreatmentGlioblastoma Multiforme (GBM)1
2CompletedTreatmentHepatocellular,Carcinoma1
2CompletedTreatmentLung Cancers1
2CompletedTreatmentMalignant Pleural Mesothelioma (MPM)1
2CompletedTreatmentMelanoma2
2CompletedTreatmentNasopharyngeal Nonkeratinizing Carcinoma / Recurrent Nasopharyngeal Undifferentiated Carcinoma / Recurrent Nasopharynx Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Nasopharyngeal Undifferentiated Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Nasopharyngeal Undifferentiated Carcinoma / Stage IVA Nasopharyngeal Carcinoma / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma / Stage IVC Nasopharyngeal Carcinoma AJCC v71
2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentPreviously Treated Metastatic Adenocarcinoma of the Pancreas1
2CompletedTreatmentRefractory, metastatic Colorectal cancer1
2Enrolling by InvitationTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Cancer (SCLC)1
2Not Yet RecruitingTreatmentAdenocarcinoma Of Esophagus / Gastric Adenocarcinoma / Hepatocellular,Carcinoma / HNSCC / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Microsatellite Instability-High Solid Malignant Tumor / Renal Cell Adenocarcinoma / Urothelial Cancer1
2Not Yet RecruitingTreatmentAdvanced Non Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2Not Yet RecruitingTreatmentAdvanced Renal Cell Carcinoma1
2Not Yet RecruitingTreatmentAdvanced Solid Tumors / Gliomas / IDH1 Mutation1
2Not Yet RecruitingTreatmentBRAF NP_004324.2:p.V600M / BRAF V600E Mutation Present / Metastatic Thyroid Gland Carcinoma / Refractory Thyroid Gland Carcinoma / Stage IV Differentiated Thyroid Gland Carcinoma AJCC v8 / Stage IVA Differentiated Thyroid Gland Carcinoma AJCC v8 / Stage IVB Differentiated Thyroid Gland Carcinoma AJCC v81
2Not Yet RecruitingTreatmentCOVID19- Infection With SARS-CoV-2 Virus / Novel Coronavirus Infectious Disease (COVID-19)1
2Not Yet RecruitingTreatmentCancer of Unknown Primary Site1
2Not Yet RecruitingTreatmentCancer, Advanced / Soft Tissue Sarcoma Adult1
2Not Yet RecruitingTreatmentCarcinoma, Colorectal / Colorectal Cancer With Hepatic Metastases / Colorectal Tumors / Metastatic Colorectal Cancer (MCRC) / Neoplasms, Colorectal1
2Not Yet RecruitingTreatmentCarcinosarcoma of Ovary / Carcinosarcoma of Uterus / Carcinosarcoma of Vagina1
2Not Yet RecruitingTreatmentChondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentChronic Lymphocytic Leukemia (CLL) - Refractory / Chronic, recurrent Lymphocytic Leukemia / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Grade 3a Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Marginal Zone Lymphoma / Refractory Non-Hodgkin's lymphoma / Refractory Plasma Cell Myeloma1
2Not Yet RecruitingTreatmentCirculating Tumor DNA / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2Not Yet RecruitingTreatmentClinical Stage III Cutaneous Melanoma AJCC v8 / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Locally Advanced Cutaneous Melanoma / Metastatic Cutaneous Melanoma / Pathologic Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIA Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v8 / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Unresectable Cutaneous Melanoma1
2Not Yet RecruitingTreatmentColorectal Cancers1
2Not Yet RecruitingTreatmentHNSCC1
2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Not Yet RecruitingTreatmentHepatocellular Carcinoma (HCC)1
2Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
2Not Yet RecruitingTreatmentInoperable œsophageal Cancer1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
2Not Yet RecruitingTreatmentLung Cancers / Lung neoplasm malignant / Malignancies / Mesothelioma / Mesothelioma; Lung / Mesothelioma; Pleura / Mesotheliomas Pleural1
2Not Yet RecruitingTreatmentLymphoma, B-Cell1
2Not Yet RecruitingTreatmentLymphoma, Hodgkins1
2Not Yet RecruitingTreatmentMalignancies / Neoplasms / Tumors1
2Not Yet RecruitingTreatmentMalignant Neoplasm of Pancreas / Pancreatic Cancer Metastatic1
2Not Yet RecruitingTreatmentMalignant Pleural Mesothelioma (MPM) / Mesotheliomas Pleural1
2Not Yet RecruitingTreatmentMelanoma1
2Not Yet RecruitingTreatmentMelanoma Stage Iii / Melanoma Stage Iv1
2Not Yet RecruitingTreatmentMelanoma, Malignant1
2Not Yet RecruitingTreatmentMetastatic Cancers1
2Not Yet RecruitingTreatmentMetastatic Lung Non-Squamous Non-Small Cell Carcinoma / Recurrent Lung Non-Squamous Non-Small Cell Carcinoma / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Unresectable Lung Non-Squamous Non-Small Cell Carcinoma1
2Not Yet RecruitingTreatmentMetastatic Melanoma / Renal Cell Adenocarcinoma1
2Not Yet RecruitingTreatmentNasopharyngeal Carcinoma1
2Not Yet RecruitingTreatmentNeoplasms1
2Not Yet RecruitingTreatmentNovel Coronavirus Infectious Disease (COVID-19) / Viral Pneumonia1
2Not Yet RecruitingTreatmentRectal Carcinoma1
2Not Yet RecruitingTreatmentRecurrent Glioblastoma / Secondary Glioblastoma1
2Not Yet RecruitingTreatmentRecurrent Head and Neck Squamous Cell Carcinoma / Stage IV Head and Neck Cancer1
2Not Yet RecruitingTreatmentSkin angiosarcoma / Skin Radiation-Related Angiosarcoma / Visceral Angiosarcoma1
2Not Yet RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Oral Cavity1
2Not Yet RecruitingTreatmentStage IV Pancreatic Cancer1
2Not Yet RecruitingTreatmentVarious Advanced Cancer1
2RecruitingBasic ScienceRecurrent Adult Brain Tumor1
2RecruitingPreventionLeukoplakia Oral / Oral Leukoplakia1
2RecruitingTreatmentALK-Positive Large B-Cell Lymphoma / Atypical Burkitt/Burkitt-Like Lymphoma / Burkitt-Like Lymphoma With 11q Aberration / Diffuse Large B-Cell Lymphoma Activated B-Cell Type / Diffuse Large B-Cell Lymphoma Associated With Chronic Inflammation / Diffuse Large B-Cell Lymphoma Germinal Center B-Cell Type / Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Mucocutaneous Ulcer / High Grade B-Cell Lymphoma With MYC, BCL2, and BCL6 Rearrangements / High Grade B-Cell Lymphoma, Not Otherwise Specified / Human Herpesvirus 8-Positive Neoplastic Cells Present / Intravascular Large B-Cell Lymphoma / Large B-Cell Lymphoma With IRF4 Rearrangement / Plasmablastic Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma, Leg Type / Primary Diffuse Large B-Cell Lymphoma of the Central Nervous System / Primary Effusion Lymphomas / Recurrent B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classic Hodgkin Lymphoma / Recurrent B-Cell Non-Hodgkin Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Lymphomatoid Granulomatosis / Recurrent Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classic Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Small Intestinal High Grade B-Cell Lymphoma, Not Otherwise Specified / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma1
2RecruitingTreatmentAcinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Apocrine Neoplasm / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Basal Cell Carcinoma (BCC) / Bladder Adenocarcinoma / Carcinoma of Gallbladder / Carcinoma, Adenoid Cystic / Cervical Clear Cell Adenocarcinoma / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Desmoid-Type Fibromatosis / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Extramammary Paget Disease / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Gastric Undifferentiated Carcinoma / Gastrointestinal Stromal Tumors / Gestational Trophoblastic Disease / Giant Cell Carcinoma / Hemangiosarcoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Testicular Sex Cord-Stromal Tumor / Metaplastic breast carcinoma / Metastatic Malignant Neoplasm of Unknown Primary / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / PEComa / Peritoneal Mesotheliomas / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Rare Disorder / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Solid Neoplasms / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Somatic-type Malignancy / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Carcinoma1
2RecruitingTreatmentAcute Bilineal Leukemia / Acute Biphenotypic Leukemia (ABL) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute, recurrent Myeloid Leukemia / Chronic Myelomonocytic Leukemia / Leukemias / Myelodysplastic Syndrome / Refractory Acute Myelogenous Leukemia (AML) / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Therapy-Related Acute Myeloid Leukemia1
2RecruitingTreatmentAcute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Adult Acute Myeloid Leukemia in Remission / Blasts Under 10 Percent of Bone Marrow Nucleated Cells / Leukemia Acute Myeloid Leukemia (AML) / Leukemias / Therapy-Related Myeloid Neoplasm1
2RecruitingTreatmentAdenocarcinoma of the Pancreas1
2RecruitingTreatmentAdenocarcinoma of the Stomach / Esophageal Cancers / Gastroesophageal Cancer (GC) / HER2 Positive Gastric Cancer / Malignant Neoplasm of Stomach / Metastatic Gastric Cancers1
2RecruitingTreatmentAdenocarcinoma, Prostate / Hormone Sensitive Prostate Cancer / Metastasis Prostate Adenocarcinoma1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2RecruitingTreatmentAdrenocortical Carcinoma / Genitourinary Cancers / High Grade Neuroendocrine Carcinoma/Small Cell Carcinoma / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell1
2RecruitingTreatmentAdult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Anaplastic Large-Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / CD30-Positive Neoplastic Cells Present / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Post Transplant Lymphoproliferative Disorder / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Hodgkin Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Non-Hodgkin Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Refractory Hodgkin Lymphoma / Refractory Non-Hodgkin's lymphoma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)1
2RecruitingTreatmentAdvanced Biliary Tract Cancer1
2RecruitingTreatmentAdvanced Gastric Cancer1
2RecruitingTreatmentAdvanced Hepatocellular Carcinoma1
2RecruitingTreatmentAdvanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Esophageal Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Uterine Neoplasm / Melanoma / Ovarian Carcinoma / Plasma Cell Myeloma / Prostate Cancer / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Thyroid Gland Carcinoma / Uterine Corpus Cancer1
2RecruitingTreatmentAdvanced Melanoma / Melanoma of Unknown Primary / Mucosal Melanoma / Refractory Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma / Unresectable Melanoma1
2RecruitingTreatmentAdvanced Metastatic Cancer1
2RecruitingTreatmentAdvanced Renal Cell Carcinoma1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)2
2RecruitingTreatmentAdvanced Stage Non-small Cell Lung Cancer1
2RecruitingTreatmentAdvanced or Metastatic Hematological or Solid Tumor / Novel Coronavirus Infectious Disease (COVID-19) / SARS-CoV-2 (COVID-19) Infection1
2RecruitingTreatmentAdvanced or Metastatic Non-clear Cell Renal Cell Carcinoma / Chromophobe Renal Cell Carcinoma / Collecting Duct Renal Cell Carcinoma / Fumarate Hydratase Deficient Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Succinate Dehydrogenase Deficient Renal Cell Carcinoma / Unclassified Renal Cell Carcinoma1
2RecruitingTreatmentAggressive Non-Hodgkin Lymphoma / Ann Arbor Stage I Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Ann Arbor Stage II B-Cell Non-Hodgkin Lymphoma / Ann Arbor Stage II Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Ann Arbor Stage III B-Cell Non-Hodgkin Lymphoma / Ann Arbor Stage III Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Ann Arbor Stage IV B-Cell Non-Hodgkin Lymphoma / Ann Arbor Stage IV Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / High Grade B-Cell Lymphoma With MYC and BCL2 and/or BCL6 Rearrangements / High Grade B-Cell Lymphoma, Not Otherwise Specified / Indolent Non-Hodgkin's Lymphomas / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Mediastinal B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classic Hodgkin Lymphoma / Transformed Non-Hodgkin Lymphoma1
2RecruitingTreatmentAnal Basaloid Carcinoma / Anal Canal Cloacogenic Carcinoma / Anal Margin Squamous Cell Carcinoma / Stage IIB Anal Cancer AJCC v8 / Stage IIIA Anal Cancer AJCC v8 / Stage IIIB Anal Cancer AJCC v8 / Stage IIIC Anal Cancer AJCC v81
2RecruitingTreatmentAnal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Stage IV Anal Canal Cancer AJCC v6 and v71
2RecruitingTreatmentAnn Arbor Stage I Hodgkin Lymphoma / Ann Arbor Stage I Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage I Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage I Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IA Hodgkin Lymphoma / Ann Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage II Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage II Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage II Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Lymphocyte-Rich Classic Hodgkin Lymphoma1
