Identification
NameNivolumab
Accession NumberDB09035  (DB06132)
TypeBiotech
GroupsApproved
Description

Nivolumab is a fully human IgG4 monoclonal antibody that acts as an immunomodulator by blocking ligand activation of programmed cell death 1 (PD-1) receptor on T cells. It is indicated for use in patients with unresectable (cannot be surgically removed) or metastatic melanoma who no longer respond to other drugs. Nivolumab is administered as an intravenous infusion over 60 minutes every 2 weeks.

Protein structureDb09035
Related Articles
Protein chemical formulaC6362H9862N1712O1995S42
Protein average weight143597.3811 Da
Sequences
>Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK
>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
SynonymsNot Available
External IDs BMS-936558 / GTPL7335 / MDX-1106 / ONO-4538
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada
OpdivoInjection10 mg/mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUs
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada
OpdivoInjection10 mg/mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNII31YO63LBSN
CAS number946414-94-4
Pharmacology
Indication

Nivolumab is indicated for the treatment of unresectable or metastatic melanoma for patients who no longer respond to treatment with other drugs. It is intended for use in patients who have been previously treated with ipilimumab and is used for melanoma patients after treatment with ipilimumab and a BRAF inhibitor in patients whose tumors express BRAF V600 gene mutations. Historically there have been very few effective treatments for advanced melanoma, which is why this product was approved under an FDA accelerated program to allow earlier patient access.

Structured Indications
PharmacodynamicsNot Available
Mechanism of action

Nivolumab is a human immunoglobulin G4 (IgG4) monoclonal antibody that binds to the programmed cell death 1 (PD-1) receptor and selectively blocks interaction with its programmed death ligands PD-L1 and PD-L2. Upregulation of PD-1 ligands occurs in some tumors and signalling through this pathway can contribute to inhibition of active T-cell immune surveillance of tumour tissue. The inhibitory effect of PD-1 and its ligands occurs through the promotion of apoptosis in antigen specific T cells while simultaneously blocking apoptosis in suppressor T cells. Blocking PD-1 activity has been shown to lead to decreased tumour growth in mouse tumour models.

TargetKindPharmacological actionActionsOrganismUniProt ID
Programmed cell death protein 1Proteinyes
antibody
HumanQ15116 details
Related Articles
Absorption

The intended route of administration is intravenous, therefore bioavailability is expected to be 100%.

Volume of distribution

8.0 L

Protein bindingNot Available
Metabolism

As nivolumab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of elimination

Renal clearance is negligible as vedolizumab is a high molecular weight protein.

Half life

26.7 days

Clearance

9.5 mL/hr

Toxicity

Based on data from animal studies, there is risk of fetal harm when administered to pregnant women. It is therefore advisable for pregnant women to use contraception during treatment and for 5 months afterwards. There have been reported cases of severe pneumonitis or interstitial lung disease, including fatal cases, with the use of nivolumab during clinical trials. Therefore, patients taking this drug should be monitored for signs and symptoms of pneumonitis. During clinical trials there have also been reports of the development of immune-mediated colitis, immune-mediated hepatitis with increased liver test abnormalities, immune-mediated nephritis and renal dysfunction, immune-mediated hypothyroidism and hyperthyroidism, and rare cases of other immune-mediated reactions such as pancreatitis, uveitis, demyelination, autoimmune neuropathy, adrenal insufficiency, and facial and abducens nerve paresis.

