Nivolumab

Identification

Name

Nivolumab

Accession Number

DB09035  (DB06132)

Type

Biotech

Groups

Approved

Biologic Classification

Protein Based Therapies
Monoclonal antibody (mAb)

Description

Nivolumab is a fully human IgG4 monoclonal antibody that acts as an immunomodulator by blocking ligand activation of programmed cell death 1 (PD-1) receptor on T cells. It is indicated for use in patients with unresectable (cannot be surgically removed) or metastatic melanoma who no longer respond to other drugs. Nivolumab is administered as an intravenous infusion over 60 minutes every 2 weeks.

Protein structure

Protein chemical formula

C₆₃₆₂H₉₈₆₂N₁₇₁₂O₁₉₉₅S₄₂

Protein average weight

143597.3811 Da

Sequences

>Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK

>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Download FASTA Format

Synonyms

Not Available

External IDs

BMS-936558 / GTPL7335 / MDX-1106 / ONO-4538

Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Opdivo	Solution	10 mg	Intravenous	Bristol Myers Squibb	2015-10-23	Not applicable
Opdivo	Injection	10 mg/mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2014-12-22	Not applicable
Opdivo	Injection	10 mg/mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2017-12-08	Not applicable
Opdivo	Solution	10 mg	Intravenous	Bristol Myers Squibb	2015-10-23	Not applicable
Opdivo	Injection	10 mg/mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2014-12-22	Not applicable

Categories

• Amino Acids, Peptides, and Proteins
• Antibodies
• Antibodies, Monoclonal
• Antineoplastic Agents
• Antineoplastic and Immunomodulating Agents
• Blood Proteins
• Globulins
• Immunoglobulins
• Immunoproteins
• Programmed Death Receptor-1 Blocking Antibody
• Proteins
• Serum Globulins

UNII

31YO63LBSN

CAS number

946414-94-4

Pharmacology

Indication

Nivolumab is indicated for the treatment of unresectable or metastatic melanoma for patients who no longer respond to treatment with other drugs. It is intended for use in patients who have been previously treated with ipilimumab and is used for melanoma patients after treatment with ipilimumab and a BRAF inhibitor in patients whose tumors express BRAF V600 gene mutations. Historically there have been very few effective treatments for advanced melanoma, which is why this product was approved under an FDA accelerated program to allow earlier patient access.

Structured Indications

• Metastatic Melanoma
• Refractory Hodgkin Lymphoma
• Unresectable Melanoma
• Refractory, advanced Renal cell carcinoma
• Refractory, metastatic Non-small cell lung cancer
• Refractory, metastatic Renal cell carcinoma

Pharmacodynamics

Not Available

Mechanism of action

Nivolumab is a human immunoglobulin G4 (IgG4) monoclonal antibody that binds to the programmed cell death 1 (PD-1) receptor and selectively blocks interaction with its programmed death ligands PD-L1 and PD-L2. Upregulation of PD-1 ligands occurs in some tumors and signalling through this pathway can contribute to inhibition of active T-cell immune surveillance of tumour tissue. The inhibitory effect of PD-1 and its ligands occurs through the promotion of apoptosis in antigen specific T cells while simultaneously blocking apoptosis in suppressor T cells. Blocking PD-1 activity has been shown to lead to decreased tumour growth in mouse tumour models.

Target	Actions	Organism
AProgrammed cell death protein 1	antibody	Human

Absorption

The intended route of administration is intravenous, therefore bioavailability is expected to be 100%.

Volume of distribution

8.0 L

Protein binding

Not Available

Metabolism

As nivolumab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of elimination

Renal clearance is negligible as vedolizumab is a high molecular weight protein.

Half life

26.7 days

Clearance

9.5 mL/hr

Toxicity

Based on data from animal studies, there is risk of fetal harm when administered to pregnant women. It is therefore advisable for pregnant women to use contraception during treatment and for 5 months afterwards. There have been reported cases of severe pneumonitis or interstitial lung disease, including fatal cases, with the use of nivolumab during clinical trials. Therefore, patients taking this drug should be monitored for signs and symptoms of pneumonitis. During clinical trials there have also been reports of the development of immune-mediated colitis, immune-mediated hepatitis with increased liver test abnormalities, immune-mediated nephritis and renal dysfunction, immune-mediated hypothyroidism and hyperthyroidism, and rare cases of other immune-mediated reactions such as pancreatitis, uveitis, demyelination, autoimmune neuropathy, adrenal insufficiency, and facial and abducens nerve paresis.

Affected organisms

Not Available

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

Drug	Interaction	Drug group
Acetyldigitoxin	Acetyldigitoxin may decrease the cardiotoxic activities of Nivolumab.	Approved
Acetyldigoxin	Acetyldigoxin may decrease the cardiotoxic activities of Nivolumab.	Experimental
Ancestim	The risk or severity of cytotoxicity can be increased when Ancestim is combined with Nivolumab.	Approved, Investigational, Withdrawn
Anthrax immune globulin human	The therapeutic efficacy of Anthrax immune globulin human can be decreased when used in combination with Nivolumab.	Approved
Bacillus calmette-guerin substrain connaught live antigen	The therapeutic efficacy of Bacillus calmette-guerin substrain connaught live antigen can be decreased when used in combination with Nivolumab.	Approved, Investigational
Bacillus calmette-guerin substrain tice live antigen	The therapeutic efficacy of Bacillus calmette-guerin substrain tice live antigen can be decreased when used in combination with Nivolumab.	Approved
BCG vaccine	The therapeutic efficacy of BCG vaccine can be decreased when used in combination with Nivolumab.	Investigational
Belimumab	The risk or severity of adverse effects can be increased when Nivolumab is combined with Belimumab.	Approved
Bevacizumab	Bevacizumab may increase the cardiotoxic activities of Nivolumab.	Approved, Investigational
Cabazitaxel	The risk or severity of adverse effects can be increased when Cabazitaxel is combined with Nivolumab.	Approved
Clostridium tetani toxoid antigen (formaldehyde inactivated)	The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Nivolumab.	Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)	The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Nivolumab.	Approved
Cyclophosphamide	Cyclophosphamide may increase the cardiotoxic activities of Nivolumab.	Approved, Investigational
Cymarin	Cymarin may decrease the cardiotoxic activities of Nivolumab.	Experimental
Deslanoside	Deslanoside may decrease the cardiotoxic activities of Nivolumab.	Approved
Digitoxin	Digitoxin may decrease the cardiotoxic activities of Nivolumab.	Approved, Investigational
Digoxin	Digoxin may decrease the cardiotoxic activities of Nivolumab.	Approved
Digoxin Immune Fab (Ovine)	Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nivolumab.	Approved
Docetaxel	The risk or severity of adverse effects can be increased when Docetaxel is combined with Nivolumab.	Approved, Investigational
G17DT	The therapeutic efficacy of G17DT can be decreased when used in combination with Nivolumab.	Investigational
GI-5005	The therapeutic efficacy of GI-5005 can be decreased when used in combination with Nivolumab.	Investigational
Gitoformate	Gitoformate may decrease the cardiotoxic activities of Nivolumab.	Experimental
Hepatitis A Vaccine	The therapeutic efficacy of Hepatitis A Vaccine can be decreased when used in combination with Nivolumab.	Approved
Hepatitis B Vaccine (Recombinant)	The therapeutic efficacy of Hepatitis B Vaccine (Recombinant) can be decreased when used in combination with Nivolumab.	Approved, Withdrawn
Human rabies virus immune globulin	The therapeutic efficacy of Human rabies virus immune globulin can be decreased when used in combination with Nivolumab.	Approved
INGN 201	The therapeutic efficacy of INGN 201 can be decreased when used in combination with Nivolumab.	Investigational
INGN 225	The therapeutic efficacy of INGN 225 can be decreased when used in combination with Nivolumab.	Investigational
Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated)	The therapeutic efficacy of Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated) can be decreased when used in combination with Nivolumab.	Approved
Lanatoside C	Lanatoside C may decrease the cardiotoxic activities of Nivolumab.	Experimental
Metildigoxin	Metildigoxin may decrease the cardiotoxic activities of Nivolumab.	Experimental
Oleandrin	Oleandrin may decrease the cardiotoxic activities of Nivolumab.	Experimental, Investigational
Ouabain	Ouabain may decrease the cardiotoxic activities of Nivolumab.	Approved
Paclitaxel	The risk or severity of adverse effects can be increased when Paclitaxel is combined with Nivolumab.	Approved, Vet Approved
Peruvoside	Peruvoside may decrease the cardiotoxic activities of Nivolumab.	Experimental
Proscillaridin	Proscillaridin may decrease the cardiotoxic activities of Nivolumab.	Experimental
Rabies virus inactivated antigen, A	The therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Nivolumab.	Approved, Investigational
Rindopepimut	The therapeutic efficacy of Rindopepimut can be decreased when used in combination with Nivolumab.	Investigational
Rotavirus Vaccine	The therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Nivolumab.	Approved
Rubella virus vaccine	The therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Nivolumab.	Approved, Investigational
Salmonella typhi ty2 vi polysaccharide antigen	The therapeutic efficacy of Salmonella typhi ty2 vi polysaccharide antigen can be decreased when used in combination with Nivolumab.	Approved
Salmonella typhi ty21a live antigen	The therapeutic efficacy of Salmonella typhi ty21a live antigen can be decreased when used in combination with Nivolumab.	Approved
SRP 299	The therapeutic efficacy of SRP 299 can be decreased when used in combination with Nivolumab.	Investigational
Tecemotide	The therapeutic efficacy of Tecemotide can be decreased when used in combination with Nivolumab.	Investigational
TG4010	The therapeutic efficacy of TG4010 can be decreased when used in combination with Nivolumab.	Investigational
Trastuzumab	Trastuzumab may increase the cardiotoxic activities of Nivolumab.	Approved, Investigational
Varicella Zoster Vaccine (Live/Attenuated)	The therapeutic efficacy of Varicella Zoster Vaccine (Live/Attenuated) can be decreased when used in combination with Nivolumab.	Approved
Yellow Fever Vaccine	The therapeutic efficacy of Yellow Fever Vaccine can be decreased when used in combination with Nivolumab.	Approved, Investigational