2RecruitingTreatmentAnn Arbor Stage I Hodgkin Lymphoma / Ann Arbor Stage IA Hodgkin Lymphoma / Ann Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Stage I Hodgkin Lymphoma / Stage IA Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma1
2RecruitingTreatmentAppendiceal Tumor / Colorectal Tumors / Mucinous Neoplasm1
2RecruitingTreatmentAtypical/Malignant Meningioma / Choroid Plexus Tumors / Ependymomas / Medulloblastomas / Pineal RegionTumors1
2RecruitingTreatmentBCL-2 Translocation / High-grade B-cell Lymphoma / Lymphoma, B-Cell / MYC Translocation / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentBRAF Gene Mutation / BRAF wt Allele / Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
2RecruitingTreatmentBRAF V600 mutation / Melanoma Metastatic1
2RecruitingTreatmentBasal Cell Carcinoma (BCC)1
2RecruitingTreatmentBiliary Tract Cancer2
2RecruitingTreatmentBladder Adenocarcinoma / Bladder Mixed Adenocarcinoma / Bladder Small Cell Carcinoma / Bladder Squamous Cell Carcinoma / Chromophobe Renal Cell Carcinoma / Infiltrating Bladder Lymphoepithelioma-Like Carcinoma / Infiltrating Bladder Urothelial Carcinoma / Infiltrating Bladder Urothelial Carcinoma With Giant Cells / Infiltrating Bladder Urothelial Carcinoma, Nested Variant / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Kidney Medullary Carcinoma / Large Cell Neuroendocrine Carcinoma / Metastatic Bladder carcinoma / Metastatic Bladder Large Cell Neuroendocrine Carcinoma / Metastatic Bladder Small Cell Carcinoma / Metastatic Bladder Squamous Cell Carcinoma / Metastatic Infiltrating Bladder Urothelial Carcinoma, Clear Cell Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Lipid-Rich Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Micropapillary Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Metastatic Kidney Medullary Carcinoma / Metastatic Malignant Genitourinary System Neoplasm / Metastatic Penile Carcinoma / Metastatic Prostate Small Cell Carcinoma / Metastatic Sarcomatoid Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Sarcomatoid Renal Cell Carcinoma / Stage IV Bladder Cancer AJCC v8 / Stage IV Penile Cancer AJCC v8 / Stage IV Prostate Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Stage IVA Bladder Cancer AJCC v8 / Stage IVA Prostate Cancer AJCC v8 / Stage IVB Bladder Cancer AJCC v8 / Stage IVB Prostate Cancer AJCC v8 / Testicular Leydig Cell Tumor / Testicular Sertoli Cell Tumor1
2RecruitingTreatmentBladder Tumors / Cancer, Bladder / Neoplasms, Bladder1
2RecruitingTreatmentBladder transitional cell carcinoma / Endometrioid Adenocarcinoma / Fallopian Tube Cancer / High Grade Serous Carcinoma / Metastatic Transitional Cell Cancer of the Renal Pelvis and Ureter / Ovarian Epithelial Cancer / Primary Peritoneal Carcinoma / Transitional Cell Carcinoma / Urothelial Carcinoma Bladder Recurrent / Urothelial Carcinoma of the Renal Pelvis and Ureter / Urothelial Carcinoma Ureter / Urothelial Carcinoma Ureter Local / Urothelial carcinoma ureter metastatic / Urothelial Carcinoma Ureter Regional1
2RecruitingTreatmentBladder transitional cell carcinoma / Transitional Cell Carcinoma / Urothelial Carcinoma of the Renal Pelvis and Ureter / Urothelial Carcinoma Ureter / Urothelial Carcinoma Urethra1
2RecruitingTreatmentBone Metastases / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2RecruitingTreatmentBrain Metastases, Adult / Clear-cell Metastatic Renal Cell Carcinoma / Melanoma / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic / Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentBreast Cancer6
2RecruitingTreatmentBreast Cancer / Breast Neoplasm Female / Carcinoma, Breast / Tumors, Breast1
2RecruitingTreatmentBreast Cancer / Hormone Receptor Positive Tumor / Luminal B / Metastatic Breast Cancer1
2RecruitingTreatmentBreast Cancer / Malignancies1
2RecruitingTreatmentBronchial dysplasia / History of Head and Neck Cancer / History of Non-Small Cell Lung Cancer / Tobacco Smoking Behavior1
2RecruitingTreatmentCD (Cluster of Differentiation) 30-Positive Neoplastic Cells Present / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / TNFRSF8 Positive1
2RecruitingTreatmentCDKN2A-p16 Positive / Clinical Stage I HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Clinical Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Human Papillomavirus DNA / Human Papillomavirus mRNA / Human Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Oropharyngeal Basaloid Carcinoma / Pathologic Stage I HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Pathologic Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Posterior Tongue Squamous Cell Carcinoma / Soft Palate Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Tonsillar Squamous Cell Carcinoma1
2RecruitingTreatmentCancer With POLE Exonucleasic Domain Mutation / Microsatellite Instability / Neoplasms, Head and Neck / Penile Neoplasms / Renal Cell Adenocarcinoma / Skin Neoplasms1
2RecruitingTreatmentCancer, Advanced1
2RecruitingTreatmentCancer, Advanced / Cancer, Bladder / Transitional Cell Carcinoma / Tumors, Solid1
2RecruitingTreatmentCancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma1
2RecruitingTreatmentCancer, Bladder4
2RecruitingTreatmentCancer, Bladder / Head/Neck Cancers / Lung Cancers / Melanoma Cancers / Metastatic Cancers / Renal Cancers1
2RecruitingTreatmentCancer, Bladder / Transitional Cell Carcinoma1
2RecruitingTreatmentCarcinoid Tumor of GI System / Carcinoid Tumors / Neuroendocrine Tumors1
2RecruitingTreatmentCarcinoid Tumors / Neuroendocrine Tumors1
2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Oropharynx Squamous Cell Carcinoma1
2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck1
2RecruitingTreatmentCarcinosarcoma / Clear Cell Carcinoma / Endometrial Carcinoma / High Grade Endometrial Stromal Sarcoma / Leiomyosarcomas / Undifferentiated sarcoma / Uterine Malignancies1
2RecruitingTreatmentCastration-Resistant Prostate Cancer (CRPC) / Metastatic Hormone Refractory Prostate Cancer / Prostate Cancer1
2RecruitingTreatmentCentral Nervous System B-Cell Non-Hodgkin Lymphoma / Recurrent Central Nervous System Lymphoma / Refractory Central Nervous System Lymphoma1
2RecruitingTreatmentCervical Cancers1