Affected organismsNot Available
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Nivolumab.Approved
BelimumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Nivolumab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Nivolumab.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Nivolumab.Approved, Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Nivolumab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Nivolumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Nivolumab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Nivolumab.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Nivolumab.Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Nivolumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Nivolumab.Investigational
OleandrinAnvirzel may decrease the cardiotoxic activities of Nivolumab.Experimental
OuabainOuabain may decrease the cardiotoxic activities of Nivolumab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Nivolumab.Approved, Vet Approved
RindopepimutThe therapeutic efficacy of CDX-110 can be decreased when used in combination with Nivolumab.Investigational
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Nivolumab.Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Nivolumab.Approved, Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116 ]
  2. Tsai KK, Zarzoso I, Daud AI: PD-1 and PD-L1 antibodies for melanoma. Hum Vaccin Immunother. 2014;10(11):3111-6. doi: 10.4161/21645515.2014.983409. [PubMed:25625924 ]
  3. Topalian SL, Sznol M, McDermott DF, Kluger HM, Carvajal RD, Sharfman WH, Brahmer JR, Lawrence DP, Atkins MB, Powderly JD, Leming PD, Lipson EJ, Puzanov I, Smith DC, Taube JM, Wigginton JM, Kollia GD, Gupta A, Pardoll DM, Sosman JA, Hodi FS: Survival, durable tumor remission, and long-term safety in patients with advanced melanoma receiving nivolumab. J Clin Oncol. 2014 Apr 1;32(10):1020-30. doi: 10.1200/JCO.2013.53.0105. Epub 2014 Mar 3. [PubMed:24590637 ]
External Links
ATC CodesL01XC17 — Nivolumab
AHFS Codes
  • 10:00
PDB EntriesNot Available
FDA labelDownload (315 KB)
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0RecruitingTreatmentMelanoma (Skin) / Skin Cancers1
0RecruitingTreatmentRenal Cancers1
1Active Not RecruitingBasic ScienceAdvanced Melanoma / Metastatic Melanoma1
1Active Not RecruitingBasic ScienceNeoplasms, Colorectal1
1Active Not RecruitingBasic ScienceRenal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentCancer, Breast / Cancer, Ovarian / Carcinoma, Colorectal / Carcinoma, Pancreatic / Malignant Neoplasm of Prostate / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma / Tumors, Solid1
1Active Not RecruitingTreatmentChronic Myeloid Leukemia (CML)1
1Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentMalignant Lymphomas / Malignant Solid Tumours1
1Active Not RecruitingTreatmentMalignant Melanoma1
1Active Not RecruitingTreatmentMelanoma (Skin)2
1Active Not RecruitingTreatmentMetastatic Castration-resistant Prostrate Cancer (mCRPC) / Metastatic Melanoma (MEL) / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)2
1Active Not RecruitingTreatmentTumors, Solid1
1CompletedTreatmentAdvanced Solid Tumors / Recurrent Solid Tumors1
1CompletedTreatmentColorectal Cancers / Malignant Melanoma / Malignant Neoplasm of Prostate / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cancers1
1CompletedTreatmentMalignant Solid Tumours1
1CompletedTreatmentNeoplasms by Site1
1Not Yet RecruitingTreatmentAcute Myeloid Leukemia and Myelodysplastic Syndrome1
1Not Yet RecruitingTreatmentAdvanced Malignancies1
1Not Yet RecruitingTreatmentAdvanced Solid Tumors1
1Not Yet RecruitingTreatmentBladder Cancers1
1Not Yet RecruitingTreatmentCancer, Advanced2
1Not Yet RecruitingTreatmentFollicular Lymphoma (FL)1
1Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
1Not Yet RecruitingTreatmentLeptomeningeal Disease / Melanoma and Other Malignant Neoplasms of Skin1
1Not Yet RecruitingTreatmentMultiple Myeloma (MM)1
1Not Yet RecruitingTreatmentNeuroblastomas1
1Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1Not Yet RecruitingTreatmentRecurrent Non-small Cell Lung Cancer1
1Not Yet RecruitingTreatmentTumors, Solid1
1RecruitingOtherMelanoma1
1RecruitingOtherSevere Sepsis1
1RecruitingTreatmentALK-positive NSCLC1
1RecruitingTreatmentAdult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Unresectable Solid Neoplasm1
1RecruitingTreatmentAdult Solid Neoplasm / Childhood Solid Neoplasm / Neoplasms, Metastatic1
1RecruitingTreatmentAdvanced Cancers1
1RecruitingTreatmentAdvanced Solid Tumors3
1RecruitingTreatmentAdvanced Solid Tumors (Part A/B/C/D) / Melanoma (Part E) / Non-small Cell Lung Cancer (NSCLC) and Melanoma (Part E) / Non-small Cell Lung Cancer (Part E) / Squamous Cell Cancer of the Head and Neck (Part E)1