Food Interactions

Not Available

References

General References

1. Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116]
2. Tsai KK, Zarzoso I, Daud AI: PD-1 and PD-L1 antibodies for melanoma. Hum Vaccin Immunother. 2014;10(11):3111-6. doi: 10.4161/21645515.2014.983409. [PubMed:25625924]
3. Topalian SL, Sznol M, McDermott DF, Kluger HM, Carvajal RD, Sharfman WH, Brahmer JR, Lawrence DP, Atkins MB, Powderly JD, Leming PD, Lipson EJ, Puzanov I, Smith DC, Taube JM, Wigginton JM, Kollia GD, Gupta A, Pardoll DM, Sosman JA, Hodi FS: Survival, durable tumor remission, and long-term safety in patients with advanced melanoma receiving nivolumab. J Clin Oncol. 2014 Apr 1;32(10):1020-30. doi: 10.1200/JCO.2013.53.0105. Epub 2014 Mar 3. [PubMed:24590637]

External Links

KEGG Drug

D10316

PubChem Substance

347910393

ChEMBL

CHEMBL2108738

RxList

RxList Drug Page

Drugs.com

Drugs.com Drug Page

Wikipedia

Nivolumab

ATC Codes

L01XC17 — Nivolumab

• L01XC — Monoclonal antibodies
• L01X — OTHER ANTINEOPLASTIC AGENTS
• L01 — ANTINEOPLASTIC AGENTS
• L — ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS

AHFS Codes

• 10:00.00 — Antineoplastic Agents

FDA label

Download (315 KB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Active Not Recruiting	Treatment	Renal Cancers	1
0	Not Yet Recruiting	Treatment	Human Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS) / Immunosuppression / Kaposi s Sarcoma (KS)	1
0	Not Yet Recruiting	Treatment	Lymphoma, Large B-Cell, Diffuse (DLBCL)	1
0	Not Yet Recruiting	Treatment	Sarcomas	1
0	Recruiting	Basic Science	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
0	Recruiting	Treatment	Larynx / Lip, Oral Cavity and Pharynx	2
0	Recruiting	Treatment	Liver Cancer	1
0	Recruiting	Treatment	Melanoma (Skin) / Skin Cancers	1
0	Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
1	Active Not Recruiting	Basic Science	Advanced Melanoma / Metastatic Melanoma	1
1	Active Not Recruiting	Basic Science	Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Advanced Solid Tumors, Including But Not Limited to Lung Cancer / Cancer of the Ovary / Colorectal Cancers / Glioblastoma Multiforme (GBM) / Head and Neck Carcinoma / Head and Neck Squamous Cell Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Gliomas / Malignant Neoplasm of Pancreas / Melanoma / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Astrocytomas / Glioblastomas / Malignant Gliomas	1
1	Active Not Recruiting	Treatment	B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Refractory Adult Acute Lymphoblastic Leukemia / Refractory Childhood Acute Lymphoblastic Leukemia	1
1	Active Not Recruiting	Treatment	Cancer of the Ovary / Cancer, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Prostate Cancer / Renal Cell Adenocarcinoma / Tumors, Solid	1
1	Active Not Recruiting	Treatment	Cancer of the Ovary / Fallopian Tubes / Primary Peritoneal Cancer / Recurrent Ovarian Cancer	1
1	Active Not Recruiting	Treatment	Cancer, Advanced	1
1	Active Not Recruiting	Treatment	Chronic Myeloid Leukemia (CML)	1
1	Active Not Recruiting	Treatment	CcRCC / Clear Cell Renal Cell Carcinoma / RCC / Renal Cancers / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Glioblastomas / Gliosarcoma / Supratentorial Glioblastoma	1
1	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
1	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Castration-resistant Prostrate Cancer / Metastatic Castration-resistant Prostrate Cancer (mCRPC) / Metastatic Melanoma / Metastatic Melanoma (MEL) / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Lymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
1	Active Not Recruiting	Treatment	Malignant Lymphomas / Malignant Solid Tumours	1
1	Active Not Recruiting	Treatment	Malignant Melanoma	1
1	Active Not Recruiting	Treatment	Melanoma (Skin)	2
1	Active Not Recruiting	Treatment	Neoplasms, Breast / Neoplasms, Pancreatic	1
1	Active Not Recruiting	Treatment	Tumors, Solid	1
1	Completed	Other	Severe Sepsis	1
1	Completed	Treatment	Advanced Solid Tumors / Recurrent Solid Tumors	1
1	Completed	Treatment	Colorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma / Prostate Cancer / Renal Cancers	1
1	Completed	Treatment	Malignant Melanoma	1
1	Completed	Treatment	Malignant Solid Tumours	1
1	Completed	Treatment	Neoplasms by Site	1
1	Not Yet Recruiting	Health Services Research	Glioblastomas	1
1	Not Yet Recruiting	Treatment	Blasts 30 Percent or Less of Bone Marrow Nucleated Cells / Chronic Myelomonocytic Leukemia / High Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Refractory Anemia	1
1	Not Yet Recruiting	Treatment	Breast Adenocarcinoma / Recurrent Breast Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Mycosis Fungoides / Recurrent Non-Hodgkin Lymphoma / Recurrent Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Mycosis Fungoides / Refractory Nodal Marginal Zone Lymphoma / Refractory Non-Hodgkin's lymphoma / Refractory Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Breast Cancer AJCC v6 and v7	1
1	Not Yet Recruiting	Treatment	Cancer, Advanced	1
1	Not Yet Recruiting	Treatment	Follicular Lymphoma (FL)	1
1	Not Yet Recruiting	Treatment	Leptomeningeal Disease / Melanoma and Other Malignant Neoplasms of Skin	1
1	Not Yet Recruiting	Treatment	Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
1	Not Yet Recruiting	Treatment	Neuroblastomas	1
1	Not Yet Recruiting	Treatment	Newly Diagnosed Glioblastoma	1
1	Recruiting	Basic Science	Soft Tissue Sarcoma Adult	1
1	Recruiting	Other	Glioblastomas	1
1	Recruiting	Other	Melanoma	1
1	Recruiting	Treatment	ALK-positive NSCLC	1
1	Recruiting	Treatment	Acute Myeloid Leukemia and Myelodysplastic Syndrome	1
1	Recruiting	Treatment	Adenocarcinoma of the Pancreas / Colon Carcinoma Metastatic in the Liver / Colorectal Adenocarcinoma / Resectable Pancreatic Carcinoma / Stage I Pancreatic Cancer / Stage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage II Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer	1
1	Recruiting	Treatment	Adenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma	1
1	Recruiting	Treatment	Adenocarcinomas / Advanced NSCLC / Carcinoma, Adenosquamous / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Squamous Cell Carcinoma (SCC)	1
1	Recruiting	Treatment	Adrenocortical Carcinoma (Part G) / Advanced Solid Tumors (Part A/B/C/D) / Melanoma (Part E) / Mesothelioma (Part G) / Non-small Cell Lung Cancer (NSCLC) and Melanoma (Part E) / Non-small Cell Lung Cancer (Part E) / Squamous Cell Cancer of the Head and Neck (Part E) / Triple Negative Breast Cancer (Part F)	1
1	Recruiting	Treatment	Adult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Recurrent Classical Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Adult Solid Neoplasm / Childhood Solid Neoplasm / Neoplasms, Metastatic	1
1	Recruiting	Treatment	Advanced Cancers	1
1	Recruiting	Treatment	Advanced Malignancies	1
1	Recruiting	Treatment	Advanced Solid Tumors	3
1	Recruiting	Treatment	Advanced Solid Tumors / Cancers	1
1	Recruiting	Treatment	Advanced Solid Tumors / Head and Neck Carcinoma, Squamous Cell / Lung Cancer Non-Small Cell Cancer (NSCLC) / Triple-Negative Breast Neoplasms	1
1	Recruiting	Treatment	Advanced or Metastatic Solid Tumors	2
1	Recruiting	Treatment	Aggressive Non-Hodgkin Lymphoma / Neoplasms, Advanced Solid / Recurrent Solid Neoplasm / Refractory Mantle Cell Lymphoma / T-Cell Non-Hodgkin Lymphoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1	1
1	Recruiting	Treatment	BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
1	Recruiting	Treatment	Bladder Cancers	1
1	Recruiting	Treatment	Bladder Carcinoma / Colorectal Cancers / Salivary Gland Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1	Recruiting	Treatment	Bladder Tumors / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Melanoma / Melanoma / Skin Cancers / Transitional Cell Carcinoma of the Bladder / Urinary Bladder Cancer	1
1	Recruiting	Treatment	Breast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Cancer, Advanced	2
1	Recruiting	Treatment	Cancers	3
1	Recruiting	Treatment	Chordomas	1
1	Recruiting	Treatment	Classical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
1	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma	1
1	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Solid Neoplasms / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma / Stage III Bladder Adenocarcinoma AJCC v6 and v7 / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Penile Cancer / Stage III Penile Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer / Stage III Urethral Cancer AJCC v7 / Stage IIIa Penile Cancer / Stage IIIa Penile Cancer AJCC v7 / Stage IIIb Penile Cancer / Stage IIIb Penile Cancer AJCC v7 / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Adenocarcinoma AJCC v7 / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Squamous Cell Carcinoma AJCC v7 / Stage IV Bladder Urothelial Carcinoma / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Penile Cancer / Stage IV Penile Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer / Stage IV Urethral Cancer AJCC v7 / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma	1
1	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Stage I Renal Cell Cancer / Stage I Renal Cell Cancer AJCC v6 and v7 / Stage II Renal Cell Cancer / Stage II Renal Cell Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7	1