2RecruitingTreatmentCervical Cancers / Colorectal Cancers / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular,Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Melanoma / Microsatellite Instability / Mismatch Repair Deficiency / Neuroendocrine Carcinoma of the Skin / Renal Cell Adenocarcinoma / Small Cell Lung Cancer (SCLC) / Transitional Cell Carcinoma1
2RecruitingTreatmentCholangiocarcinomas / Malignant Neoplasm of Pancreas / Pancreatic Cancer Metastatic / Previously Treated Unresectable or Metastatic Cholangiocarcinoma and Pancreactic Cancer / Previously Treated Unresectable or Metastatic Cholangiocarcinoma and Pancreatic Cancer1
2RecruitingTreatmentChordomas / Locally Advanced Chordoma / Metastatic Chordoma / Unresectable Chordoma1
2RecruitingTreatmentClassic Hodgkin Lymphoma / Classical Hodgkin's Lymphoma / Hematopoietic Cell Transplant Recipient / Hematopoietic Cell Transplantation Recipient / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
2RecruitingTreatmentClassic Kaposi Sarcoma1
2RecruitingTreatmentClassical Hodgkin's Lymphoma1
2RecruitingTreatmentClear Cell Adenocarcinoma / Extra Renal Origin / Fallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Carcinoma1
2RecruitingTreatmentClear Cell Metastatic Renal Cell Carcinoma1
2RecruitingTreatmentClear Cell Renal Cell Carcinoma1
2RecruitingTreatmentCoexisting Medical Conditions / Lymphoma, Hodgkins1
2RecruitingTreatmentColon Carcinoma1
2RecruitingTreatmentColorectal Adenocarcinoma / Metastatic Colorectal Cancer (MCRC) / Metastatic Microsatellite Stable Colorectal Carcinoma / Refractory Colorectal Carcinoma / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer / Stage IVC Colorectal Cancer1
2RecruitingTreatmentColorectal Adenocarcinoma / Microsatellite Stable (MSS) Colorectal Adenocarcinomas1
2RecruitingTreatmentColorectal Cancers1
2RecruitingTreatmentColorectal neoplasms malignant / Metastatic Colorectal Cancer (MCRC)1
2RecruitingTreatmentCutaneous Melanoma, Stage III / Cutaneous Melanoma, Stage IV / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Unresectable Melanoma1
2RecruitingTreatmentCutaneous Melanoma / Malignant Melanoma of Skin / Melanoma / Melanoma (Skin) / Melanoma Stage Iii / Melanoma Stage Iv1
2RecruitingTreatmentCutaneous Melanoma / Melanoma / Mucosal Melanoma / Ocular Melanoma / Oligometastatic Melanoma / Stage III Acral Lentiginous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Uveal Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Uveal Melanoma AJCC v7 / Stage IV Acral Lentiginous Melanoma AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma AJCC v71
2RecruitingTreatmentDifferentiated Thyroid Gland Carcinoma / Follicular Variant Thyroid Gland Papillary Carcinoma / Poorly Differentiated Thyroid Gland Carcinoma / Refractory Differentiated Thyroid Gland Carcinoma / Refractory Thyroid Gland Carcinoma / Tall Cell Variant Thyroid Gland Papillary Carcinoma / Thyroid Gland Follicular Carcinoma / Thyroid Gland Hurthle Cell Carcinoma / Thyroid Gland Papillary Carcinoma1
2RecruitingTreatmentDisorders, Lymphoproliferative / Epstein-Barr Virus Infections / Malignant Lymphomas1
2RecruitingTreatmentDocetaxel / Lung Cancer Non-Small Cell Cancer (NSCLC) / Nivolumab1
2RecruitingTreatmentEffects of Combination Chemotherapy and Immunotherapy / Sarcomas1
2RecruitingTreatmentEndometrial Adenocarcinomas / Endometrial Carcinosarcoma1
2RecruitingTreatmentEsophageal Cancers / Gastroesophageal Cancer (GC) / Malignant Neoplasm of Esophagus / Metastatic Esophageal Cancer / Metastatic Oesophageal Cancer / Oesophageal Cancer Nos1
2RecruitingTreatmentEsophageal Squamous Cell Carcinoma (ESCC)2
2RecruitingTreatmentEye and Orbit1
2RecruitingTreatmentFallopian Tube Cancer / Malignant Peritoneal Neoplasm / Ovarian Cancer1
2RecruitingTreatmentGBM / MGMT-unmethylated Glioblastoma (GBM)1
2RecruitingTreatmentGastric and Esophagogastric Junction Adenocarcinoma1
2RecruitingTreatmentGastroenteropancreatic Neuroendocrine Tumors / Neuroendocrine Neoplasms / Neuroendocrine Tumors1
2RecruitingTreatmentGastroesophageal Adenocarcinoma1
2RecruitingTreatmentGastrointestinal Stromal Tumors1
2RecruitingTreatmentGlioblastoma Multiforme (GBM)1
2RecruitingTreatmentGlioblastomas1
2RecruitingTreatmentGlioblastomas / Gliomas / Gliomas, Malignant / High Grage Glioma / Low Grade Glioma (LGG)1
2RecruitingTreatmentGliomas1
2RecruitingTreatmentGrade I Neuroendocrine Carcinoma / Grade II Neuroendocrine Carcinoma / Grade III Neuroendocrine Carcinoma / Large Cell Neuroendocrine Carcinoma / Lung carcinoma cell type unspecified stage IV / Metastatic Neuroendocrine Carcinoma / Metastatic Small Cell Lung Cancer / Neuroendocrine Carcinomas / Neuroendocrine Tumors / Recurrent Small Cell Lung Carcinoma / Refractory Small Cell Lung Carcinoma / Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentHNSCC / HPV-Related Squamous Cell Carcinoma1
2RecruitingTreatmentHNSCC / HPV-Related Squamous Cell Carcinoma / Human Papilloma Virus (HPV) / Squamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentHaematological Malignancies1
2RecruitingTreatmentHead and Neck Carcinoma2
2RecruitingTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / Metastatic Squamous Cell Carcinoma of the Head and Neck1
2RecruitingTreatmentHead and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma1
2RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentHepatic Carcinoma / Hepatocellular Cancer / Hepatocellular,Carcinoma1
2RecruitingTreatmentHepatocellular,Carcinoma2
2RecruitingTreatmentHepatocellular,Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2RecruitingTreatmentHepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs / Resectable Hepatocellular Carcinoma1
2RecruitingTreatmentHeptocellular Cancer / Heptocellular Carcinoma / Liver Metastasis / Metastatic Colorectal Cancer (MCRC) / Pancreatic Cancer Metastatic1
2RecruitingTreatmentHodgkins Disease (HD)1
2RecruitingTreatmentHodgkins Disease (HD) / Peripheral T Cell Lymphoma (PTCL) / Peripheral T-Cell Lymphoma (PTCL)1
2RecruitingTreatmentKidney Cancer Metastatic / Kidney Cancer Stage Iv / Kidney Cancer, Stage IV / Renal Cancers1
2RecruitingTreatmentKidney Medullary Carcinoma / Loss of INI 1 Protein Expression / Stage III Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v81
2RecruitingTreatmentLarynx / LIP / Oral Cavity Squamous Cell Carcinoma / Pharynx / Squamous Cell Carcinoma (SCC)1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes1