1RecruitingTreatmentAdvanced Solid Tumors, Including But Not Limited to Lung Cancer / Cancer, Ovarian / Colorectal Cancers / Glioblastoma Multiforme / Head and Neck Carcinoma / Head and Neck Squamous Cell Cancer / Malignant Gliomas / Malignant Neoplasm of Pancreas / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma1
1RecruitingTreatmentAdvanced Solid Tumors / Cancers1
1RecruitingTreatmentAdvanced Solid Tumors / Head and Neck Carcinoma, Squamous Cell / Non-Small-Cell Lung Carcinoma (NSCLC) / Triple-Negative Breast Neoplasms1
1RecruitingTreatmentAdvanced or Metastatic Solid Tumors2
1RecruitingTreatmentAggressive Non-Hodgkin Lymphoma / Neoplasms, Advanced Solid / Recurrent Solid Neoplasm / Refractory Mantle Cell Lymphoma / T-Cell Non-Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentAstrocytomas / Glioblastomas / Malignant Gliomas1
1RecruitingTreatmentB Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Refractory Adult Acute Lymphoblastic Leukemia / Refractory Childhood Acute Lymphoblastic Leukemia1
1RecruitingTreatmentB Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL11
1RecruitingTreatmentBRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1RecruitingTreatmentBladder Carcinoma / Colorectal Cancers / Salivary Gland Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentBladder Tumors / Lung Cancers / Malignant Melanoma / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC) / Skin Cancers / Transitional Cell Carcinoma of the Bladder / Urinary Bladder Cancer1
1RecruitingTreatmentBreast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Unresectable Solid Neoplasm1
1RecruitingTreatmentCancer, Advanced Solid Tumors1
1RecruitingTreatmentCancer, Ovarian / Fallopian Tubes / Primary Peritoneal Cancer / Recurrent Ovarian Cancer1
1RecruitingTreatmentCancers1
1RecruitingTreatmentChordomas1
1RecruitingTreatmentClassical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Solid Neoplasms / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Urothelial Carcinoma / Stage III Penile Cancer / Stage III Renal Cell Cancer / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Urethral Cancer / Stage IIIa Penile Cancer / Stage IIIb Penile Cancer / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Urothelial Carcinoma / Stage IV Penile Cancer / Stage IV Renal Cell Cancer / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Urethral Cancer / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma1
1RecruitingTreatmentCcRCC / Clear Cell Renal Cell Carcinoma / RCC / Renal Cancers / Renal Cell Adenocarcinoma1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma / Stage I Renal Cell Cancer / Stage II Renal Cell Cancer / Stage III Renal Cell Cancer1
1RecruitingTreatmentColo-rectal Cancer / Malignant Neoplasm of Stomach / Metastatic Cancers / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma / Squamous-cell Carcinomas of the Head and Neck / Tumors, Solid1
1RecruitingTreatmentEBV Related Hodgkin's Lymphoma / EBV Related Lymphoma / EBV Related Non-Hodgkin's Lymphoma / EBV-Related PTLD / Lymphoma, Hodgkins / Lymphoproliferative Disorders / NonHodgkin Lymphoma1
1RecruitingTreatmentEsophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Stomach1
1RecruitingTreatmentEsophageal Cancers / Lung Cancers / Malignant Neoplasm of Stomach / Renal Cancers1
1RecruitingTreatmentGlioblastomas1
1RecruitingTreatmentGlioblastomas / Gliosarcoma / Recurrent Brain Neoplasm1
1RecruitingTreatmentGlioblastomas / Gliosarcoma / Supratentorial Glioblastoma1
1RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1RecruitingTreatmentHematopoietic Cell Transplantation Recipient / Myeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Lymphocytic Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma1
1RecruitingTreatmentHuman Papillomavirus Positive Anal Carcinoma / Human Papillomavirus Positive Cervical Carcinoma / Human Papillomavirus Positive Oropharyngeal Carcinoma / Human Papillomavirus Positive Penile Carcinoma / Human Papillomavirus Positive Vulvar Carcinoma / Human Papillomavirus-Related Carcinoma1
1RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1RecruitingTreatmentLymphoma, Hodgkins1
1RecruitingTreatmentLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1RecruitingTreatmentMalignancies, Hematologic1
1RecruitingTreatmentMalignant Gliomas1
1RecruitingTreatmentMalignant Melanoma1
1RecruitingTreatmentMelanoma2
1RecruitingTreatmentMetastatic Colorectal Cancers1
1RecruitingTreatmentMetastatic Malignant Neoplasm in the Brain / Metastatic Malignant Neoplasm in the Spine / Stage IV Skin Melanoma1
1RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
1RecruitingTreatmentNeoplasms Malignant1
1RecruitingTreatmentNeoplasms, Breast / Neoplasms, Pancreatic1
1RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentStage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma1