1	Recruiting	Treatment	EBV Related Hodgkin's Lymphoma / EBV Related Lymphoma / EBV Related Non-Hodgkin's Lymphoma / EBV-Related PTLD / Lymphoma, Hodgkins / Lymphoproliferative Disorders / NonHodgkin Lymphoma	1
1	Recruiting	Treatment	Esophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Stomach	1
1	Recruiting	Treatment	Esophageal Cancers / Lung Cancers / Malignant Neoplasm of Stomach / Renal Cancers	1
1	Recruiting	Treatment	Fallopian Tubes / High Grade Serous Ovarian / Primary Peritoneal Cancer	1
1	Recruiting	Treatment	Follicular Lymphoma (FL)	1
1	Recruiting	Treatment	Glioblastomas	2
1	Recruiting	Treatment	Glioblastomas / Gliosarcoma / Recurrent Brain Neoplasm	1
1	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms / Renal Cell Adenocarcinoma / Urothelial Neoplasm	1
1	Recruiting	Treatment	Hematopoietic Cell Transplantation Recipient / Myelodysplastic Syndrome / Myeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Lymphocytic Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma	1
1	Recruiting	Treatment	Hepatocellular,Carcinoma	3
1	Recruiting	Treatment	Human Papillomavirus Positive Anal Carcinoma / Human Papillomavirus Positive Cervical Carcinoma / Human Papillomavirus Positive Oropharyngeal Carcinoma / Human Papillomavirus Positive Penile Carcinoma / Human Papillomavirus Positive Vulvar Carcinoma / Human Papillomavirus-Related Carcinoma	1
1	Recruiting	Treatment	Locally Advanced Hepatocellular Carcinoma	1
1	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
1	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC)	1
1	Recruiting	Treatment	Lymphoma, Hodgkins	1
1	Recruiting	Treatment	Malignancies, Hematologic	1
1	Recruiting	Treatment	Malignant Lymphomas / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Metastatic Renal Cell Cancer / Recurrent Bladder Carcinoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Renal Cell Carcinoma Recurrent / Stage III Bladder Cancer / Stage III Lymphoma / Stage III Non-Small Cell Lung Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Bladder Cancer / Stage IV Lymphoma / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Bladder Cancer / Stage IVB Bladder Cancer / Stages III Skin Melanoma / Unresectable Head and Neck Squamous Cell Carcinoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Melanoma	2
1	Recruiting	Treatment	Metastatic Colorectal Cancers	1
1	Recruiting	Treatment	Metastatic Malignant Neoplasm in the Brain / Metastatic Malignant Neoplasm in the Spine / Stage IV Skin Melanoma	1
1	Recruiting	Treatment	Metastatic Melanoma	1
1	Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
1	Recruiting	Treatment	Metastatic Solid Tumors / Treatment-Refractory Cancers	1
1	Recruiting	Treatment	Multiple Myeloma (MM)	1
1	Recruiting	Treatment	Neoplasms Malignant	1
1	Recruiting	Treatment	Neoplasms, Malignant	1
1	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1	Recruiting	Treatment	Stage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma	1
1	Recruiting	Treatment	Stage IV Small Cell Lung Cancer	1
1	Recruiting	Treatment	Transitional Cell Carcinoma	1
1	Recruiting	Treatment	Tumors, Solid	1
1	Suspended	Treatment	Malignant Gliomas	1
1	Terminated	Basic Science	Neoplasms, Colorectal	1
1	Unknown Status	Treatment	Advanced Solid Tumors / Recurrent Solid Tumors	1
1	Withdrawn	Treatment	Malignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)	1
1	Withdrawn	Treatment	Metastatic Melanoma	1
1, 2	Active Not Recruiting	Treatment	Advanced or Metastatic Solid Tumors	1
1, 2	Active Not Recruiting	Treatment	CANCER,NOS	1
1, 2	Active Not Recruiting	Treatment	Cancer, Advanced	1
1, 2	Active Not Recruiting	Treatment	Cancer, Advanced / Hepatocellular,Carcinoma	1
1, 2	Active Not Recruiting	Treatment	Clear Cell Renal Cell Carcinoma	1
1, 2	Active Not Recruiting	Treatment	Colorectal Cancer (CRC) / Colorectal Cancer (CRC)-Enrollment Completed / Glioblastoma (GBM) (Phase ll Only) / Glioblastoma (GBM) (Phase ll Only)-Enrollment Completed / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma of Head and Neck / Malignant Neoplasm of Colon / Melanoma / Ovarian Carcinoma / Ovarian Carcinoma-Enrollment Completed / Renal Cell Carcinoma (RCC) (Phase ll Only) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1, 2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1, 2	Active Not Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC)	1
1, 2	Active Not Recruiting	Treatment	Lymphoma, Hodgkins	1
1, 2	Active Not Recruiting	Treatment	Metastatic Cancers	1
1, 2	Active Not Recruiting	Treatment	Neoplasms, Hematologic	1
1, 2	Active Not Recruiting	Treatment	Tumors, Solid	1
1, 2	Not Yet Recruiting	Treatment	Adenocarcinoma of the Lung / Lung Cancers	1
1, 2	Not Yet Recruiting	Treatment	Advanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage III Uveal Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm	1
1, 2	Not Yet Recruiting	Treatment	Antibodies, Neoplasm	1
1, 2	Not Yet Recruiting	Treatment	Cancer, Advanced	1
1, 2	Not Yet Recruiting	Treatment	Chondrosarcomas / Ewing's Sarcoma (ES) / Liposarcoma / Sarcoma, Osteogenic / Undifferentiated Pleomorphic Sarcoma	1
1, 2	Not Yet Recruiting	Treatment	Colorectal Cancers	1
1, 2	Not Yet Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1, 2	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1, 2	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Stage II / Non-small Cell Lung Cancer Stage I	1
1, 2	Not Yet Recruiting	Treatment	Melanoma	2
1, 2	Not Yet Recruiting	Treatment	Pancreatic Ductal Adenocarcinoma	1
1, 2	Recruiting	Prevention	Stage IIIC Skin Melanoma / Stage IV Skin Melanoma	1
1, 2	Recruiting	Treatment	ALK Gene Mutation / EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
1, 2	Recruiting	Treatment	ALK Gene Translocation / EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Translocation / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7	1
1, 2	Recruiting	Treatment	Adenocarcinoma of the Lung	1
1, 2	Recruiting	Treatment	Adenocarcinoma of the Pancreas	1
1, 2	Recruiting	Treatment	Advanced B-cell NHL / Advanced Solid Tumors	1
1, 2	Recruiting	Treatment	Advanced Malignancies / Clear Cell Renal Cell Carcinoma / Renal Cancers / Select Advanced Malignancies	1
1, 2	Recruiting	Treatment	Advanced Malignancies / Metastatic Malignancy	1
1, 2	Recruiting	Treatment	Advanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma	1
1, 2	Recruiting	Treatment	Advanced Tumors / Multiple Indications Cancer	1
1, 2	Recruiting	Treatment	Advanced and Metastatic Solid Tumor	1
1, 2	Recruiting	Treatment	Advanced or Metastatic Malignancies	1
1, 2	Recruiting	Treatment	Advanced or Metastatic Solid Tumors	1
1, 2	Recruiting	Treatment	B Cell NHL Including DLBCL / Cancer of the Ovary / Carcinoma, Squamous Cell of Head and Neck / CRC (Colorectal Cancer) / Glioblastomas / HL / HNSCC (Head and Neck Squamous Cell Cancer / Hodgkin Lymphona (B-cell Malignancies) / I/O naïve Melanoma (MEL) / I/O Refractory MEL / I/O Relapsed MEL / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms, Colorectal / Neoplasms, Ovarian	1
1, 2	Recruiting	Treatment	Biallelic Mismatch Repair Deficiency (bMMRD) Positive Patients / Refractory or Recurrent Hypermutated Malignancies	1
1, 2	Recruiting	Treatment	Broad Solid Tumor	1
1, 2	Recruiting	Treatment	Cancer of Rectum	1
1, 2	Recruiting	Treatment	Cancer of the Ovary / Colorectal Cancers / Melanoma / Neuroendocrine Carcinoma of the Skin / Renal Cell Adenocarcinoma / Sarcomas / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)	1
1, 2	Recruiting	Treatment	Cancer, Advanced	5
1, 2	Recruiting	Treatment	Cancer, Advanced / Carcinoma, Colorectal / Endometrial / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Renal Cell Adenocarcinoma / Uterine	1
1, 2	Recruiting	Treatment	Cancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma	1
1, 2	Recruiting	Treatment	Cancer, Breast / Triple-Negative Breast Cancer (TNBC)	1
1, 2	Recruiting	Treatment	Cancers	7
1, 2	Recruiting	Treatment	Cancers / Carcinoma NOS / HCC / Hepatocellular,Carcinoma / Tumors, Solid	1
1, 2	Recruiting	Treatment	Cancers / Malignancies / Neoplasms / Tumors	1