2RecruitingTreatmentLeukemias / Myelodysplastic Syndrome / Recurrent Myelodysplastic Syndrome1
2RecruitingTreatmentLiposarcomas, Dedifferentiated / Recurrent Dedifferentiated Liposarcoma / Recurrent Undifferentiated Pleomorphic Sarcoma / Resectable Dedifferentiated Liposarcoma / Resectable Undifferentiated Pleomorphic Sarcoma / Systemic Connective Tissue Disorders / Undifferentiated Pleomorphic Sarcoma1
2RecruitingTreatmentLocalized Oesogastric Adenocarcimona / MSI and or dMMR1
2RecruitingTreatmentLocally Advanced Cancer / Metastatic Cancers / Pancreatic Ductal Adenocarcinoma1
2RecruitingTreatmentLocally Advanced Head and Neck Carcinoma / Recurrent Head and Neck Carcinoma1
2RecruitingTreatmentLung Atypical Carcinoid Tumor / Lung Neuroendocrine Neoplasm / Lung Non-Small Cell Squamous Carcinoma / Minimally Invasive Lung Adenocarcinoma / Neuroendocrine Carcinomas / Recurrent Lung Adenocarcinoma / Recurrent Lung Large Cell Carcinoma / Recurrent Lung Non-Small Cell Carcinoma / Stage I Lung Cancer AJCC v8 / Stage IA1 Lung Cancer AJCC v8 / Stage IA2 Lung Cancer AJCC v8 / Stage IA3 Lung Cancer AJCC v8 / Stage IB Lung Cancer AJCC v8 / Stage IIA Lung Cancer AJCC v81
2RecruitingTreatmentLung Cancer Metastatic / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)11
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-squamous Cell Lung Cancer / Squamous Cell Carcinoma of Lung1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Stage I Non-Small Cell Lung Cancer AJCC v7 / Stage IA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer AJCC v71
2RecruitingTreatmentLung Cancers / Relapsed Small cell lung cancer / Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentLung Squamous Cell Carcinoma Stage IV / Metastatic Uveal Melanoma / Nonsquamous Nonsmall Cell Neoplasm of Lung1
2RecruitingTreatmentLymph Node Cancer / Melanoma1
2RecruitingTreatmentLymphoma, Hodgkins3
2RecruitingTreatmentMalignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer1
2RecruitingTreatmentMSI-H Tumors / Refractory MSI - H Solid Tumors Prior of PD-(L) 1 Therapy1
2RecruitingTreatmentMetastatic Colorectal Cancer (MCRC) / MSS1
2RecruitingTreatmentMalignancies1
2RecruitingTreatmentMalignancies / Neoplasms / Tumors1
2RecruitingTreatmentMalignant Lymphomas / Metastatic Bladder Cancer / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Metastatic Renal Cell Cancer / Recurrent Bladder Carcinoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Renal Cell Carcinoma Recurrent / Stage III Bladder Cancer / Stage III Lymphoma / Stage III Non-Small Cell Lung Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Lymphoma / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Bladder Cancer / Stage IVB Bladder Cancer / Stages III Skin Melanoma / Unresectable Head and Neck Squamous Cell Carcinoma / Unresectable Solid Neoplasm1
2RecruitingTreatmentMalignant Melanoma Stage III1
2RecruitingTreatmentMalignant Neoplasm of Colon1
2RecruitingTreatmentMalignant Neoplasm of Pancreas5
2RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2RecruitingTreatmentMelanoma8
2RecruitingTreatmentMelanoma Stage Iv1
2RecruitingTreatmentMelanoma Stage Iv / Renal Cell Carcinoma, Metastatic1
2RecruitingTreatmentMelanoma With Brain Metastasis1
2RecruitingTreatmentMelanoma, Malignant1
2RecruitingTreatmentMelanoma / Ocular Melanoma1
2RecruitingTreatmentMeningiomas1
2RecruitingTreatmentMesothelioma malignant / Mesothelioma, Malignant1
2RecruitingTreatmentMetastatic Adult Soft Tissue Sarcoma1
2RecruitingTreatmentMetastatic Biliary Tract Cancer / Pancreatic Cancer Metastatic1
2RecruitingTreatmentMetastatic Breast Cancer1
2RecruitingTreatmentMetastatic Cancers / Metastatic Castration Resistant Prostate Cancer1
2RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)4
2RecruitingTreatmentMetastatic Large Cell Neuroendocrine Carcinoma / Metastatic Neuroendocrine Carcinoma / Metastatic Neuroendocrine Neoplasm / Metastatic Small Cell Carcinoma1
2RecruitingTreatmentMetastatic Melanoma3
2RecruitingTreatmentMetastatic Melanoma / Tumors Metastatic to Brain1
2RecruitingTreatmentMetastatic Prostatic Adenocarcinoma1
2RecruitingTreatmentMetastatic Renal Cancer1
2RecruitingTreatmentMetastatic Renal Cell Carcinoma4
2RecruitingTreatmentMetastatic Renal Cell Carcinoma / Renal Cell Carcinoma Associated With Xp11.2 Translocations/TFE3 Gene Fusions / Stage III Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Unresectable Renal Cell Carcinoma1
2RecruitingTreatmentMetastatic Urothelial Cancer1
2RecruitingTreatmentMetastatic or Unresectable Melanoma1
2RecruitingTreatmentMucosal Melanoma1
2RecruitingTreatmentMultiple Myeloma (MM)1
2RecruitingTreatmentNSCLC Stage II / NSCLC, Stage I / NSCLC, Stage IIIA1
2RecruitingTreatmentName Human Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Stage II Oropharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Oral Cavity Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Laryngeal Squamous Cell Carcinoma / Stage IV Oral Cavity Squamous Cell Carcinoma / Stage IV Oropharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Oral Cavity Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Oral Cavity Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVC Hypopharyngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Oral Cavity Squamous Cell Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma1
2RecruitingTreatmentNasopharyngeal Carcinoma2
2RecruitingTreatmentNeoplasms Metastasis / Urinary Bladder Neoplasms1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Skin Cancers1
2RecruitingTreatmentNeuroendocrine Carcinomas1
2RecruitingTreatmentNon-Small Lung Cancer, Epigenetic Therapy1
2RecruitingTreatmentNon-small Cell Lung Cancer Stage I1
2RecruitingTreatmentOral Cavity SCC1
2RecruitingTreatmentOropharynx Cancers1
2RecruitingTreatmentPan Tumor1
2RecruitingTreatmentPancreatic Cancer Metastatic1
2RecruitingTreatmentPituitary / Pituitary Cancer / Pituitary Carcinoma / Pituitary Neoplasms1
2RecruitingTreatmentPleural mesothelioma malignant1
2RecruitingTreatmentProgress Free Survival (PFS) and Overall Survival (OS)1
2RecruitingTreatmentProstate Cancer5
2RecruitingTreatmentProstate Cancer / Recurrent Prostate Cancer1
2RecruitingTreatmentProstate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma1
2RecruitingTreatmentRectal Carcinoma1
2RecruitingTreatmentRecurrent Diffuse Large B-Cell Lymphoma / Recurrent Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma1