1Unknown StatusTreatmentAdvanced Solid Tumors / Recurrent Solid Tumors1
1WithdrawnTreatmentMetastatic Melanoma1
1, 2Active Not RecruitingTreatmentCancer, Advanced1
1, 2Active Not RecruitingTreatmentCancer, Breast / Triple-Negative Breast Cancer (TNBC)1
1, 2Active Not RecruitingTreatmentMetastatic Cancers1
1, 2Not Yet RecruitingTreatmentAdenocarcinoma of the Lung / Lung Cancers1
1, 2Not Yet RecruitingTreatmentAntibodies, Neoplasm1
1, 2Not Yet RecruitingTreatmentChondrosarcomas / Ewing's Sarcoma (ES) / Liposarcoma / Sarcoma, Osteogenic / Undifferentiated Pleomorphic Sarcoma1
1, 2Not Yet RecruitingTreatmentColorectal Cancers1
1, 2Not Yet RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Not Yet RecruitingTreatmentImmunotherapy / Neoplasms, Head and Neck1
1, 2Not Yet RecruitingTreatmentMelanoma1
1, 2Not Yet RecruitingTreatmentMetastatic Melanoma1
1, 2Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingPreventionStage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2RecruitingTreatmentALK Gene Mutation / EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1, 2RecruitingTreatmentALK Gene Translocation / EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Translocation / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1, 2RecruitingTreatmentAcute Myeloid Leukaemias (AML) / Leukemias / Myelodysplastic Syndrome1
1, 2RecruitingTreatmentAdvanced B-cell NHL / Advanced Solid Tumors1
1, 2RecruitingTreatmentAdvanced Malignancies / Metastatic Malignancy1
1, 2RecruitingTreatmentAdvanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma1
1, 2RecruitingTreatmentAdvanced or Metastatic Colorectal Cancer (CRC) / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Ligand 1 (PD-L1) Inhibitor / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Protein 1 (PD-1) Inhibitor / Advanced or Metastatic Solid Tumors / Non-Small Cell Lung Cancer (NSCLC; Squamous or Nonsquamous) / Pancreatic Ductal Adenocarcinoma (PDAC)1
1, 2RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1, 2RecruitingTreatmentB Cell NHL Including DLBCL / Carcinoma, Squamous Cell of Head and Neck / Glioblastomas / HL / Melanoma / Neoplasms, Colorectal / Neoplasms, Ovarian / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentBiallelic Mismatch Repair Deficiency (bMMRD) Positive Patients / Refractory or Recurrent Hypermutated Malignancies1
1, 2RecruitingTreatmentBroad Solid Tumor1
1, 2RecruitingTreatmentCANCER,NOS1
1, 2RecruitingTreatmentCancer of Rectum1
1, 2RecruitingTreatmentCancer, Advanced3
1, 2RecruitingTreatmentCancer, Advanced / Carcinoma, Colorectal / Endometrial / Malignant Neoplasm of Pancreas / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma / Uterine1
1, 2RecruitingTreatmentCancer, Advanced / Hepatocellular,Carcinoma1
1, 2RecruitingTreatmentCancer, Advanced / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentCancers3
1, 2RecruitingTreatmentCancers / Carcinoma NOS / Tumors, Solid1
1, 2RecruitingTreatmentCancers / Melanoma / Metastatic Melanoma / Neoplasm of Lung / Non Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentCarcinoma´╝îNon-Small-Cell Lung / Melanoma / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentChildhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Non-Hodgkin's lymphoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1, 2RecruitingTreatmentChildren, Adolescents and Young Adults With Refractory or Recurrent Malignancies1
1, 2RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1, 2RecruitingTreatmentClear Cell Renal Cell Carcinoma / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentColorectal Cancer (CRC) / Glioblastoma (GBM) (Phase ll Only) / Malignant Melanoma of Head and Neck / Malignant Neoplasm of Colon / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC) / Ovarian Carcinoma / Renal Cell Carcinoma (RCC) (Phase ll Only) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2RecruitingTreatmentEGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1, 2RecruitingTreatmentExtensive-Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentGastroesophageal Junction Region (GEJ) Cancer / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentGlioblastomas / Hepatocellular Carcinoma Recurrent / Non-Small Cell Lung Cancer Recurrent / Tumors, Solid1
1, 2RecruitingTreatmentGrade 3a Follicular Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma1
1, 2RecruitingTreatmentHepatic Metastases / Uveal Melanoma1
1, 2RecruitingTreatmentHepatocellular Carcinoma (HCC)1
1, 2RecruitingTreatmentHepatocellular,Carcinoma2
1, 2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentLymphoma, Hodgkins1
1, 2RecruitingTreatmentMalignant Lymphomas / Multiple Myeloma (MM)1
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentMalignant Neoplasm of Prostate1
1, 2RecruitingTreatmentMalignant Neoplasms of Urinary Tract / Other Disorders of Kidney and Ureter / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentMalignant Solid Tumours2
1, 2RecruitingTreatmentMelanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma1
1, 2RecruitingTreatmentMetastatic Brain Cancer1
1, 2RecruitingTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2RecruitingTreatmentMetastatic Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2RecruitingTreatmentNeoplasms by Site1
1, 2RecruitingTreatmentNeoplasms, Hematologic2
1, 2RecruitingTreatmentNon-Hodgkin's Disease1
1, 2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)4
1, 2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC) / Tumors, Solid1
1, 2RecruitingTreatmentRenal Cell Adenocarcinoma2
1, 2RecruitingTreatmentStage III/IV Melanoma1
1, 2RecruitingTreatmentTumors, Solid1
1, 2RecruitingTreatmentVarious Advanced Cancer1
1, 2TerminatedOtherTumors, Solid1
1, 2WithdrawnTreatmentSquamous Non-Small Cell Lung Cancer1
2Active Not RecruitingOtherNon-Small-Cell Lung Carcinoma (NSCLC)1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Stage IV Cervical Cancer / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer1
2Active Not RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer2
2Active Not RecruitingTreatmentAdvanced or Metastatic Melanoma1
2Active Not RecruitingTreatmentAnal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Recurrent Anal Canal Carcinoma / Stage IV Anal Canal Cancer1
2Active Not RecruitingTreatmentGastric Adenocarcinoma / Gastroesophageal Junction Adenocarcinoma1
2Active Not RecruitingTreatmentHodgkins Disease (HD)1
2Active Not RecruitingTreatmentMalignant Lymphomas1
2Active Not RecruitingTreatmentMalignant Neoplasm of Prostate / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma1
2Active Not RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2Active Not RecruitingTreatmentMelanoma1
2Active Not RecruitingTreatmentMelanoma / Metastatic Brain Tumors1
2Active Not RecruitingTreatmentMesothelioma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Unresectable Melanoma1
2Active Not RecruitingTreatmentNasopharyngeal Nonkeratinizing Carcinoma / Recurrent Nasopharyngeal Undifferentiated Carcinoma / Recurrent Nasopharynx Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Nasopharyngeal Undifferentiated Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Nasopharyngeal Undifferentiated Carcinoma / Stage IVA Nasopharyngeal Carcinoma / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma / Stage IVC Nasopharyngeal Carcinoma AJCC v71
2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
2Active Not RecruitingTreatmentPreviously Treated Metastatic Adenocarcinoma of the Pancreas1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
2Active Not RecruitingTreatmentSquamous Cell Non-small Cell Lung Cancer1
2Active Not RecruitingTreatmentTumors, Solid1
2Active Not RecruitingTreatmentVarious Advanced Cancer1
2CompletedTreatmentGlioblastoma Multiforme1
2Enrolling by InvitationTreatmentNon-Small-Cell Lung Carcinoma (NSCLC) / Small Cell Lung Carcinoma1
2Not Yet RecruitingTreatmentActivated B-Cell-Like Diffuse Large B-Cell Lymphoma / ALK-Positive Large B-Cell Lymphoma / Atypical Burkitt/Burkitt-Like Lymphoma / Diffuse Large B-Cell Lymphoma Associated With Chronic Inflammation / Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / Epstein-Barr Virus Positive Diffuse Large B-Cell Lymphoma of the Elderly / Epstein-Barr Virus-Positive Mucocutaneous Ulcer / Epstein-Barr Virus-Positive Neoplastic Cells Present / Germinal Center B-Cell-Like Diffuse Large B-Cell Lymphoma / High-Grade B-Cell Lymphoma With MYC and BCL2 and/or BCL6 Rearrangements / Human Herpes Virus 8-Related Malignant Neoplasm / Human Herpesvirus-8-Positive Neoplastic Cells Present / Intravascular Large B-Cell Lymphoma / Large B-Cell Lymphoma With IRF4 Rearrangement / MYC-Negative B-Cell Lymphoma With 11q Aberration Resembling Burkitt Lymphoma / Plasmablastic Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma, Leg Type / Primary Diffuse Large B-Cell Lymphoma of the Central Nervous System / Primary Effusion Lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Lymphomatoid Granulomatosis / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Skin Ulcers / Small Intestinal B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Burkitt Lymphoma / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma1
2Not Yet RecruitingTreatmentAcral lentiginous melanoma / Mucosal Melanoma1
2Not Yet RecruitingTreatmentAdenocarcinoma of the Pancreas1
2Not Yet RecruitingTreatmentAdnexal Carcinoma / Apocrine Carcinoma / Carcinoma, Adenoid Cystic / Eccrine Porocarcinoma / Extraocular Cutaneous Sebaceous Carcinoma / Hidradenocarcinoma / Keratoacanthoma / Malignant sweat gland neoplasm / Microcystic Adnexal Carcinoma / Neuroendocrine Carcinoma of the Skin / NK-Cell Lymphoma, Unclassifiable / Non-Melanomatous Lesion / Paget's Disease / Papillary Adenocarcinoma / Primary Cutaneous Mucinous Carcinoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Refractory Mycosis Fungoides / Refractory T-Cell Non-Hodgkin Lymphoma / Sezary Syndrome / Signet Ring Cell Carcinoma / Skin Basal Cell Carcinoma / Skin Basosquamous Cell Carcinoma / Skin Squamous Cell Carcinoma / Spiradenocarcinoma / Squamous Cell Carcinoma of Unknown Primary Origin / Stage III Skin Cancer / Stage IV Skin Cancer / Sweat Gland Carcinoma / Trichilemmocarcinoma / Vulvar Squamous Cell Carcinoma1
2Not Yet RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer / Lung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
2Not Yet RecruitingTreatmentAdvanced Renal Cell Carcinoma1
2Not Yet RecruitingTreatmentBladder Cancers / Transitional Cell Carcinoma1
2Not Yet RecruitingTreatmentCarcinoma´╝îNon-Small-Cell Lung / Large Cell Lung Carcinoma Metastatic / Lung adenocarcinoma metastatic / Metastatic Lung Cancer / Nonsmall Cell Lung Cancer1
2Not Yet RecruitingTreatmentChondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentChromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma1
2Not Yet RecruitingTreatmentClear Cell Metastatic Renal Cell Carcinoma1
2Not Yet RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
2Not Yet RecruitingTreatmentGastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours1
2Not Yet RecruitingTreatmentGiant Cell Glioblastoma / Gliosarcoma / Oligodendrogliomas / Recurrent Glioblastoma / Small Cell Glioblastoma1
2Not Yet RecruitingTreatmentHER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma1
2Not Yet RecruitingTreatmentMalignant Neoplasm of Pancreas2
2Not Yet RecruitingTreatmentMalignant Neoplasm of Prostate2
2Not Yet RecruitingTreatmentMelanoma2
2Not Yet RecruitingTreatmentMelanoma / Metastatic Melanoma1
2Not Yet RecruitingTreatmentMicrosatellite Instability / Neoplasms, Head and Neck / Penile Neoplasms / Renal Cell Adenocarcinoma / Skin Neoplasms1
2Not Yet RecruitingTreatmentNon Small Cell Lung Cancer Recurrent / Non-Small Cell Carcinoma of Lung, TNM Stage 4 / Non-Small-Cell Lung Cancer Metastatic / Nonsmall Cell Lung Cancer1
2Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2Not Yet RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2Not Yet RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer2
2Not Yet RecruitingTreatmentRenal Cancers1
2Not Yet RecruitingTreatmentRenal Cell Adenocarcinoma1
2Not Yet RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentStage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2Not Yet RecruitingTreatmentType B3 Thymoma and Thymic Carcinoma1
2Not Yet RecruitingTreatmentVarious Advanced Cancer1
2RecruitingDiagnosticBrain Metastasis / Melanoma1
2RecruitingTreatmentAcinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Endometrial Adenocarcinomas / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metastatic Malignant Neoplasm of Unknown Primary Origin / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Squamous Cell Carcinoma1
2RecruitingTreatmentAcute Adult T-Cell Leukemia/Lymphoma / Adult T-Cell Leukemia/Lymphoma / CD3 Positive / CD4-Positive Neoplastic Cells Present / Chronic Adult T-Cell Leukemia/Lymphoma / HTLV-1 Infection / Hypercalcemia / Lymphomatous Adult T-Cell Leukemia/Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Smoldering Adult T-Cell Leukemia/Lymphoma1
2RecruitingTreatmentAcute Myeloid Leukaemias (AML) / Leukemias1
2RecruitingTreatmentAdenocarcinoma of the Lung / Lung Cancers / Non-Squamous Non-Small Cell Lung Cancer (NSCLC)1
2RecruitingTreatmentAdenocarcinomas1
2RecruitingTreatmentAdult Acute Myeloid Leukemia in Remission1
2RecruitingTreatmentAdvanced Malignant Neoplasm / Advanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Neoplasm of Prostate / Malignant Uterine Neoplasm / Melanoma / Oesophageal Carcinoma / Ovarian Carcinoma / Plasma Cell Myeloma / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Solid Neoplasm / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Neoplasm / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Solid Neoplasms / Thyroid Gland Carcinoma / Uterine Corpus Cancer1
2RecruitingTreatmentAdvanced Stage Non-small Cell Lung Cancer1
2RecruitingTreatmentBiliary Tract Cancer / Biliary Tract Neoplasms1
2RecruitingTreatmentBladder Cancers / Melanoma1
2RecruitingTreatmentBlastic Plasmacytoid Dendritic Cell Neoplasm (BPDCN) / Hepatosplenic T-Cell Lymphoma / HTLV-1 Infection / NK-Cell Lymphoma, Unclassifiable / Primary Systemic Anaplastic Large Cell Lymphoma, ALK-Negative / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Angioimmunoblastic T-cell Lymphoma / Recurrent Enteropathy-Associated T-Cell Lymphoma / Recurrent Mycosis Fungoides / Refractory Adult T-Cell Leukemia/Lymphoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Angioimmunoblastic T-cell Lymphoma / Refractory Enteropathy-Associated T-Cell Lymphoma / Refractory Mycosis Fungoides / Refractory Nasal Type Extranodal NK/T-Cell Lymphoma / Refractory Peripheral T-Cell Lymphoma, Not Otherwise Specified1
2RecruitingTreatmentBrain Metastases, Adult / Clear-cell Metastatic Renal Cell Carcinoma / Non Small Cell Lung Cancer Metastatic1
2RecruitingTreatmentCD (Cluster of Differentiation) 30-Positive Neoplastic Cells Present / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
2RecruitingTreatmentCancer, Advanced2
2RecruitingTreatmentCancer, Breast1
2RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cancer1
2RecruitingTreatmentCancers1
2RecruitingTreatmentCancers / Neoplasia / Neoplasms / Tumors1
2RecruitingTreatmentChordomas / Ependymomas / Meningiomas1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
2RecruitingTreatmentClassical Hodgkin Lymphoma2
2RecruitingTreatmentClassical Hodgkin Lymphoma / Hematopoietic Cell Transplantation Recipient / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
2RecruitingTreatmentClassical Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma / Stage III Hodgkin Lymphoma / Stage IIIA Hodgkin Lymphoma / Stage IIIB Hodgkin Lymphoma / Stage IV Hodgkin Lymphoma / Stage IVA Hodgkin Lymphoma / Stage IVB Hodgkin Lymphoma1
2RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
2RecruitingTreatmentColon Carcinoma1
2RecruitingTreatmentDocumented Stage III NSCLC, Amenable to Concomitant or Sequential Chemoradiotherapy / Locally Advanced Non-Small Cell Lung Cancer1
2RecruitingTreatmentEGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentGastric cancer stage IV1
2RecruitingTreatmentGastrointestinal Stromal Tumors1
2RecruitingTreatmentHaematological Malignancies1
2RecruitingTreatmentHead and Neck Carcinoma2
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentHepatocellular,Carcinoma1
2RecruitingTreatmentHodgkins Disease (HD)2
2RecruitingTreatmentKidney Cancer Metastatic / Kidney Cancer, Stage IV / Renal Cancers1
2RecruitingTreatmentLeptomeningeal Carcinomatosis / Melanoma1
2RecruitingTreatmentLeukemias2
2RecruitingTreatmentLeukemias / Myelodysplastic Syndrome1
2RecruitingTreatmentLimited Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentLung Cancers / Metastatic Lung Cancer / Non-Small-Cell Lung Carcinoma (NSCLC)1
2RecruitingTreatmentLung Squamous Cell Carcinoma Stage IV / Nonsquamous Nonsmall Cell Neoplasm of Lung1
2RecruitingTreatmentMalignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer1
2RecruitingTreatmentMicrosatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer1
2RecruitingTreatmentMajor Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma1
2RecruitingTreatmentMalignant Lymphomas1
2RecruitingTreatmentMalignant Melanoma1
2RecruitingTreatmentMalignant Melanoma Stage III1
2RecruitingTreatmentMalignant Neoplasm of Prostate1
2RecruitingTreatmentMalignant Neoplasms of Respiratory and Intrathoracic Organs / Non-Small-Cell Lung Carcinoma (NSCLC)1
2RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2RecruitingTreatmentMelanoma4
2RecruitingTreatmentMelanoma / Oligometastatic Melanoma1
2RecruitingTreatmentMelanoma / Uveal Melanoma1
2RecruitingTreatmentMeningiomas1
2RecruitingTreatmentMetastatic Cancers / Recurrent Cancer / Salivary Gland Carcinoma1
2RecruitingTreatmentMetastatic Carcinoma in the Adrenal Cortex / Recurrent Adrenal Cortex Carcinoma / Stage III Adrenal Cortex Carcinoma / Stage IV Adrenal Cortex Carcinoma1
2RecruitingTreatmentMetastatic Clear Cell Renal Cell Carcinoma1
2RecruitingTreatmentMetastatic Melanoma2
2RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2RecruitingTreatmentMetastatic Renal Cell Cancer / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Non-Small Cell Lung Cancer / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma1
2RecruitingTreatmentMetastatic Renal Cell Carcinoma2
2RecruitingTreatmentMetastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic1
2RecruitingTreatmentMetastatic or Advanced Non-Small Cell Lung Cancer (NSCLC)1
2RecruitingTreatmentMultiple Myeloma (MM)1
2RecruitingTreatmentMyeloproliferative Diseases1
2RecruitingTreatmentNasopharyngeal Carcinoma1
2RecruitingTreatmentNeoplasms, Brain1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Skin Cancers1
2RecruitingTreatmentNon-Small Lung Cancer, Epigenetic Therapy1
2RecruitingTreatmentNon-Small-Cell Lung Cancer (NSCLC)1
2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)7
2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC) / Non-squamous Cell Lung Cancer / Squamous Cell Carcinoma of Lung1
2RecruitingTreatmentOral Cavity SCC1
2RecruitingTreatmentPancreatic Cancer Metastatic1
2RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentRenal Cell Adenocarcinoma2
2RecruitingTreatmentSalivary Gland Cancers1
2RecruitingTreatmentSmoldering Multiple Myeloma (SMM)1
2RecruitingTreatmentSolid Tumors Induced by Prior Radiation Exposure1
2RecruitingTreatmentUntreated Metastatic Pancreatic Ductal Adenocarcinoma1
2RecruitingTreatmentUterine Corpus Leiomyosarcoma1
2RecruitingTreatmentUveal Melanoma1
2RecruitingTreatmentVarious Advanced Cancer1
2RecruitingTreatmentRefractory, metastatic Colorectal cancer1
2SuspendedTreatmentGastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Metastatic Liposarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Soft Tissue Sarcoma / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Soft Tissue Sarcoma / Stage IVA Bone Sarcoma / Stage IVB Bone Sarcoma / Unresectable Liposarcoma1
2WithdrawnTreatmentAdvanced Non-Small Cell Lung Cancer / Metastatic Non-Small Cell Lung Cancer / Neoplasms, Lung1
2WithdrawnTreatmentLung Cancer, Nonsmall Cell, Stage I1
2WithdrawnTreatmentMelanoma1
2, 3Not Yet RecruitingTreatmentAdult Myelodysplastic Syndrome / Myelodysplastic Syndrome With Excess Blasts-2 / Untreated Adult Acute Myeloid Leukemia1
2, 3RecruitingTreatmentMalignant Neoplasm of Stomach1
2, 3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma1
2, 3SuspendedTreatmentRecurrent Melanoma of the Skin / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3Active Not RecruitingTreatmentAdvanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
3Active Not RecruitingTreatmentAdvanced or Metastatic (Medically or Surgically Unresectable) Clear-cell Renal Cell Carcinoma1
3Active Not RecruitingTreatmentLung Cancers1
3Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
3Active Not RecruitingTreatmentMelanoma4
3Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)2
3Active Not RecruitingTreatmentNon-Squamous Cell Non-small Cell Lung Cancer1
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
3Active Not RecruitingTreatmentSquamous Cell Non-small Cell Lung Cancer1
3Active Not RecruitingTreatmentStage IV or Recurrent Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentUnresectable or Metastatic Melanoma2
3Not Yet RecruitingTreatmentLung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
3Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
3Not Yet RecruitingTreatmentRenal Cell Adenocarcinoma1
3RecruitingTreatmentBRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3RecruitingTreatmentBrain Cancer1
3RecruitingTreatmentCancer, Advanced1
3RecruitingTreatmentEsophageal Cancers1
3RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
3RecruitingTreatmentHead and Neck Carcinoma1
3RecruitingTreatmentHepatocellular,Carcinoma / I.V Advanced Cancer1
3RecruitingTreatmentHodgkins Disease (HD)1
3RecruitingTreatmentLung Cancers3
3RecruitingTreatmentMalignant Neoplasm of Stomach1
3RecruitingTreatmentMelanoma2
3RecruitingTreatmentMesothelioma2
3RecruitingTreatmentMetastatic Brain Tumors1
3RecruitingTreatmentMultiple Myeloma (MM)1
3RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)4
3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma1
3RecruitingTreatmentRenal Cell Adenocarcinoma1
3RecruitingTreatmentSarcomatoid Renal Cell Carcinoma / Stage II Renal Cell Cancer / Stage III Renal Cell Cancer / Unclassified Renal Cell Carcinoma1
3RecruitingTreatmentStage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v71
3RecruitingTreatmentUrothelial Cancer1
3RecruitingTreatmentVarious Advanced Cancer2
4Active Not RecruitingOtherRenal Cell Adenocarcinoma1
4RecruitingNot AvailableMetastatic Melanoma1
4RecruitingTreatmentRenal Cell Adenocarcinoma1
Not AvailableActive Not RecruitingNot AvailableInflammation, Brain1
Not AvailableActive Not RecruitingNot AvailableMelanoma1
Not AvailableNo Longer AvailableNot AvailableMalignant Melanoma1
Not AvailableNo Longer AvailableNot AvailableNon-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer1
Not AvailableNo Longer AvailableNot AvailableStage III (Unresectable) or Stage IV Advanced Melanoma1
Not AvailableNot Yet RecruitingNot AvailableNivolumab Treatment in Expanded Use in Real World1
Not AvailableRecruitingTreatmentCancer, Breast1
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
InjectionIntravenous10 mg/mL
SolutionIntravenous10 mg
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US2013173223 No2013-05-132033-05-13Us
Properties
StateSolid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Signal transducer activity
Specific Function:
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. Possible cell death inducer, in association with other factors.
Gene Name:
PDCD1
Uniprot ID:
Q15116
Molecular Weight:
31646.635 Da
References
  1. Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116 ]
Drug created on February 24, 2015 16:02 / Updated on June 07, 2017 15:17