1, 2	Recruiting	Treatment	Cancers / Melanoma / Metastatic Melanoma / Neoplasm of Lung / Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Carcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal	1
1, 2	Recruiting	Treatment	Carcinoma，Non-Small-Cell Lung / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)	1
1, 2	Recruiting	Treatment	Cervical Cancers / Locally Advanced Cervical Cancer	1
1, 2	Recruiting	Treatment	Childhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Non-Hodgkin's lymphoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
1, 2	Recruiting	Treatment	Children, Adolescents and Young Adults With Refractory or Recurrent Malignancies	1
1, 2	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma	1
1, 2	Recruiting	Treatment	Colorectal Cancers / Malignant Neoplasm of Pancreas	1
1, 2	Recruiting	Treatment	EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
1, 2	Recruiting	Treatment	Extensive-Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)	1
1, 2	Recruiting	Treatment	Gastroesophageal Junction Region (GEJ) Cancer / Malignant Neoplasm of Stomach	1
1, 2	Recruiting	Treatment	Glioblastomas / Hepatocellular Carcinoma Recurrent / Non-Small Cell Lung Cancer Recurrent / Tumors, Solid	1
1, 2	Recruiting	Treatment	Grade 3a Follicular Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma	1
1, 2	Recruiting	Treatment	Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1, 2	Recruiting	Treatment	Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / Squamous Cell Cancer / Squamous Cell Carcinoma of the Hypopharynx / Squamous Cell Carcinoma of the Larynx / Squamous Cell Carcinoma of the Oral Cavity / Squamous Cell Carcinoma of the Oropharynx / Squamous Cell Carcinoma of the Paranasal Sinus	1
1, 2	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1, 2	Recruiting	Treatment	Hepatic Metastases / Uveal Melanoma	1
1, 2	Recruiting	Treatment	Hepatocellular Carcinoma (HCC)	1
1, 2	Recruiting	Treatment	Hepatocellular,Carcinoma	2
1, 2	Recruiting	Treatment	Immunotherapy / Neoplasms, Head and Neck	1
1, 2	Recruiting	Treatment	Leukemia Acute Myeloid Leukemia (AML) / Leukemias / Myelodysplastic Syndrome	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Tumors, Solid	1
1, 2	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC) / Small Cell Lung Cancer Extensive Stage	1
1, 2	Recruiting	Treatment	Lymphoma, Hodgkins	2
1, 2	Recruiting	Treatment	Lymphoma, Large B-Cell, Diffuse (DLBCL)	1
1, 2	Recruiting	Treatment	MSS / RAS-mutant Colorectal Cancer	1
1, 2	Recruiting	Treatment	Malignant Lymphomas / Multiple Myeloma (MM)	1
1, 2	Recruiting	Treatment	Malignant Neoplasm of Pancreas	1
1, 2	Recruiting	Treatment	Malignant Neoplasms of Urinary Tract / Other Disorders of Kidney and Ureter / Renal Cell Adenocarcinoma	1
1, 2	Recruiting	Treatment	Malignant Solid Tumours	2
1, 2	Recruiting	Treatment	Melanoma	1
1, 2	Recruiting	Treatment	Melanoma / Melanoma Stage Iii / Melanoma Stage Iv	1
1, 2	Recruiting	Treatment	Melanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma	1
1, 2	Recruiting	Treatment	Metastatic Brain Cancer	1
1, 2	Recruiting	Treatment	Metastatic Melanoma	1
1, 2	Recruiting	Treatment	Metastatic Melanoma / Stage III Melanoma / Stage IV Melanoma	1
1, 2	Recruiting	Treatment	Metastatic Renal Cell Cancer / Stage IV Renal Cell Cancer	1
1, 2	Recruiting	Treatment	Metastatic or Advanced Non-Small Cell Lung Cancer (NSCLC)	1
1, 2	Recruiting	Treatment	Multiple Myeloma (MM)	1
1, 2	Recruiting	Treatment	Myelodysplastic Syndromes	1
1, 2	Recruiting	Treatment	Neoplasms by Site	1
1, 2	Recruiting	Treatment	Neoplasms, Hematologic	1
1, 2	Recruiting	Treatment	Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Non-Hodgkin's Disease	1
1, 2	Recruiting	Treatment	Ovarian Cancer Metastatic	1
1, 2	Recruiting	Treatment	Ovarian Epithelial Cancer	1
1, 2	Recruiting	Treatment	Pancreatic Adenocarcinoma Metastatic	1
1, 2	Recruiting	Treatment	Prostate Cancer	1
1, 2	Recruiting	Treatment	Refractory Diffuse Large B-Cell Lymphoma / Relapsed Diffuse Large B-Cell Lymphoma	1
1, 2	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
1, 2	Recruiting	Treatment	Sarcoma, Bone / Soft Tissue Sarcoma (STS)	1
1, 2	Recruiting	Treatment	Sarcomas / Solid Tumor, Adult / Solid Tumor, Childhood	1
1, 2	Recruiting	Treatment	Squamous Cell Carcinoma of Esophagus	1
1, 2	Recruiting	Treatment	Stage III/IV Melanoma	1
1, 2	Recruiting	Treatment	Various Advanced Cancer	1
1, 2	Terminated	Other	Tumors, Solid	1
1, 2	Withdrawn	Treatment	Squamous Non-Small Cell Lung Cancer	1
2	Active Not Recruiting	Other	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Active Not Recruiting	Treatment	Acute Adult T-Cell Leukemia/Lymphoma / Adult T-Cell Leukemia/Lymphoma / CD3 Positive / CD4-Positive Neoplastic Cells Present / Chronic Adult T-Cell Leukemia/Lymphoma / HTLV-1 Infection / Hypercalcemia / Lymphomatous Adult T-Cell Leukemia/Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Smoldering Adult T-Cell Leukemia/Lymphoma	1
2	Active Not Recruiting	Treatment	Adenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Stage IV Cervical Cancer / Stage IV Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v7	1
2	Active Not Recruiting	Treatment	Adenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma	1
2	Active Not Recruiting	Treatment	Advanced Non-Small Cell Lung Cancer	2
2	Active Not Recruiting	Treatment	Advanced or Metastatic Melanoma	1
2	Active Not Recruiting	Treatment	Anal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Recurrent Anal Canal Carcinoma / Stage IV Anal Canal Cancer	1
2	Active Not Recruiting	Treatment	Head and Neck Carcinoma	1
2	Active Not Recruiting	Treatment	Hodgkins Disease (HD)	1
2	Active Not Recruiting	Treatment	Leukemias	1
2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Metastatic Lung Cancer	1
2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Non Small Cell Lung Cancer Recurrent / Non-Small Cell Carcinoma of Lung, TNM Stage 4 / Non-Small-Cell Lung Cancer Metastatic	1
2	Active Not Recruiting	Treatment	Malignant Lymphomas	1
2	Active Not Recruiting	Treatment	Malignant Pleural Mesothelioma (MPM)	1
2	Active Not Recruiting	Treatment	Melanoma	3
2	Active Not Recruiting	Treatment	Melanoma / Metastatic Brain Tumors	1
2	Active Not Recruiting	Treatment	Melanoma / Oligometastatic Melanoma	1
2	Active Not Recruiting	Treatment	Mesothelioma	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Unresectable Melanoma	1
2	Active Not Recruiting	Treatment	Multiple Myeloma (MM)	1
2	Active Not Recruiting	Treatment	Myeloproliferative Disorders	1
2	Active Not Recruiting	Treatment	Nasopharyngeal Nonkeratinizing Carcinoma / Recurrent Nasopharyngeal Undifferentiated Carcinoma / Recurrent Nasopharynx Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Nasopharyngeal Undifferentiated Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Nasopharyngeal Undifferentiated Carcinoma / Stage IVA Nasopharyngeal Carcinoma / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma / Stage IVC Nasopharyngeal Carcinoma AJCC v7	1
2	Active Not Recruiting	Treatment	Non-Hodgkin's Lymphoma (NHL)	1
2	Active Not Recruiting	Treatment	Previously Treated Metastatic Adenocarcinoma of the Pancreas	1
2	Active Not Recruiting	Treatment	Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma	1
2	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	2
2	Active Not Recruiting	Treatment	Squamous Cell Non-small Cell Lung Cancer	1
2	Active Not Recruiting	Treatment	Tumors, Solid	1
2	Active Not Recruiting	Treatment	Uveal Melanoma	1
2	Active Not Recruiting	Treatment	Various Advanced Cancer	1
2	Active Not Recruiting	Treatment	Refractory, metastatic Colorectal cancer	1
2	Completed	Treatment	Glioblastoma Multiforme (GBM)	1
2	Completed	Treatment	Malignant Pleural Mesothelioma (MPM)	1
2	Enrolling by Invitation	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Carcinoma	1
2	Not Yet Recruiting	Treatment	Advanced Solid Tumors	1
2	Not Yet Recruiting	Treatment	Bronchial dysplasia / History of Head and Neck Cancer / History of Non-Small Cell Lung Cancer / Tobacco Smoking	1
2	Not Yet Recruiting	Treatment	Cancer of the Ovary / Clear Cell Adenocarcinoma / Extra Renal Origin / Fallopian Tube Cancer / Primary Peritoneal Carcinoma	1