2RecruitingTreatmentRecurrent Glioblastoma1
2RecruitingTreatmentRecurrent Head and Neck Cancer1
2RecruitingTreatmentRecurrent Head and Neck Squamous Cell Carcinoma1
2RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentRefractory Multiple Myeloma / Relapsed Multiple Myeloma1
2RecruitingTreatmentRelapsing/Refractory ALK+ Anaplastic Large Cell Lymphoma1
2RecruitingTreatmentRenal Cancers / Renal Cell Adenocarcinoma1
2RecruitingTreatmentRenal Cell Adenocarcinoma4
2RecruitingTreatmentRenal Cell Carcinoma, Metastatic1
2RecruitingTreatmentResectable Biliary Tract Cancer1
2RecruitingTreatmentSCCHN1
2RecruitingTreatmentSalivary Gland Cancers1
2RecruitingTreatmentSmall Cell Lung Cancer (SCLC)1
2RecruitingTreatmentSmall Cell Lung Cancer (SCLC) / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
2RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2RecruitingTreatmentSquamous Cell Carcinoma of Lung / Squamous-Cell Lung Cancer1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
2RecruitingTreatmentSquamous Cell Carcinoma of the Skin1
2RecruitingTreatmentStage II Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage IV Bladder Urothelial Carcinoma AJCC v71
2RecruitingTreatmentStage III Hepatocellular Carcinoma AJCC v8 / Stage IIIA Hepatocellular Carcinoma AJCC v8 / Stage IIIB Hepatocellular Carcinoma AJCC v7 / Stage IIIC Hepatocellular Carcinoma AJCC v7 / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v81
2RecruitingTreatmentStage III Non-small-Cell Lung Cancer1
2RecruitingTreatmentStage IV Melanoma / Unresectable Stage III Melanoma1
2RecruitingTreatmentThymic Carcinoma / Thymoma Type B3 / Type B3 Thymoma and Thymic Carcinoma1
2RecruitingTreatmentThyroid Cancers1
2RecruitingTreatmentTransitional Cell Carcinoma1
2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentTumors, Solid1
2RecruitingTreatmentUntreated Metastatic Pancreatic Ductal Adenocarcinoma1
2RecruitingTreatmentUrinary Bladder Cancer1
2SuspendedTreatmentAdnexal Carcinoma / Apocrine Carcinoma / Carcinoma, Adenoid Cystic / Extraocular Cutaneous Sebaceous Carcinoma / Hidradenocarcinoma / Keratoacanthoma / Malignant sweat gland neoplasm / Microcystic Adnexal Carcinoma / Neuroendocrine Carcinoma of the Skin / NK-Cell Lymphoma, Unclassifiable / Paget’s Disease / Papillary Adenocarcinoma / Porocarcinoma / Primary Cutaneous Mucinous Carcinoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Refractory T-Cell Non-Hodgkin Lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Sezary Syndrome / Signet Ring Cell Carcinoma / Signet-ring cell carcinoma / Skin Basal Cell Carcinoma / Skin Basosquamous Cell Carcinoma / Skin Squamous Cell Carcinoma / Spiradenocarcinoma / Squamous Cell Carcinoma of Unknown Primary / Stage III Skin Cancer / Stage IV Skin Cancer / Sweat Gland Carcinoma / Trichilemmal Carcinoma / Vulvar Squamous Cell Carcinoma1
2SuspendedTreatmentAdvanced Endometrial Carcinoma / Metastatic Endometrial carcinoma / Recurrent Endometrial Carcinoma / Stage III Uterine Corpus Cancer AJCC v7 / Stage IIIA Uterine Corpus Cancer AJCC v7 / Stage IIIB Uterine Corpus Cancer AJCC v7 / Stage IIIC Uterine Corpus Cancer AJCC v7 / Stage IIIC1 Uterine Corpus Cancer AJCC v7 / Stage IIIC2 Uterine Corpus Cancer AJCC v7 / Stage IV Uterine Corpus Cancer AJCC v7 / Stage IVA Uterine Corpus Cancer AJCC v7 / Stage IVB Uterine Corpus Cancer AJCC v71
2SuspendedTreatmentAdvanced Lung Non-Small Cell Carcinoma / Advanced Melanoma / Metastatic Kidney Carcinoma / Metastatic Renal Cell Cancer / Recurrent Lung Carcinoma / Recurrent Lung Non-Small Cell Carcinoma / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage III Cutaneous Melanoma AJCC v7 / Stage III Renal Cell Cancer AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Lung Non-Small Cell Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Skin Melanoma1
2SuspendedTreatmentHepatocellular,Carcinoma1
2SuspendedTreatmentHigher Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML)1
2SuspendedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2SuspendedTreatmentLymphoma, Hodgkins1
2SuspendedTreatmentOropharynx Squamous Cell Carcinoma1
2SuspendedTreatmentPancreatic Cancer Stage IV1
2SuspendedTreatmentProstate Cancer1
2SuspendedTreatmentSmall Cell Lung Cancer (SCLC)1
2SuspendedTreatmentSmoldering Multiple Myeloma (SMM)1
2TerminatedDiagnosticBrain Metastasis / Melanoma1
2TerminatedTreatmentAdenocarcinoma of the Lung / Lung Cancers / Non-Squamous Non-Small Cell Lung Cancer (NSCLC) / Squamous Cell Carcinoma of Lung1
2TerminatedTreatmentBlastic Plasmacytoid Dendritic Cell Neoplasm (BPDCN) / Hepatosplenic T-Cell Lymphoma / HTLV-1 Infection / NK-Cell Lymphoma, Unclassifiable / Primary Systemic Anaplastic Large Cell Lymphoma, ALK-Negative / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Angioimmunoblastic T-cell Lymphoma / Recurrent Enteropathy-Associated T-Cell Lymphoma / Recurrent Mycosis Fungoides / Refractory Adult T-Cell Leukemia/Lymphoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Angioimmunoblastic T-cell Lymphoma / Refractory Enteropathy-Associated T-Cell Lymphoma / Refractory Nasal Type Extranodal NK/T-Cell Lymphoma / Refractory Peripheral T-Cell Lymphoma, Not Otherwise Specified / Refractory, advanced Mycosis fungoides1
2TerminatedTreatmentHER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma1
2TerminatedTreatmentHepatomegaly / Myelofibrosis Transformation in Essential Thrombocythemia / Myeloproliferative Disorders / Polycythemia Vera, Post-Polycythemic Myelofibrosis Phase / Primary Myelofibrosis / Splenomegaly1
2TerminatedTreatmentLeukemia Acute Myeloid Leukemia (AML)1
2TerminatedTreatmentLeukemias1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Metastatic Lung Cancer1
2TerminatedTreatmentMalignant Neoplasm of Female Breast / Malignant Neoplasm of Stomach / Ovarian Cancer1
2TerminatedTreatmentMelanoma1
2TerminatedTreatmentMetastatic Carcinoma in the Adrenal Cortex / Recurrent Adrenal Cortex Carcinoma / Stage III Adrenal Cortex Carcinoma / Stage IV Adrenal Cortex Carcinoma1
2TerminatedTreatmentNon Small Cell Lung Cancer Stage IIIB / Non-Small Cell Lung Cancer Stage IIIB1
2TerminatedTreatmentRecurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
2TerminatedTreatmentSolid Tumors Induced by Prior Radiation Exposure1
2WithdrawnTreatmentAdvanced Non Small Cell Lung Cancer / Metastatic Non-Small Cell Lung Cancer / Neoplasms, Lung1