2	Not Yet Recruiting	Treatment	Carcinoid Tumors / Neuroendocrine Tumors	1
2	Not Yet Recruiting	Treatment	Cervical Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oesophageal Carcinoma / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma	1
2	Not Yet Recruiting	Treatment	Chondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)	1
2	Not Yet Recruiting	Treatment	Classic Kaposi Sarcoma	1
2	Not Yet Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
2	Not Yet Recruiting	Treatment	Colorectal neoplasms malignant	1
2	Not Yet Recruiting	Treatment	Epstein-Barr Virus Infections / Malignant Lymphomas	1
2	Not Yet Recruiting	Treatment	Extensive Stage Small Cell Lung Carcinoma	1
2	Not Yet Recruiting	Treatment	Eye and Orbit	1
2	Not Yet Recruiting	Treatment	Gastric and Esophagogastric Junction Adenocarcinoma	1
2	Not Yet Recruiting	Treatment	Giant Cell Glioblastoma / Gliosarcoma / Oligodendrogliomas / Recurrent Glioblastoma / Small Cell Glioblastoma	1
2	Not Yet Recruiting	Treatment	Glioblastomas	1
2	Not Yet Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
2	Not Yet Recruiting	Treatment	Higher Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML)	1
2	Not Yet Recruiting	Treatment	Inoperable œsophageal Cancer	1
2	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	3
2	Not Yet Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers / Relapsed Small cell lung cancer	1
2	Not Yet Recruiting	Treatment	Lymphoma, Hodgkins	2
2	Not Yet Recruiting	Treatment	Melanoma Stage Iv	1
2	Not Yet Recruiting	Treatment	Melanoma / Metastatic Melanoma	1
2	Not Yet Recruiting	Treatment	Metastatic Urothelial Cancer	1
2	Not Yet Recruiting	Treatment	Multiple Myeloma (MM)	1
2	Not Yet Recruiting	Treatment	Nasopharyngeal Carcinoma	1
2	Not Yet Recruiting	Treatment	Prostate Cancer	1
2	Not Yet Recruiting	Treatment	Recurrent Glioblastoma	1
2	Not Yet Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer	1
2	Not Yet Recruiting	Treatment	Recurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma	1
2	Not Yet Recruiting	Treatment	Soft Tissue Sarcoma (STS)	1
2	Not Yet Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
2	Not Yet Recruiting	Treatment	Stage I Hodgkin Lymphoma / Stage IA Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma	1
2	Not Yet Recruiting	Treatment	Stage II Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage IV Bladder Urothelial Carcinoma AJCC v7	1
2	Not Yet Recruiting	Treatment	Stage IV Melanoma / Unresectable Stage III Melanoma	1
2	Not Yet Recruiting	Treatment	Thymic Carcinoma / Thymoma Type B3 / Type B3 Thymoma and Thymic Carcinoma	1
2	Not Yet Recruiting	Treatment	Various Advanced Cancer	1
2	Recruiting	Diagnostic	Brain Metastasis / Melanoma	1
2	Recruiting	Treatment	Activated B-Cell-Like Diffuse Large B-Cell Lymphoma / ALK-Positive Large B-Cell Lymphoma / Atypical Burkitt/Burkitt-Like Lymphoma / Burkitt-Like Lymphoma With 11q Aberration / Diffuse Large B-Cell Lymphoma Activated B-Cell Type / Diffuse Large B-Cell Lymphoma Associated With Chronic Inflammation / Diffuse Large B-Cell Lymphoma Germinal Center B-Cell Type / Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Mucocutaneous Ulcer / Epstein-Barr Virus Positive Diffuse Large B-Cell Lymphoma of the Elderly / Epstein-Barr Virus-Positive Mucocutaneous Ulcer / Epstein-Barr Virus-Positive Neoplastic Cells Present / Germinal Center B-Cell-Like Diffuse Large B-Cell Lymphoma / High-Grade B-Cell Lymphoma With MYC and BCL2 and/or BCL6 Rearrangements / High-Grade B-Cell Lymphoma With MYC, BCL2, and BCL6 Rearrangements / Human Herpes Virus 8-Related Malignant Neoplasm / Human Herpesvirus 8-Positive Neoplastic Cells Present / Human Herpesvirus-8-Positive Neoplastic Cells Present / Intravascular Large B-Cell Lymphoma / Large B-Cell Lymphoma With IRF4 Rearrangement / MYC-Negative B-Cell Lymphoma With 11q Aberration Resembling Burkitt Lymphoma / Plasmablastic Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma, Leg Type / Primary Diffuse Large B-Cell Lymphoma of the Central Nervous System / Primary Effusion Lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classical Hodgkin Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Lymphomatoid Granulomatosis / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classical Hodgkin Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Skin Ulcers / Small Intestinal B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Burkitt Lymphoma / Small Intestinal High Grade B-Cell Lymphoma, Not Otherwise Specified / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma	1
2	Recruiting	Treatment	Acinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Carcinoma, Adenoid Cystic / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Desmoid-Type Fibromatosis / Endometrial Adenocarcinomas / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Gastrointestinal Stromal Tumors / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metaplastic breast carcinoma / Metastatic Malignant Neoplasm of Unknown Primary Origin / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Rare Disorder / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Carcinoma / Vulvar Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Acute myeloid leukaemia (in remission) / Adult Acute Myeloid Leukemia in Remission	1
2	Recruiting	Treatment	Adenocarcinoma of the Lung / Lung Cancers / Non-Squamous Non-Small Cell Lung Cancer (NSCLC)	1
2	Recruiting	Treatment	Adenocarcinoma of the Pancreas	1
2	Recruiting	Treatment	Adenocarcinoma of the Stomach / Esophageal Cancers / Gastrooesophageal Cancer / HER2 Positive Gastric Cancer / Malignant Neoplasm of Stomach / Metastatic Gastric Cancers	1
2	Recruiting	Treatment	Adenocarcinomas	1
2	Recruiting	Treatment	Adnexal Carcinoma / Apocrine Carcinoma / Carcinoma, Adenoid Cystic / Eccrine Porocarcinoma / Extraocular Cutaneous Sebaceous Carcinoma / Hidradenocarcinoma / Keratoacanthoma / Malignant sweat gland neoplasm / Microcystic Adnexal Carcinoma / Neuroendocrine Carcinoma of the Skin / NK-Cell Lymphoma, Unclassifiable / Non-Melanomatous Lesion / Paget's Disease / Papillary Adenocarcinoma / Primary Cutaneous Mucinous Carcinoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Refractory Mycosis Fungoides / Refractory Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory T-Cell Non-Hodgkin Lymphoma / Sezary Syndrome / Signet Ring Cell Carcinoma / Skin Basal Cell Carcinoma / Skin Basosquamous Cell Carcinoma / Skin Squamous Cell Carcinoma / Spiradenocarcinoma / Squamous Cell Carcinoma of Unknown Primary Origin / Stage III Skin Cancer / Stage IV Skin Cancer / Sweat Gland Carcinoma / Trichilemmocarcinoma / Vulvar Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Adrenocortical Carcinoma / Genitourinary Cancers / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell	1
2	Recruiting	Treatment	Adult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / CD30-Positive Neoplastic Cells Present / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Post-Transplant Lymphoproliferative Disorder / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Hodgkin Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Non-Hodgkin Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Refractory Hodgkin Lymphoma / Refractory Non-Hodgkin's lymphoma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)	1
2	Recruiting	Treatment	Advanced Gastric Cancer	1
2	Recruiting	Treatment	Advanced Malignant Neoplasm / Advanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Uterine Neoplasm / Melanoma / Oesophageal Carcinoma / Ovarian Carcinoma / Plasma Cell Myeloma / Prostate Cancer / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Solid Neoplasm / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Neoplasm / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Solid Neoplasms / Thyroid Gland Carcinoma / Uterine Corpus Cancer	1
2	Recruiting	Treatment	Advanced Non-Small Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers	1
2	Recruiting	Treatment	Advanced Pancreatic Cancer	1
2	Recruiting	Treatment	Advanced Renal Cell Carcinoma	1
2	Recruiting	Treatment	Advanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
2	Recruiting	Treatment	Advanced Stage Non-small Cell Lung Cancer	1
2	Recruiting	Treatment	Anal Basaloid Carcinoma / Anal Canal Cloacogenic Carcinoma / Anal Margin Squamous Cell Carcinoma / Stage II Anal Canal Cancer AJCC v6 and v7 / Stage IIB Anal Cancer AJCC v8 / Stage III Anal Canal Cancer AJCC v6 and v7 / Stage IIIA Anal Canal Cancer AJCC v6 and v7 / Stage IIIB Anal Canal Cancer AJCC v6 and v7	1
2	Recruiting	Treatment	Ann Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Ann Arbor Stage III Hodgkin Lymphoma / Ann Arbor Stage IIIA Hodgkin Lymphoma / Ann Arbor Stage IIIB Hodgkin Lymphoma / Ann Arbor Stage IV Hodgkin Lymphoma / Ann Arbor Stage IVA Hodgkin Lymphoma / Ann Arbor Stage IVB Hodgkin Lymphoma / Classical Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma / Stage III Hodgkin Lymphoma / Stage IIIA Hodgkin Lymphoma / Stage IIIB Hodgkin Lymphoma / Stage IV Hodgkin Lymphoma / Stage IVA Hodgkin Lymphoma / Stage IVB Hodgkin Lymphoma	1
2	Recruiting	Treatment	Biliary Tract Cancer / Biliary Tract Neoplasms	1
2	Recruiting	Treatment	Biliary Tract Neoplasms	1
2	Recruiting	Treatment	Bladder Cancers	1
2	Recruiting	Treatment	Bladder Cancers / Melanoma	1
2	Recruiting	Treatment	Bladder Cancers / Transitional Cell Carcinoma	1
2	Recruiting	Treatment	Blastic Plasmacytoid Dendritic Cell Neoplasm (BPDCN) / Hepatosplenic T-Cell Lymphoma / HTLV-1 Infection / NK-Cell Lymphoma, Unclassifiable / Primary Systemic Anaplastic Large Cell Lymphoma, ALK-Negative / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Angioimmunoblastic T-cell Lymphoma / Recurrent Enteropathy-Associated T-Cell Lymphoma / Recurrent Mycosis Fungoides / Refractory Adult T-Cell Leukemia/Lymphoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Angioimmunoblastic T-cell Lymphoma / Refractory Enteropathy-Associated T-Cell Lymphoma / Refractory Mycosis Fungoides / Refractory Nasal Type Extranodal NK/T-Cell Lymphoma / Refractory Peripheral T-Cell Lymphoma, Not Otherwise Specified	1
2	Recruiting	Treatment	Brain Metastases, Adult / Clear-cell Metastatic Renal Cell Carcinoma / Non Small Cell Lung Cancer Metastatic	1
2	Recruiting	Treatment	CD (Cluster of Differentiation) 30-Positive Neoplastic Cells Present / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
2	Recruiting	Treatment	Cancer of the Ovary / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm	1
2	Recruiting	Treatment	Cancer of the Ovary / Malignant Neoplasm of Female Breast / Malignant Neoplasm of Stomach	1
2	Recruiting	Treatment	Cancer, Advanced	2
2	Recruiting	Treatment	Cancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma	1
2	Recruiting	Treatment	Cancer, Breast	3
2	Recruiting	Treatment	Cancer, Breast / Luminal B	1
2	Recruiting	Treatment	Cancers	1
2	Recruiting	Treatment	Cancers / Neoplasia / Neoplasms / Tumors	1
2	Recruiting	Treatment	Carcinoma，Non-Small-Cell Lung / Large Cell Lung Carcinoma Metastatic / Lung adenocarcinoma metastatic / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Lung Cancer	1
2	Recruiting	Treatment	Chordomas / Ependymomas / Meningiomas	1
2	Recruiting	Treatment	Chromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma	1
2	Recruiting	Treatment	Chronic Lymphocytic Leukaemia (CLL) / Leukemias	1
2	Recruiting	Treatment	Classical Hodgkin Lymphoma	2
2	Recruiting	Treatment	Classical Hodgkin Lymphoma / Hematopoietic Cell Transplantation Recipient / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
2	Recruiting	Treatment	Clear Cell Metastatic Renal Cell Carcinoma	1
2	Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
2	Recruiting	Treatment	Colon Carcinoma	1
2	Recruiting	Treatment	Documented Stage III NSCLC, Amenable to Concomitant or Sequential Chemoradiotherapy / Locally Advanced Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Esophageal cancer metastatic / Esophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Esophagus / Oesophageal cancer metastatic / Oesophageal Cancer Nos	1
2	Recruiting	Treatment	GBM / MGMT-unmethylated Glioblastoma (GBM)	1
2	Recruiting	Treatment	Gastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours	1
2	Recruiting	Treatment	Gastrointestinal Stromal Tumors	1
2	Recruiting	Treatment	Gastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Metastatic Liposarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Liposarcoma	1
2	Recruiting	Treatment	HER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma	1
2	Recruiting	Treatment	HNSCC / HPV-Related Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Haematological Malignancies	1
2	Recruiting	Treatment	Head and Neck Carcinoma	2
2	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
2	Recruiting	Treatment	Hepatocellular,Carcinoma	2
2	Recruiting	Treatment	Hepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs	1
2	Recruiting	Treatment	Hodgkins Disease (HD)	2
2	Recruiting	Treatment	Human Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS) / Non Small Cell Lung Cancer Metastatic / Non Small Cell Lung Cancer Stage IIIB	1
2	Recruiting	Treatment	Kidney Cancer Metastatic / Kidney Cancer, Stage IV / Renal Cancers	1
2	Recruiting	Treatment	Leptomeningeal Carcinomatosis / Melanoma	1
2	Recruiting	Treatment	Leukemia Acute Myeloid Leukemia (AML)	1
2	Recruiting	Treatment	Leukemia Acute Myeloid Leukemia (AML) / Leukemias	1
2	Recruiting	Treatment	Leukemias	1
2	Recruiting	Treatment	Leukemias / Myelodysplastic Syndrome	1
2	Recruiting	Treatment	Limited Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)	1
2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	10
2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs	1
2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Non-squamous Cell Lung Cancer / Squamous Cell Carcinoma of Lung	1
2	Recruiting	Treatment	Lung Cancers	1
2	Recruiting	Treatment	Lung Squamous Cell Carcinoma Stage IV / Metastatic Uveal Melanoma / Nonsquamous Nonsmall Cell Neoplasm of Lung	1
2	Recruiting	Treatment	Lymphoma, Hodgkins	1
2	Recruiting	Treatment	C-MET Gene Amplification / MET Exon 14 Mutation / Metastatic Non-Squamous Non-Small Cell Lung Carcinoma / Recurrent Non-Squamous Non-Small Cell Lung Carcinoma / RET/PTC Rearrangement / ROS1 Gene Rearrangement / Stage IV Non-Small Cell Lung Cancer AJCC v7	1
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer	1
2	Recruiting	Treatment	Microsatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer	1
2	Recruiting	Treatment	Major Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma	1
2	Recruiting	Treatment	Malignant Lymphomas	1
2	Recruiting	Treatment	Malignant Melanoma	1
2	Recruiting	Treatment	Malignant Melanoma Stage III	1
2	Recruiting	Treatment	Malignant Neoplasm of Colon	1
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas	2
2	Recruiting	Treatment	Melanoma	5
2	Recruiting	Treatment	Melanoma (Skin)	1
2	Recruiting	Treatment	Melanoma / Uveal Melanoma	1
2	Recruiting	Treatment	Meningiomas	1
2	Recruiting	Treatment	Metastatic Cancer Colorectal	1
2	Recruiting	Treatment	Metastatic Cancers / Recurrent Cancer / Salivary Gland Carcinoma	1
2	Recruiting	Treatment	Metastatic Carcinoma in the Adrenal Cortex / Recurrent Adrenal Cortex Carcinoma / Stage III Adrenal Cortex Carcinoma / Stage IV Adrenal Cortex Carcinoma	1
2	Recruiting	Treatment	Metastatic Clear Cell Renal Cell Carcinoma	1
2	Recruiting	Treatment	Metastatic Melanoma	2
2	Recruiting	Treatment	Metastatic Melanoma / Stage IV Melanoma	1
2	Recruiting	Treatment	Metastatic Renal Cell Cancer / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Skin Melanoma	1
2	Recruiting	Treatment	Metastatic Renal Cell Carcinoma	3
2	Recruiting	Treatment	Metastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic	1
2	Recruiting	Treatment	Microsatellite Instability / Neoplasms, Head and Neck / Penile Neoplasms / Renal Cell Adenocarcinoma / Skin Neoplasms	1
2	Recruiting	Treatment	Mucosal Melanoma	1
2	Recruiting	Treatment	Muscle Invasive Bladder Cancer	1
2	Recruiting	Treatment	Name Human Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Stage II Oropharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Oral Cavity Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Laryngeal Squamous Cell Carcinoma / Stage IV Oral Cavity Squamous Cell Carcinoma / Stage IV Oropharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Oral Cavity Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Oral Cavity Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVC Hypopharyngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Oral Cavity Squamous Cell Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Nasopharyngeal Carcinoma	2
2	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin	1
2	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin / Skin Cancers	1
2	Recruiting	Treatment	Non Small Cell Lung Cancer Stage IIIB	1
2	Recruiting	Treatment	Non-Small Lung Cancer, Epigenetic Therapy	1
2	Recruiting	Treatment	Non-Squamous Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage I Non-Small Cell Lung Cancer AJCC v7 / Stage IA Non-Small Cell Lung Carcinoma / Stage IA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7	1
2	Recruiting	Treatment	Oral Cavity SCC	1
2	Recruiting	Treatment	Other Disorders of Kidney and Ureter / Renal Medullary Carcinoma	1
2	Recruiting	Treatment	Pancreatic Cancer Metastatic	1
2	Recruiting	Treatment	Previously Treated Unresectable or Metastatic Cholangiocarcinoma and Pancreactic Cancer	1
2	Recruiting	Treatment	Prostate Cancer	3
2	Recruiting	Treatment	Prostate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma	1
2	Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Recurrent Uterine Corpus Carcinoma / Stage III Uterine Corpus Cancer AJCC v7 / Stage IIIA Uterine Corpus Cancer AJCC v7 / Stage IIIB Uterine Corpus Cancer AJCC v7 / Stage IIIC Uterine Corpus Cancer AJCC v7 / Stage IIIC1 Uterine Corpus Cancer AJCC v7 / Stage IIIC2 Uterine Corpus Cancer AJCC v7 / Stage IV Uterine Corpus Cancer AJCC v7 / Stage IVA Uterine Corpus Cancer AJCC v7 / Stage IVB Uterine Corpus Cancer AJCC v7	1
2	Recruiting	Treatment	Renal Cancers	1
2	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
2	Recruiting	Treatment	Renal cancer metastatic	1
2	Recruiting	Treatment	Salivary Gland Cancers	1
2	Recruiting	Treatment	Sarcomas	1
2	Recruiting	Treatment	Solid Tumors Induced by Prior Radiation Exposure	1
2	Recruiting	Treatment	Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
2	Recruiting	Treatment	Stage III Hepatocellular Carcinoma AJCC v8 / Stage IIIA Hepatocellular Carcinoma AJCC v8 / Stage IIIB Hepatocellular Carcinoma AJCC v7 / Stage IIIC Hepatocellular Carcinoma AJCC v7 / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v8	1
2	Recruiting	Treatment	Systemic Connective Tissue Disorders	1
2	Recruiting	Treatment	Thyroid Cancers	1
2	Recruiting	Treatment	Untreated Metastatic Pancreatic Ductal Adenocarcinoma	1
2	Recruiting	Treatment	Uterine Corpus Leiomyosarcoma	1
2	Recruiting	Treatment	Various Advanced Cancer	1
2	Suspended	Treatment	Smoldering Multiple Myeloma (SMM)	1
2	Withdrawn	Treatment	Advanced Non-Small Cell Lung Cancer / Metastatic Non-Small Cell Lung Cancer / Neoplasms, Lung	1
2	Withdrawn	Treatment	Lung Cancer, Nonsmall Cell, Stage I	1
2	Withdrawn	Treatment	Melanoma	1
2	Withdrawn	Treatment	Renal Cell Adenocarcinoma	1
2, 3	Not Yet Recruiting	Treatment	Melanoma	1
2, 3	Recruiting	Treatment	Adult Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome With Excess Blasts-2 / Untreated Adult Acute Myeloid Leukemia	1
2, 3	Recruiting	Treatment	Colorectal Cancers	1
2, 3	Recruiting	Treatment	Malignant Neoplasm of Stomach	1
2, 3	Recruiting	Treatment	Melanoma	1
2, 3	Recruiting	Treatment	Non-Hodgkin's Lymphoma (NHL)	1
2, 3	Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v7	1
2, 3	Suspended	Treatment	Recurrent Melanoma of the Skin / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
3	Active Not Recruiting	Treatment	Advanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
3	Active Not Recruiting	Treatment	Advanced or Metastatic (Medically or Surgically Unresectable) Clear-cell Renal Cell Carcinoma	1
3	Active Not Recruiting	Treatment	Hepatocellular,Carcinoma / I.V Advanced Cancer	1
3	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	3
3	Active Not Recruiting	Treatment	Lung Cancers	2
3	Active Not Recruiting	Treatment	Malignant Neoplasm of Stomach	1
3	Active Not Recruiting	Treatment	Melanoma	5
3	Active Not Recruiting	Treatment	Multiple Myeloma (MM)	1
3	Active Not Recruiting	Treatment	Non-Squamous Cell Non-small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Recurrent Glioblastoma	1
3	Active Not Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
3	Active Not Recruiting	Treatment	Squamous Cell Non-small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Stage IV or Recurrent Non-Small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Unresectable or Metastatic Melanoma	2
3	Not Yet Recruiting	Treatment	Advanced Non Small Cell Lung Cancer	1
3	Not Yet Recruiting	Treatment	Head and Neck Carcinoma	1
3	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers	1
3	Not Yet Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
3	Recruiting	Treatment	BRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
3	Recruiting	Treatment	Brain Cancer	1
3	Recruiting	Treatment	Cancer, Advanced	1
3	Recruiting	Treatment	Esophageal Cancers	1
3	Recruiting	Treatment	Gastroesophageal Junction Cancer / Malignant Neoplasm of Stomach	1
3	Recruiting	Treatment	Head and Neck Carcinoma	1
3	Recruiting	Treatment	Hepatocellular,Carcinoma / Liver Cancer	1
3	Recruiting	Treatment	Hodgkins Disease (HD)	1
3	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	6
3	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers	1
3	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs	1
3	Recruiting	Treatment	Lung Cancers	1
3	Recruiting	Treatment	Malignant Neoplasm of Stomach	1
3	Recruiting	Treatment	Melanoma	1
3	Recruiting	Treatment	Melanoma / Skin Cancers	1
3	Recruiting	Treatment	Mesothelioma	2
3	Recruiting	Treatment	Metastatic Brain Tumors	1
3	Recruiting	Treatment	Neoplasms, Brain	1
3	Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v7	1
3	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
3	Recruiting	Treatment	Sarcomatoid Renal Cell Carcinoma / Stage II Renal Cell Cancer / Stage II Renal Cell Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Unclassified Renal Cell Carcinoma	1
3	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	2
3	Recruiting	Treatment	Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7	1
3	Recruiting	Treatment	Urothelial Cancer	1
3	Recruiting	Treatment	Various Advanced Cancer	2
3	Withdrawn	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
4	Active Not Recruiting	Other	Renal Cell Adenocarcinoma	1
4	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	1
4	Not Yet Recruiting	Diagnostic	Lung Cancers / Melanoma / Non-small Cell	1
4	Recruiting	Not Available	Metastatic Melanoma	1
4	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Kidney / Renal Cancers / Renal Neoplasms	1
4	Recruiting	Treatment	Lung Cancers	1
Not Available	Active Not Recruiting	Not Available	Inflammation, Brain	1
Not Available	Active Not Recruiting	Treatment	Cancer, Breast	1
Not Available	Completed	Not Available	Melanoma	1
Not Available	No Longer Available	Not Available	Malignant Melanoma	1
Not Available	No Longer Available	Not Available	Non-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer	1
Not Available	No Longer Available	Not Available	Stage III (Unresectable) or Stage IV Advanced Melanoma	1
Not Available	Recruiting	Not Available	Acral lentiginous melanoma / Mucosal Melanoma	1
Not Available	Recruiting	Not Available	Metastatic Cancers	1
Not Available	Recruiting	Not Available	Nivolumab Treatment in Expanded Use in Real World	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage forms

Form	Route	Strength
Injection	Intravenous	10 mg/mL
Solution	Intravenous	10 mg

Prices

Not Available

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
US2013173223	No	2013-05-13	2033-05-13

Properties

State

Solid

Experimental Properties

Not Available

Taxonomy

Description

Not Available

Kingdom

Organic Compounds

Super Class

Organic Acids

Class

Carboxylic Acids and Derivatives

Sub Class

Amino Acids, Peptides, and Analogues

Direct Parent

Peptides

Alternative Parents

Not Available

Substituents

Not Available

Molecular Framework

Not Available

External Descriptors

Not Available

Drug created on February 24, 2015 16:02 / Updated on April 22, 2018 23:40