2WithdrawnTreatmentBasal Cell Nevus Syndrome1
2WithdrawnTreatmentCancer of the Stomach / Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2WithdrawnTreatmentCervical Carcinoma / Esophageal Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma1
2WithdrawnTreatmentCervix Uteri--Diseases1
2WithdrawnTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
2WithdrawnTreatmentColorectal Cancers1
2WithdrawnTreatmentGerm Cell Tumors1
2WithdrawnTreatmentGiant Cell Glioblastoma / Gliosarcoma / Oligodendrogliomas / Recurrent Glioblastoma / Small Cell Glioblastoma1
2WithdrawnTreatmentLung Cancer, Nonsmall Cell, Stage I1
2WithdrawnTreatmentMelanoma1
2WithdrawnTreatmentMelanoma Stage Iii / Melanoma Stage Iv1
2WithdrawnTreatmentMelanoma / Metastatic Melanoma1
2WithdrawnTreatmentMultiple Myeloma (MM)1
2WithdrawnTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer2
2WithdrawnTreatmentRenal Cell Adenocarcinoma1
2, 3Active Not RecruitingTreatmentColorectal Cancers1
2, 3Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
2, 3Active Not RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v71
2, 3Not Yet RecruitingTreatmentGliosarcoma / MGMT-unmethylated Glioblastoma1
2, 3RecruitingTreatmentAdenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Clinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IVA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IVA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v81
2, 3RecruitingTreatmentBasaloid Squamous Cell Carcinoma / Clinical Stage I HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Clinical Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Oropharyngeal Squamous Cell Carcinoma / Papillary Squamous Cell Carcinoma / Pathologic Stage I HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Pathologic Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v81
2, 3RecruitingTreatmentClinical Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Clinical Stage III HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Pathologic Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Pathologic Stage III HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v81
2, 3RecruitingTreatmentHepatocellular,Carcinoma1
2, 3RecruitingTreatmentMelanoma1
2, 3RecruitingTreatmentMetastatic Hormone-sensitive Prostate Cancer1
2, 3RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
2, 3SuspendedTreatmentLeukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Myelodysplastic Syndrome With Excess Blasts-21
2, 3SuspendedTreatmentMetastatic Cutaneous Melanoma / Recurrent Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma1
2, 3WithdrawnTreatmentHepatocellular,Carcinoma1
3Active Not RecruitingTreatmentAdvanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
3Active Not RecruitingTreatmentAdvanced or Metastatic (Medically or Surgically Unresectable) Clear-cell Renal Cell Carcinoma1
3Active Not RecruitingTreatmentBrain Cancer1
3Active Not RecruitingTreatmentCancer, Advanced1
3Active Not RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
3Active Not RecruitingTreatmentHead and Neck Carcinoma1
3Active Not RecruitingTreatmentHepatocellular,Carcinoma1
3Active Not RecruitingTreatmentHodgkins Disease (HD)1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)5
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
3Active Not RecruitingTreatmentLung Cancers3
3Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
3Active Not RecruitingTreatmentMelanoma5
3Active Not RecruitingTreatmentMelanoma / Skin Cancers1
3Active Not RecruitingTreatmentMesothelioma2
3Active Not RecruitingTreatmentMultiple Myeloma (MM)1
3Active Not RecruitingTreatmentNeoplasms, Brain1
3Active Not RecruitingTreatmentNon-Squamous Cell Non-small Cell Lung Cancer1
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v71
3Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
3Active Not RecruitingTreatmentSquamous Cell Non-small Cell Lung Cancer1
3Active Not RecruitingTreatmentStage IB Lung Non-Small Cell Carcinoma AJCC v7 / Stage II Lung Non-Small Cell Cancer AJCC v7 / Stage IIA Lung Non-Small Cell Carcinoma AJCC v7 / Stage IIB Lung Non-Small Cell Carcinoma AJCC v7 / Stage IIIA Lung Non-Small Cell Cancer AJCC v71
3Active Not RecruitingTreatmentStage IV or Recurrent Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentUnresectable or Metastatic Melanoma2
3Active Not RecruitingTreatmentVarious Advanced Cancer2
3CompletedTreatmentMelanoma1
3CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
3Not Yet RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
3Not Yet RecruitingTreatmentLiver Cancer1
3Not Yet RecruitingTreatmentRenal Cancers / Renal Cell Carcinoma Metastatic / Synchronous Neoplasm1
3Not Yet RecruitingTreatmentStage II Malignant Melanoma1
3RecruitingTreatmentAdenocarcinoma of the Lung / ALK wt Allele / EGFR wt Allele / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Non-Small Cell Carcinoma / Malignant Neoplasms of Respiratory and Intrathoracic Organs / RET gene mutation / ROS1 Gene Mutation / Stage IV Lung Cancer AJCC v81
3RecruitingTreatmentAdvanced Solid Tumors / Cancer, Anal / Cancer, Bladder / Cholangiocarcinomas / Colorectal Cancers / Hepatocellular,Carcinoma / HNSCC / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Melanoma / Renal Cancers1
3RecruitingTreatmentAnn Arbor Stage III Hodgkin Lymphoma / Ann Arbor Stage III Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage III Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage III Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IIIA Hodgkin Lymphoma / Ann Arbor Stage IIIB Hodgkin Lymphoma / Ann Arbor Stage IV Hodgkin Lymphoma / Ann Arbor Stage IV Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage IV Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage IV Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IVA Hodgkin Lymphoma / Ann Arbor Stage IVB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Lymphocyte-Rich Classic Hodgkin Lymphoma1
3RecruitingTreatmentBMS-986205 / Cancer, Bladder / Muscle-invasive Bladder Cancer1
3RecruitingTreatmentBladder Tumors / Cancer, Bladder / Muscle-invasive Bladder Cancer1
3RecruitingTreatmentBreast Cancer1
3RecruitingTreatmentCancer, Bladder1
3RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Malignant Neoplasm in Lymph Node / Metastatic Malignant Neoplasm in the Bone / Metastatic Malignant Neoplasm in the Soft Tissues / Metastatic Malignant Neoplasm in the Viscera / Sarcomatoid Renal Cell Carcinoma / Stage IV Renal Cell Cancer AJCC v81
3RecruitingTreatmentComplete Response / Fallopian Tube Cancer / FIGO Stage III-IV / Newly Diagnosed / Ovarian Epithelial Cancer / Partial Response / Primary Peritoneal1
3RecruitingTreatmentEsophageal Cancers1
3RecruitingTreatmentHead and Neck Carcinoma1
3RecruitingTreatmentHepatocellular,Carcinoma1
3RecruitingTreatmentHepatocellular,Carcinoma / Liver Cancer1
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
3RecruitingTreatmentMalignant Neoplasm of Stomach1
3RecruitingTreatmentMelanoma2
3RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
3RecruitingTreatmentMetastatic Colorectal Cancer (MCRC) / Stage III Colorectal Cancer1
3RecruitingTreatmentMetastatic Malignant Neoplasm in Lymph Node / Metastatic Malignant Neoplasm in the Adrenal Gland / Metastatic Malignant Neoplasm in the Lung / Metastatic Malignant Neoplasm in the Pancreas / Metastatic Malignant Neoplasm in the Skin / Metastatic Malignant Neoplasm in the Soft Tissues / Metastatic Renal Cell Carcinoma / Sarcomatoid Renal Cell Carcinoma / Stage II Renal Cell Cancer AJCC v7 / Stage III Renal Cell Cancer AJCC v7 / Unclassified Renal Cell Carcinoma1
3RecruitingTreatmentMetastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma1
3RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
3RecruitingTreatmentMetastatic Non-Squamous Non-Small Cell Lung Cancer1
3RecruitingTreatmentMetastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
3RecruitingTreatmentProstate Cancer1
3RecruitingTreatmentRenal Cell Adenocarcinoma3
3RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
3RecruitingTreatmentSquamous Non-Small Cell Lung Cancer1
3RecruitingTreatmentTumors Metastatic to Brain1
3RecruitingTreatmentUrothelial Cancer1
3SuspendedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic / Non-Small Cell Carcinoma of Lung, TNM Stage 41
3TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
3WithdrawnTreatmentHead and Neck Carcinoma1
3WithdrawnTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
3WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
4Active Not RecruitingOtherRenal Cell Adenocarcinoma1
4Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Kidney / Renal Cancers / Renal Neoplasms1
4Active Not RecruitingTreatmentLung Cancers1
4Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
4Not Yet RecruitingDiagnosticLung Cancers / Melanoma / Non-small Cell1
4Not Yet RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
4RecruitingNot AvailableMetastatic Melanoma1
Not AvailableActive Not RecruitingNot AvailableInflammation, Brain1
Not AvailableActive Not RecruitingTreatmentBreast Cancer1
Not AvailableAvailableNot AvailablePediatric Cancer1
Not AvailableCompletedNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC) / Nivolumab Treatment in Expanded Use in Real World1
Not AvailableCompletedNot AvailableMelanoma1
Not AvailableNo Longer AvailableNot AvailableMelanoma, Malignant1
Not AvailableNo Longer AvailableNot AvailableNon-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer1
Not AvailableNo Longer AvailableNot AvailableStage III (Unresectable) or Stage IV Advanced Melanoma1
Not AvailableNot Yet RecruitingNot AvailableDysphagia, Oropharyngeal / Head and Neck Carcinoma / Oropharynx Cancers / Oropharynx Squamous Cell Carcinoma / Swallowing Disorders1
Not AvailableNot Yet RecruitingNot AvailableImmune-Related Adverse Events / Lung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableNot Yet RecruitingNot AvailableLung Cancers / Melanoma / Renal Cancers1
Not AvailableNot Yet RecruitingNot AvailableLung Squamous Cell Carcinoma Stage IV1
Not AvailableNot Yet RecruitingOtherCervix Cancer1
Not AvailableRecruitingNot AvailableBiliary Tract Cancer / Hepatocellular,Carcinoma1
Not AvailableRecruitingNot AvailableCarcinoma, Colorectal / Lung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableRecruitingNot AvailableDNA Damage / DNA Double Strand Break / HNSCC1
Not AvailableRecruitingNot AvailableHead and Neck Carcinoma1
Not AvailableRecruitingNot AvailableHealthy Volunteers / Immunotherapy / Melanoma / Metagenome / Microbiome1
Not AvailableRecruitingNot AvailableImmunotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metagenome / Microbiome / Renal Cell Adenocarcinoma1
Not AvailableRecruitingNot AvailableImmunotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoantigens / Neoepitopes / Next Generation Sequencing (NGS) / Personalized Neoantigen Cancer Vaccine1
Not AvailableRecruitingNot AvailableMelanoma1
Not AvailableRecruitingNot AvailableMetastatic Cancers1
Not AvailableRecruitingNot AvailableTumors Metastatic to Brain1
Not AvailableRecruitingScreeningAdenocarcinoma of the Lung / Lung Large Cell Carcinoma / Resectable Lung Non-Small Cell Carcinoma / Stage IB Lung Non-Small Cell Carcinoma AJCC v7 / Stage IB Lung Squamous Cell Carcinoma AJCC v7 / Stage II Lung Non-Small Cell Cancer AJCC v7 / Stage II Lung Squamous Cell Carcinoma AJCC v7 / Stage IIA Lung Non-Small Cell Carcinoma AJCC v7 / Stage IIA Lung Squamous Cell Carcinoma AJCC v7 / Stage IIB Lung Non-Small Cell Carcinoma AJCC v7 / Stage IIB Lung Squamous Cell Carcinoma AJCC v7 / Stage IIIA Lung Non-Small Cell Cancer AJCC v7 / Stage IIIA Lung Squamous Cell Carcinoma AJCC v71

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
InjectionIntravenous10 mg/1mL
SolutionIntravenous10 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US2013173223No2013-05-132033-05-13Us
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)80-90 ºC (based on IgG properties)McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282
boiling point (°C)Fab and Fc domains denaturates at 60 and 70 ºC respectivelyArnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility50 mg/mlHuman IgG purified. Product Information
isoelectric point6.1-8.5 Agrisera Information about IgG antibodies.

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Signal transducer activity
Specific Function
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. ...
Gene Name
PDCD1
Uniprot ID
Q15116
Uniprot Name
Programmed cell death protein 1
Molecular Weight
31646.635 Da
References
  1. Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116]

Drug created on February 24, 2015 16:02 / Updated on June 03, 2020 08:00

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates