Nivolumab

Identification

Name
Nivolumab
Accession Number
DB09035  (DB06132)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Nivolumab is a fully humanized IgG4 antibody targeting the immune checkpoint programmed death receptor-1 (PD-1). This molecule was produced entirely on mice and grafted onto human kappa and IgG4 Fc region with the mutation S228P for additional stability and reduced variability.[2] It is developed by Bristol Myers Squibb and originally FDA approved on December 22, 2014. Since this approval, nivolumab has been approved for a variety of other uses related to cancer therapy. On 2017, was notably approved for the treatment of hepatocellular carcinoma[8] and on July 11, 2018, the FDA approved this agent in combination with low doses of Ipilimumab for the treatment of MSI-H/dMMR metastatic colorectal cancer.[7]

Protein structure
Db09035
Protein chemical formula
C6362H9862N1712O1995S42
Protein average weight
143597.3811 Da
Sequences
>Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK
>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
External IDs
BMS-936558 / GTPL7335 / MDX-1106 / ONO-4538
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUs
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUs
OpdivoInjection10 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2017-12-08Not applicableUs
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada
Categories
UNII
31YO63LBSN
CAS number
946414-94-4

Pharmacology

Indication

Nivolumab is indicated as a single agent for the treatment of:

  • BRAF V600 wild-type unresectable or metastatic melanoma.
  • BRAF V600 mutation-positive unresectable or metastatic melanoma.
  • metastatic non-small cell lung cancer and progression on or after platinum-based chemotherapy. Patients with EGFR or ALK genomic tumor aberrations should have disease progression on disease-specific FDA therapy.
  • advanced renal cell carcinoma with prior anti-angiogenic therapy.
  • classical Hodgkin lymphoma in adults that has relapsed or progressed after autologous hematopoietic stem cell transplantation and brentuximab vedotin or 3 or more lines of systemic therapy that includes autologous hematopoietic stem cell transplantation.
  • recurrent or metastatic squamous cell carcinoma of the head and neck with disease progression on or after platinum-based therapy.
  • locally advanced or metastatic urothelial carcinoma with disease progression during or after platinum-containing chemotherapy or disease progression within 12 months of neoadjuvant or adjuvant treatment with platinum-containing chemotherapy.
  • microsatellite instability-high (MSI-H) or mismatch repair deficient (dMMR) metastatic colorectal cancer in patients 12 years or older that progressed following treatment with fluoropyrimidine, oxaliplatin and irinotecan.
  • hepatocellular carcinoma previously treated with sorafenib.[Label]

In combination with Ipilimumab, nivolumab is indicated for the treatment of:

  • unresectable or metastatic melanoma.
  • melanoma with lymph node involvement or metastatic disease that has gone through complete resection.
  • intermediate or poor risk, previously untreated advanced renal cell carcinoma.
  • microsatellite instability-high (MSI-H) or mismatch repair deficient (dMMR) metastatic colorectal cancer in patients 12 years or older that progressed following treatment with fluoropyrimidine, oxaliplatin and irinotecan.[Label]
Associated Conditions
Pharmacodynamics

In vitro testing showed a nivolumab-induced cytokine upregulation as well as an antigen-specific response of PD-1-positive T cells. The invitro pharmacodynamics studies were based on the occupancy on circulating CD3 positive T cells and they indicated a maximal occupancy of 85%. Initial clinical trials have shown that in patients with non-small-cell lung cancer, melanoma and renal cell carcinoma nivolumab presented an overall survival rate of 42%, 63% and 70% respectively.[1]

In phase I clinical trials, patients with non-small cell lung cancer, the objective response rate (ORR) was registered to be of maximum 18% with a median overall survival (mOS) of 9.4 months. When nivolumab was used as a first-line treatment for non-small cell lung cancer, the objective response rate was 30% and the median progression-free survival (mPFS) was 29.6% with a mOS of 9.9 months. In melanoma, the combination of Ipilimumab and nivolumab or nivolumab monotherapy on patients pre-treated with Ipilimumab was 40% and 20% respectively. In metastatic renal cell carcinoma, the median duration of response was 12.9 month while the response rate for Hodgkin's lymphoma was 87% with a ratio of stable disease of 13%.[3]

In phase II clinical trials in lung cancer, the mPFS and mOS was 1.9 and 8.2 months respectively. In melanoma, the ORR of the combination therapy with Ipilimumab was 61% as compared with 11% on the Ipilimumab monotherapy. The mPFS, ORR and mOS for the maximal concentration of nivolumab was 4.2 months, 20%, and 24.7 months respectively while the mPFS and mOS in ovarian cancer were reported to be 3.5 and 20 months respectively.[3]

Phase III studies in lung cancer and renal cell carcinoma were performed showing a mOS of 9.2 and 25 months respectively; the mPFS for this conditions was 3.5 and 4.6 months respectively. In the case of melanoma, the ORR was 31.7% and the mPFS of nivolumab alone was 7 months.[3]

The combination of nivolumab and Ipilimumab was studied in clinical trials and it was shown to produce an objective response in 40% of the patients studied which was significantly higher when compared to patients receiving nivolumab as a monotherapy when pretreated with Ipilimumab.[2] In clinical trials, the results were based on the reports that indicated significant improvement in overall survival and objective response rate of 42%.[9] This combination was also confirmed by trials with progression after therapy colorectal cancer which obtained an overall response rate of 46% and 89% of those has a response duration of over 6 months.[7]

Mechanism of action

PD-1 is a member of the CD28 T-cell receptor family which makes it be expressed mainly in T-cells, B cells and myeloid cells. PD-1 is upregulated after chronic antigen stimulation and produces a state of T-cell exhaustion. The ligands for PD-1, PD-L1 and PD-L2, are induced by the presence of inflammatory cytokines such as interferon gamma. Tumor studies have shown to express both of the PD-1 ligands. When PD-L1 and PD-L2 are bound to PD-1, this produces an inhibitory signal in the T cells which interrupts the immune response. Therefore, nivolumab blocks the immune checkpoint PD-1. The strategy behind this mechanism is related to the reduction of the inhibitory signaling and to restore the patient's natural tumor-specific T-cell immune response.[1]

The combination of nivolumab and Ipilimumab are based on the fact that PD-1 and CTLA-4 checkpoints have nonredundant roles on T-cell modulation.[1]

TargetActionsOrganism
AProgrammed cell death protein 1
antibody
Human
Absorption

Pharmacokinetic studies have suggested that nivolumab presents linear pharmacokinetics with a dose-proportional increase in peak concentration and AUC. The time to peak plasma concentration ranges between 1-4 hours.[1] The absorption pharmacokinetic properties respective to the administration of a dose of 10 mg/kg are reported to be Cmax, Tmax and AUC of 242 mcg/kg, 2.99 hours and 68100 mcg.h/ml respectively.[5]

Volume of distribution

The volume of distribution at steady state when a dose of 10 mg/kg of nivolumab is administered is reported to be 91.1 ml/kg.[5] At doses ranging from 0.1 to 20 mg/kg the volume of distribution is reported to be 8 L.[6]

Protein binding

There is no information regarding the plasma protein binding of nivolumab.[11]

Metabolism

There have not been formal studies regarding the specific metabolism of nivolumab but as a human monoclonal antibody, it has been suggested to not be metabolized by cytochrome P450 enzyme but to be degraded to small peptides and individual amino acids.[10]

Route of elimination

There have not been studies regarding the specific elimination route of nivolumab.[11]

Half life

Serum half-life is calculated to range around 20 days[1] with an elimination half-life of 26.7 days.[6]

Clearance

The estimated clearance rate for nivolumab is 9.4 ml/h.[4] The clearance rate seems to be increased according to the body weight.[6]

Toxicity

In vitro studies did not show antibody-dependent cell-mediated or complement-dependent cytotoxicity.[1] Long-term studies with nivolumab have nos shown a significant effect of this agent in the fertility. No studies regarding the carcinogenicity, genotoxicity or short-term effect on fertility have been performed. Some of the most serious effects are related to an increased severity of infectious and inflammatory response.[Label]

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Nivolumab.
AbituzumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Abituzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Nivolumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Nivolumab.
AducanumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Nivolumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Nivolumab.
AlirocumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Amatuximab.
AMG 108The risk or severity of adverse effects can be increased when AMG 108 is combined with Nivolumab.
Food Interactions
Not Available

References

General References
  1. Brahmer JR, Hammers H, Lipson EJ: Nivolumab: targeting PD-1 to bolster antitumor immunity. Future Oncol. 2015;11(9):1307-26. doi: 10.2217/fon.15.52. Epub 2015 Mar 23. [PubMed:25798726]
  2. Mashima E, Inoue A, Sakuragi Y, Yamaguchi T, Sasaki N, Hara Y, Omoto D, Ohmori S, Haruyama S, Sawada Y, Yoshioka M, Nishio D, Nakamura M: Nivolumab in the treatment of malignant melanoma: review of the literature. Onco Targets Ther. 2015 Aug 6;8:2045-51. doi: 10.2147/OTT.S62102. eCollection 2015. [PubMed:26273207]
  3. Guo L, Zhang H, Chen B: Nivolumab as Programmed Death-1 (PD-1) Inhibitor for Targeted Immunotherapy in Tumor. J Cancer. 2017 Feb 10;8(3):410-416. doi: 10.7150/jca.17144. eCollection 2017. [PubMed:28261342]
  4. Bajaj G, Wang X, Agrawal S, Gupta M, Roy A, Feng Y: Model-Based Population Pharmacokinetic Analysis of Nivolumab in Patients With Solid Tumors. CPT Pharmacometrics Syst Pharmacol. 2017 Jan;6(1):58-66. doi: 10.1002/psp4.12143. Epub 2016 Dec 26. [PubMed:28019091]
  5. Lee KW, Lee DH, Kang JH, Park JO, Kim SH, Hong YS, Kim ST, Oh DY, Bang YJ: Phase I Pharmacokinetic Study of Nivolumab in Korean Patients with Advanced Solid Tumors. Oncologist. 2018 Feb;23(2):155-e17. doi: 10.1634/theoncologist.2017-0528. Epub 2017 Nov 20. [PubMed:29158363]
  6. Solimando DA Jr, Waddell JA: Nivolumab and Olaparib. Hosp Pharm. 2015 May;50(5):356-66. doi: 10.1310/hpj5005-356. [PubMed:26405320]
  7. FDA news [Link]
  8. FDA 2017 new drug approvals [Link]
  9. FDA news [Link]
  10. EMA label [File]
  11. OPDIVO monograph [File]
External Links
KEGG Drug
D10316
PubChem Substance
347910393
ChEMBL
CHEMBL2108738
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Nivolumab
ATC Codes
L01XC17 — Nivolumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (2.51 MB)
MSDS
Download (1.26 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Cancer / Renal Cancers / Stage IV Renal Cell Cancer AJCC V71
0Active Not RecruitingTreatmentMelanoma (Skin) / Skin Cancers1
0RecruitingBasic ScienceLung Cancer Non-Small Cell Cancer (NSCLC)1
0RecruitingTreatmentHuman Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS) / Immunosuppression / Kaposi s Sarcoma (KS)1
0RecruitingTreatmentLarynx / Lip, Oral Cavity and Pharynx2
0RecruitingTreatmentLiver Cancer1
0RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
0RecruitingTreatmentMalignant Neoplasm of Pancreas1
0RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
0RecruitingTreatmentSarcomas1
0RecruitingTreatmentSquamous Cell Carcinoma Mouth / Squamous Cell Carcinoma of the Oral Cavity / Squamous Cell Carcinoma, Head And Neck1
1Active Not RecruitingBasic ScienceAdvanced Melanoma / Metastatic Melanoma1
1Active Not RecruitingBasic ScienceRenal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentAdvanced Solid Tumors, Including But Not Limited to Lung Cancer / Cancer of the Ovary / Colorectal Cancers / Glioblastoma Multiforme (GBM) / Head and Neck Carcinoma / Head and Neck Squamous Cell Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Gliomas / Malignant Neoplasm of Pancreas / Melanoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentAdvanced Solid Tumors / Solid Tumor, Recurrent1
1Active Not RecruitingTreatmentAstrocytomas / Glioblastomas / Malignant Gliomas1
1Active Not RecruitingTreatmentB Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Refractory Adult Acute Lymphoblastic Leukemia / Refractory Childhood Acute Lymphoblastic Leukemia1
1Active Not RecruitingTreatmentBRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1Active Not RecruitingTreatmentBladder Tumors / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Melanoma / Melanoma / Skin Cancers / Transitional Cell Carcinoma of the Bladder / Urinary Bladder Cancer1
1Active Not RecruitingTreatmentCancer of the Ovary / Cancer, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Prostate Cancer / Renal Cell Adenocarcinoma / Tumors, Solid1
1Active Not RecruitingTreatmentCancer of the Ovary / Fallopian Tubes / Primary Peritoneal Cancer / Recurrent Ovarian Cancer1
1Active Not RecruitingTreatmentCancer, Advanced2
1Active Not RecruitingTreatmentChronic Myeloid Leukemia (CML)1
1Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1Active Not RecruitingTreatmentCcRCC / Clear Cell Renal Cell Carcinoma / RCC / Renal Cancers / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentGlioblastomas / Gliosarcoma / Supratentorial Glioblastoma1
1Active Not RecruitingTreatmentGlioma, Malignant1
1Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Castration-resistant Prostrate Cancer / Metastatic Castration-resistant Prostrate Cancer (mCRPC) / Metastatic Melanoma / Metastatic Melanoma (MEL) / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1Active Not RecruitingTreatmentMalignant Lymphomas / Malignant Solid Tumours1
1Active Not RecruitingTreatmentMalignant Melanoma1
1Active Not RecruitingTreatmentMelanoma1
1Active Not RecruitingTreatmentMelanoma (Skin)2
1Active Not RecruitingTreatmentNeoplasms, Breast / Neoplasms, Pancreatic1
1Active Not RecruitingTreatmentTumors, Solid1
1CompletedOtherSevere Sepsis1
1CompletedTreatmentAdvanced Solid Tumors / Solid Tumor, Recurrent1
1CompletedTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma / Prostate Cancer / Renal Cancers1
1CompletedTreatmentMalignant Melanoma1
1CompletedTreatmentMalignant Solid Tumours1
1CompletedTreatmentNeoplasms by Site1
1Not Yet RecruitingTreatmentAcute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / Refractory Acute Myeloid Leukemia1
1Not Yet RecruitingTreatmentAutoimmune Diseases / Crohn's Disease (CD) / Disseminated Sclerosis / Giant Cells Arteritis / Lung Cancer Non-Small Cell Cancer (NSCLC) / Polymyalgia Rheumatica / Psoriasis / Rheumatoid Arthritis / Systemic Lupus Erythematosus (SLE) / Ulcerative Colitis (UC)1
1Not Yet RecruitingTreatmentBladder Cancers1
1Not Yet RecruitingTreatmentBreast Adenocarcinoma / Recurrent Breast Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Mycosis Fungoides / Recurrent Non-Hodgkin Lymphoma / Recurrent Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Nodal Marginal Zone Lymphoma / Refractory Non-Hodgkin's lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Breast Cancer AJCC v6 and v71
1Not Yet RecruitingTreatmentColorectal neoplasms malignant / Hepatic Metastases1
1Not Yet RecruitingTreatmentGlioblastomas1
1Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1Not Yet RecruitingTreatmentMetastatic Squamous Cell Carcinoma of the Head or Neck / Platinum- and Cetuximab-Refractory Squamous Cell Carcinoma of the Head or Neck / Recurrent Squamous Cell Carcinoma of the Head or Neck / Squamous Cell Carcinoma (SCC)1
1Not Yet RecruitingTreatmentRecurrent Hepatocellular Carcinoma / Refractory Liver Carcinoma / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v81
1Not Yet RecruitingTreatmentRecurrent Plasma Cell Myeloma1
1Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingOtherGlioblastomas1
1RecruitingTreatmentALK-positive NSCLC1
1RecruitingTreatmentAcral lentiginous melanoma / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Leptomeningeal Disease / Leptomeningeal Neoplasm / Melanoma and Other Malignant Neoplasms of Skin / Metastatic Melanoma / Metastatic Uveal Melanoma / Mucosal Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v81
1RecruitingTreatmentAcute Myeloid Leukemia and Myelodysplastic Syndrome1
1RecruitingTreatmentAdenocarcinoma of the Pancreas / Colon Carcinoma Metastatic in the Liver / Colorectal Adenocarcinoma / Resectable Pancreatic Carcinoma / Stage I Pancreatic Cancer / Stage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage II Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Hepatocellular,Carcinoma / Malignant Neoplasm of Stomach / Tumors, Solid1
1RecruitingTreatmentAdenocarcinomas / Advanced NSCLC / Carcinoma, Adenosquamous / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Squamous Cell Carcinoma (SCC)1
1RecruitingTreatmentAdrenocortical Carcinoma (Part G) / Advanced Solid Tumors (Part A/B/C/D) / High-circulating Myeloid-derived Suppressor Cells (Part H) / Melanoma (Part E) / Mesothelioma (Part G) / Non-small Cell Lung Cancer (NSCLC) and Melanoma (Part E) / Non-small Cell Lung Cancer (Part E) / Squamous Cell Cancer of the Head and Neck (Part E) / Triple Negative Breast Cancer (Part F)1
1RecruitingTreatmentAdult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Recurrent Classic Hodgkin Lymphoma / Recurrent Classical Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentAdult Solid Neoplasm / Childhood Solid Neoplasm / Neoplasms, Metastatic1
1RecruitingTreatmentAdvanced Cancers1
1RecruitingTreatmentAdvanced Malignancies1
1RecruitingTreatmentAdvanced Melanoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Renal Cell Adenocarcinoma1
1RecruitingTreatmentAdvanced Solid Tumors3
1RecruitingTreatmentAdvanced Solid Tumors / Advanced Solid Tumors Cancer1
1RecruitingTreatmentAdvanced Solid Tumors / Advanced Solid Tumors Cancer / Cancers1
1RecruitingTreatmentAdvanced Solid Tumors / Head and Neck Carcinoma, Squamous Cell / Lung Cancer Non-Small Cell Cancer (NSCLC) / Triple-Negative Breast Neoplasms1
1RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1RecruitingTreatmentAggressive Non-Hodgkin Lymphoma / Neoplasms, Advanced Solid / Recurrent Solid Neoplasm / Refractory Mantle Cell Lymphoma / T-Cell Non-Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentAnn Arbor Stage III Lymphoma / Ann Arbor Stage IV Lymphoma / Metastatic Malignant Solid Neoplasm1
1RecruitingTreatmentB Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Recurrent B Acute Lymphoblastic Leukemia / Refractory B Acute Lymphoblastic Leukemia1
1RecruitingTreatmentBladder Cancer TNM Staging Distant Metastasis (M) M0 / Bladder Cancer TNM Staging Primary Tumor (T) T2 / Bladder Cancer TNM Staging Primary Tumor (T) T2A / Bladder Cancer TNM Staging Primary Tumor (T) T2B / Bladder Cancer TNM Staging Primary Tumor (T) T3 / Bladder Cancer TNM Staging Primary Tumor (T) T3A / Bladder Cancer TNM Staging Primary Tumor (T) T3B / Bladder Cancer TNM Staging Regional Lymph Node (N) N0 / Bladder Cancer TNM Staging Regional Lymph Node (N) N11
1RecruitingTreatmentBladder Carcinoma / Colorectal Cancers / Salivary Gland Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentBladder Small Cell Neuroendocrine Carcinoma / Clear Cell Renal Cell Carcinoma / Infiltrating Bladder Urothelial Carcinoma Sarcomatoid Variant / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Kidney Medullary Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Renal Cell Carcinoma / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Sarcomatoid Renal Cell Carcinoma / Solid Neoplasms / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma / Stage III Bladder Adenocarcinoma AJCC v6 and v7 / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Penile Cancer / Stage III Penile Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer / Stage III Urethral Cancer AJCC v7 / Stage IIIa Penile Cancer / Stage IIIa Penile Cancer AJCC v7 / Stage IIIb Penile Cancer / Stage IIIb Penile Cancer AJCC v7 / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Adenocarcinoma AJCC v7 / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Squamous Cell Carcinoma AJCC v7 / Stage IV Bladder Urothelial Carcinoma / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Penile Cancer / Stage IV Penile Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer / Stage IV Urethral Cancer AJCC v7 / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma1
1RecruitingTreatmentBlasts 30 Percent or Less of Bone Marrow Nucleated Cells / Chronic Myelomonocytic Leukemia / High Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Refractory Anemia1
1RecruitingTreatmentBreast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm1
1RecruitingTreatmentCancer, Advanced2
1RecruitingTreatmentCancer, Breast / Transitional Cell Carcinoma1
1RecruitingTreatmentCancers3
1RecruitingTreatmentChordomas1
1RecruitingTreatmentChronic Leukemias / Leukemia, Acute / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma / Stage I Renal Cell Cancer / Stage I Renal Cell Cancer AJCC v6 and v7 / Stage II Renal Cell Cancer / Stage II Renal Cell Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v71
1RecruitingTreatmentEBV Related Hodgkin's Lymphoma / EBV Related Lymphoma / EBV Related Non-Hodgkin's Lymphoma / EBV-Related PTLD / Lymphoma, Hodgkins / Lymphoproliferative Disorders / NonHodgkin Lymphoma1
1RecruitingTreatmentEsophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Stomach1
1RecruitingTreatmentEsophageal Cancers / Lung Cancers / Malignant Neoplasm of Stomach / Renal Cancers1
1RecruitingTreatmentFallopian Tubes / High Grade Serous Ovarian / Primary Peritoneal Cancer1
1RecruitingTreatmentFollicular Lymphoma (FL)2
1RecruitingTreatmentGlioblastomas3
1RecruitingTreatmentGlioblastomas / Gliosarcoma / Recurrent Brain Neoplasm1
1RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms / Renal Cell Adenocarcinoma / Urothelial Neoplasm1
1RecruitingTreatmentChronic, recurrent Lymphocytic Leukemia / Hematopoietic Cell Transplantation Recipient / Myelodysplastic Syndrome / Myeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma1
1RecruitingTreatmentHepatocellular,Carcinoma3
1RecruitingTreatmentHuman Papillomavirus Positive Anal Carcinoma / Human Papillomavirus Positive Cervical Carcinoma / Human Papillomavirus Positive Oropharyngeal Carcinoma / Human Papillomavirus Positive Penile Carcinoma / Human Papillomavirus Positive Vulvar Carcinoma / Human Papillomavirus-Related Carcinoma1
1RecruitingTreatmentLocally Advanced Cancer / Metastatic Cancers1
1RecruitingTreatmentLocally Advanced Hepatocellular Carcinoma1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1RecruitingTreatmentMalignancies, Hematologic1
1RecruitingTreatmentMalignant Gliomas1
1RecruitingTreatmentMalignant Peritoneal Neoplasm / Malignant Retroperitoneal Neoplasm / Peritoneal Carcinomatosis / Recurrent Cervical Carcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage IV Cervical Cancer AJCC v8 / Stage IV Fallopian Tube Cancer AJCC v8 / Stage IV Ovarian Cancer AJCC v8 / Stage IV Primary Peritoneal Cancer AJCC v8 / Stage IV Uterine Corpus Cancer AJCC v8 / Stage IVA Cervical Cancer AJCC v8 / Stage IVA Fallopian Tube Cancer AJCC v8 / Stage IVA Ovarian Cancer AJCC v8 / Stage IVA Primary Peritoneal Cancer AJCC v8 / Stage IVA Uterine Corpus Cancer AJCC v8 / Stage IVB Cervical Cancer AJCC v8 / Stage IVB Fallopian Tube Cancer AJCC v8 / Stage IVB Ovarian Cancer AJCC v8 / Stage IVB Primary Peritoneal Cancer AJCC v8 / Stage IVB Uterine Corpus Cancer AJCC v81
1RecruitingTreatmentMelanoma1
1RecruitingTreatmentMetastatic Colorectal Cancers1
1RecruitingTreatmentMetastatic Hormone-sensitive Prostate Cancer1
1RecruitingTreatmentMetastatic Malignant Neoplasm in the Brain / Metastatic Malignant Neoplasm in the Spine / Stage IV Skin Melanoma1
1RecruitingTreatmentMetastatic Malignant Solid Neoplasm1
1RecruitingTreatmentMetastatic Melanoma2
1RecruitingTreatmentMetastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
1RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
1RecruitingTreatmentMetastatic Solid Tumors / Treatment-Refractory Cancers1
1RecruitingTreatmentNeoplasms Malignant1
1RecruitingTreatmentNeoplasms, Malignant1
1RecruitingTreatmentNeuroblastomas1
1RecruitingTreatmentNewly Diagnosed Glioblastoma1
1RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentStage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma1
1RecruitingTreatmentStage IV Small Cell Lung Cancer1
1RecruitingTreatmentTransitional Cell Carcinoma1
1RecruitingTreatmentTumors, Solid1
1TerminatedBasic ScienceNeoplasms, Colorectal1
1TerminatedOtherMelanoma1
1TerminatedTreatmentBladder Cancers1
1TerminatedTreatmentMultiple Myeloma (MM)1
1WithdrawnTreatmentMalignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)1
1WithdrawnTreatmentMetastatic Melanoma1
1, 2Active Not RecruitingTreatmentAdenocarcinoma of the Lung1
1, 2Active Not RecruitingTreatmentAdvanced Malignancies / Clear Cell Renal Cell Carcinoma / Renal Cancers / Select Advanced Malignancies1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1, 2Active Not RecruitingTreatmentB Cell NHL Including DLBCL / B-Cell Malignancies / Cancer of the Ovary / Carcinoma, Squamous Cell of Head and Neck / Colorectal Cancer (CRC) / CRC (Colorectal Cancer) / Glioblastomas / Head and Neck Carcinoma / HL / HNSCC (Head and Neck Squamous Cell Cancer / Hodgkin Lymphona (B-cell Malignancies) / I/O naïve Melanoma (MEL) / I/O Refractory MEL / I/O Relapsed MEL / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Lymphomas / Melanoma / Neoplasms, Colorectal / Neoplasms, Ovarian1
1, 2Active Not RecruitingTreatmentCancer, Advanced2
1, 2Active Not RecruitingTreatmentCancer, Advanced / Hepatocellular,Carcinoma1
1, 2Active Not RecruitingTreatmentCancer,NOS1
1, 2Active Not RecruitingTreatmentCancers2
1, 2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1, 2Active Not RecruitingTreatmentColorectal Cancer (CRC) / Colorectal Cancer (CRC)-Enrollment Completed / Glioblastoma (GBM) (Phase ll Only) / Glioblastoma (GBM) (Phase ll Only)-Enrollment Completed / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma of Head and Neck / Malignant Neoplasm of Colon / Melanoma / Ovarian Carcinoma / Ovarian Carcinoma-Enrollment Completed / Renal Cell Carcinoma (RCC) (Phase ll Only) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2Active Not RecruitingTreatmentExtensive-Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)1
1, 2Active Not RecruitingTreatmentHepatocellular,Carcinoma2
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic or Advanced Non-Small Cell Lung Cancer (NSCLC)1
1, 2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1, 2Active Not RecruitingTreatmentLymphoma, Hodgkins1
1, 2Active Not RecruitingTreatmentMSS / RAS-mutant Colorectal Cancer1
1, 2Active Not RecruitingTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2Active Not RecruitingTreatmentNeoplasms, Hematologic1
1, 2Active Not RecruitingTreatmentOvarian Cancer Metastatic1
1, 2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2Active Not RecruitingTreatmentTumors, Solid1
1, 2CompletedTreatmentMelanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma1
1, 2Not Yet RecruitingTreatmentAdenocarcinoma of the Prostate / Prostate Cancer1
1, 2Not Yet RecruitingTreatmentAntibodies, Neoplasm1
1, 2Not Yet RecruitingTreatmentChildhood Lymphoma / Childhood Solid Tumors1
1, 2Not Yet RecruitingTreatmentCohort 1a and 1b: Glioblastoma Multiforme / Cohort 1a and 1b: Glioma / Cohort 2a and 2b: Hepatobiliary Tumors (Hepatocellular Carcinoma, Bile Duct Carcinoma, Intrahepatic Cholangiocarcinoma, Other Hepatobiliary Carcinomas) / Cohort 3a and 3b: Chondrosarcoma / Cohort 4a and 4b: Intrahepatic Cholangiocarcinoma / Cohort 5a: Other Solid Tumors With IDH1 Mutations1
1, 2Not Yet RecruitingTreatmentColorectal Adenocarcinoma / CpG Island Methylator Phenotype / Metastatic Microsatellite Stable Colorectal Carcinoma / Refractory Colorectal Carcinoma / Stage IV Colorectal Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v81
1, 2Not Yet RecruitingTreatmentColorectal Cancers1
1, 2Not Yet RecruitingTreatmentGastrooesophageal Cancer / Immune Checkpoint Inhibition1
1, 2Not Yet RecruitingTreatmentGrade II Meningioma / Grade III Meningioma / Recurrent Meningiomas1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)2
1, 2Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
1, 2Not Yet RecruitingTreatmentHuman Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Stage II Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Oral Cavity Squamous Cell Carcinoma AJCC v6 and v71
1, 2Not Yet RecruitingTreatmentIn-Transit Metastasis / Melanoma1
1, 2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1, 2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Stage II / Non-small Cell Lung Cancer Stage I1
1, 2Not Yet RecruitingTreatmentLung Cancers / Malignant Pleural Effusions / Stage IV Metastatic Cancer1
1, 2Not Yet RecruitingTreatmentMelanoma2
1, 2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers / Metastatic Solid Tumor Cancer / Recurrent Head and Neck Cancer1
1, 2Not Yet RecruitingTreatmentMetastatic Hepatocellular Carcinoma / Stage III Hepatocellular Carcinoma AJCC v8 / Stage IIIA Hepatocellular Carcinoma AJCC v8 / Stage IIIB Hepatocellular Carcinoma AJCC v8 / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v8 / Unresectable Hepatocellular Carcinoma1
1, 2Not Yet RecruitingTreatmentOsteosarcoma in Children / Recurrent Osteosarcoma / Sarcoma, Osteogenic / Sarcomas1
1, 2Not Yet RecruitingTreatmentPeripheral T Cell Lymphoma (PTCL)1
1, 2Not Yet RecruitingTreatmentTumors, Solid1
1, 2RecruitingPreventionStage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2RecruitingTreatmentALK Gene Mutation / EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1, 2RecruitingTreatmentALK Gene Translocation / EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Translocation / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v71
1, 2RecruitingTreatmentAdenocarcinoma of the Pancreas1
1, 2RecruitingTreatmentAdvanced B-cell NHL / Advanced Solid Tumors1
1, 2RecruitingTreatmentAdvanced Malignancies / Advanced or Metastatic Malignancies1
1, 2RecruitingTreatmentAdvanced Malignancies / Metastatic Malignancy1
1, 2RecruitingTreatmentAdvanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma1
1, 2RecruitingTreatmentAdvanced Tumors / Multiple Indications Cancer1
1, 2RecruitingTreatmentAdvanced and Metastatic Solid Tumor1
1, 2RecruitingTreatmentAdvanced or Metastatic Solid Tumors / Tumors, Solid1
1, 2RecruitingTreatmentBiallelic Mismatch Repair Deficiency (bMMRD) Positive Patients / Refractory or Recurrent Hypermutated Malignancies1
1, 2RecruitingTreatmentBroad Solid Tumor1
1, 2RecruitingTreatmentCancer of Rectum1
1, 2RecruitingTreatmentCancer of the Ovary / Colorectal Cancers / Melanoma / Neuroendocrine Carcinoma of the Skin / Renal Cell Adenocarcinoma / Sarcomas / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentCancer, Advanced6
1, 2RecruitingTreatmentCancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1, 2RecruitingTreatmentCancer, Advanced / Solid Tumors and Hematologic Malignancy1
1, 2RecruitingTreatmentCancer, Breast / Triple-Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentCancers4
1, 2RecruitingTreatmentCancers / Carcinoma NOS / HCC / Hepatocellular,Carcinoma / Tumors, Solid1
1, 2RecruitingTreatmentCancers / Malignancies / Neoplasms / Tumors1
1, 2RecruitingTreatmentCancers / Melanoma / Metastatic Melanoma / Neoplasm of Lung / Non Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
1, 2RecruitingTreatmentCarcinoma,Non-Small-Cell Lung / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentCervical Cancers / Locally Advanced Cervical Cancer1
1, 2RecruitingTreatmentChildhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Melanoma / Refractory Neuroblastoma / Refractory Non-Hodgkin's lymphoma / Refractory Osteosarcoma / Refractory Rhabdomyosarcoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1, 2RecruitingTreatmentChildren, Adolescents and Young Adults With Refractory or Recurrent Malignancies1
1, 2RecruitingTreatmentChondrosarcomas / Ewing's Sarcoma (ES) / Liposarcoma / Sarcoma, Osteogenic / Undifferentiated Pleomorphic Sarcoma1
1, 2RecruitingTreatmentClear Cell Renal Cell Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1, 2RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentCutaneous Melanoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Renal Cell Adenocarcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentEGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1, 2RecruitingTreatmentEndometrial Cancers / Prostate Cancer1
1, 2RecruitingTreatmentEsophageal Cancers1
1, 2RecruitingTreatmentGastroesophageal Junction Region (GEJ) Cancer / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentGlioblastomas / Non-Small Cell Lung Cancer Recurrent / Recurrent Hepatocellular Carcinoma / Tumors, Solid1
1, 2RecruitingTreatmentGrade 3a Follicular Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory Burkitt Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma1
1, 2RecruitingTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2RecruitingTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / Squamous Cell Cancer / Squamous Cell Carcinoma of the Hypopharynx / Squamous Cell Carcinoma of the Larynx / Squamous Cell Carcinoma of the Oral Cavity / Squamous Cell Carcinoma of the Oropharynx / Squamous Cell Carcinoma of the Paranasal Sinus1
1, 2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2RecruitingTreatmentHepatic Metastases / Uveal Melanoma1
1, 2RecruitingTreatmentHepatocellular Carcinoma (HCC)1
1, 2RecruitingTreatmentHepatocellular,Carcinoma / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentImmunotherapy / Neoplasms, Head and Neck1
1, 2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Leukemias / Myelodysplastic Syndrome1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Refractory Thoracic Tumors / Thymic Carcinoma1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Tumors, Solid1
1, 2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers1
1, 2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Small Cell Lung Cancer Extensive Stage1
1, 2RecruitingTreatmentLymphoma, Hodgkins4
1, 2RecruitingTreatmentLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1, 2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
1, 2RecruitingTreatmentMalignant Lymphomas / Multiple Myeloma (MM)1
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentMalignant Neoplasms of Urinary Tract / Other Disorders of Kidney and Ureter / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentMalignant Solid Tumours2
1, 2RecruitingTreatmentMelanoma1
1, 2RecruitingTreatmentMelanoma / Melanoma Stage Iii / Melanoma Stage Iv1
1, 2RecruitingTreatmentMetastatic Brain Tumors1
1, 2RecruitingTreatmentMetastatic Melanoma1
1, 2RecruitingTreatmentMetastatic Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2RecruitingTreatmentMultiple Myeloma (MM)1
1, 2RecruitingTreatmentMyelodysplastic Syndromes1
1, 2RecruitingTreatmentNeoplasms by Site2
1, 2RecruitingTreatmentNeoplasms, Hematologic1
1, 2RecruitingTreatmentNon Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentNon-Hodgkin's Disease1
1, 2RecruitingTreatmentOvarian Epithelial Cancer1
1, 2RecruitingTreatmentPancreatic Adenocarcinoma Metastatic1
1, 2RecruitingTreatmentPancreatic Ductal Adenocarcinoma1
1, 2RecruitingTreatmentProstate Cancer1
1, 2RecruitingTreatmentProstate Cancer / Prostate Disease1
1, 2RecruitingTreatmentRecurrent Central Nervous System Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Refractory Central Nervous System Lymphoma / Refractory Diffuse Large B Cell Lymphoma1
1, 2RecruitingTreatmentRefractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma1
1, 2RecruitingTreatmentRenal Cell Adenocarcinoma2
1, 2RecruitingTreatmentSarcoma, Bone / Soft Tissue Sarcoma (STS)1
1, 2RecruitingTreatmentSarcomas / Solid Tumor, Adult / Solid Tumor, Childhood1
1, 2RecruitingTreatmentSquamous Cell Carcinoma of Esophagus1
1, 2RecruitingTreatmentStage III/IV Melanoma1
1, 2RecruitingTreatmentVarious Advanced Cancer1
1, 2SuspendedTreatmentClassical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Classic Hodgkin Lymphoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
1, 2TerminatedOtherTumors, Solid1
1, 2TerminatedTreatmentCancer, Advanced / Carcinoma, Colorectal / Endometrial / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Renal Cell Adenocarcinoma / Uterine1
1, 2TerminatedTreatmentCancers1
1, 2TerminatedTreatmentMetastatic Cancers1
1, 2WithdrawnTreatmentAdenocarcinoma of the Lung / Lung Cancers1
1, 2WithdrawnTreatmentAdvanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage III Uveal Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm1
1, 2WithdrawnTreatmentSquamous Non-Small Cell Lung Cancer1
2Active Not RecruitingOtherLung Cancer Non-Small Cell Cancer (NSCLC)1
2Active Not RecruitingTreatmentAcute Adult T-Cell Leukemia/Lymphoma / Adult T-Cell Leukemia/Lymphoma / CD3 Positive / CD4-Positive Neoplastic Cells Present / Chronic Adult T-Cell Leukemia/Lymphoma / HTLV-1 Infection / Hypercalcemia / Lymphomatous Adult T-Cell Leukemia/Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Smoldering Adult T-Cell Leukemia/Lymphoma1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Recurrent, IV-B Cervical cancer / Stage IV Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v71
2Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
2Active Not RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer2
2Active Not RecruitingTreatmentAdvanced or Metastatic Melanoma1
2Active Not RecruitingTreatmentCancer of the Ovary / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm1
2Active Not RecruitingTreatmentDocumented Stage III NSCLC, Amenable to Concomitant or Sequential Chemoradiotherapy / Locally Advanced Non-Small Cell Lung Cancer1
2Active Not RecruitingTreatmentHead and Neck Carcinoma1
2Active Not RecruitingTreatmentHodgkins Disease (HD)1
2Active Not RecruitingTreatmentLeukemias1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Small Cell Carcinoma of Lung, TNM Stage 4 / Non-Small-Cell Lung Cancer Metastatic / Recurrent Non Small Cell Lung Cancer1
2Active Not RecruitingTreatmentMicrosatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer1
2Active Not RecruitingTreatmentMalignant Lymphomas1
2Active Not RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2Active Not RecruitingTreatmentMelanoma4
2Active Not RecruitingTreatmentMelanoma / Metastatic Brain Tumors1
2Active Not RecruitingTreatmentMelanoma / Oligometastatic Melanoma1
2Active Not RecruitingTreatmentMelanoma / Uveal Melanoma1
2Active Not RecruitingTreatmentMesothelioma1
2Active Not RecruitingTreatmentMetastatic Carcinoma in the Adrenal Cortex / Recurrent Adrenal Cortex Carcinoma / Stage III Adrenal Cortex Carcinoma / Stage IV Adrenal Cortex Carcinoma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Unresectable Melanoma1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)1
2Active Not RecruitingTreatmentNasopharyngeal Nonkeratinizing Carcinoma / Recurrent Nasopharyngeal Undifferentiated Carcinoma / Recurrent Nasopharynx Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Nasopharyngeal Undifferentiated Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Nasopharyngeal Undifferentiated Carcinoma / Stage IVA Nasopharyngeal Carcinoma / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma / Stage IVC Nasopharyngeal Carcinoma AJCC v71
2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
2Active Not RecruitingTreatmentPreviously Treated Metastatic Adenocarcinoma of the Pancreas1
2Active Not RecruitingTreatmentProstate Cancer1
2Active Not RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma2
2Active Not RecruitingTreatmentSquamous Cell Non-small Cell Lung Cancer1
2Active Not RecruitingTreatmentTumors, Solid1
2Active Not RecruitingTreatmentUveal Melanoma1
2Active Not RecruitingTreatmentVarious Advanced Cancer1
2CompletedTreatmentGlioblastoma Multiforme (GBM)1
2CompletedTreatmentMalignant Pleural Mesothelioma (MPM)1
2CompletedTreatmentMetastatic Leiomyosarcoma / Unresectable Leiomyosarcoma / Uterine Corpus Leiomyosarcoma1
2CompletedTreatmentMyeloproliferative Disorders1
2CompletedTreatmentRefractory, metastatic Colorectal cancer1
2Enrolling by InvitationTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Carcinoma1
2Not Yet RecruitingPreventionOral Leukoplakia1
2Not Yet RecruitingTreatmentAdenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Clinical Stage I Esophageal Adenocarcinoma AJCC v8 / Clinical Stage I Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v81
2Not Yet RecruitingTreatmentAdenocarcinoma of the Stomach / Gastrooesophageal Cancer1
2Not Yet RecruitingTreatmentAdvanced Metastatic Cancer1
2Not Yet RecruitingTreatmentAppendiceal Tumor / Colorectal Tumors / Mucinous Neoplasm1
2Not Yet RecruitingTreatmentBasal Cell Carcinoma (BCC)1
2Not Yet RecruitingTreatmentBiliary Tract Cancer1
2Not Yet RecruitingTreatmentBreast Neoplasm Female / Cancer, Breast / Carcinoma, Breast / Tumors, Breast1
2Not Yet RecruitingTreatmentBronchial dysplasia / History of Head and Neck Cancer / History of Non-Small Cell Lung Cancer / Tobacco Smoking1
2Not Yet RecruitingTreatmentCancer of the Stomach / Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2Not Yet RecruitingTreatmentCancer, Breast1
2Not Yet RecruitingTreatmentCervical Cancers1
2Not Yet RecruitingTreatmentChondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentChordomas / Locally Advanced Chordoma / Metastatic Chordoma / Unresectable Chordoma1
2Not Yet RecruitingTreatmentClassic Kaposi Sarcoma1
2Not Yet RecruitingTreatmentColorectal Adenocarcinoma / Microsatellite Stable (MSS) Colorectal Adenocarcinomas1
2Not Yet RecruitingTreatmentGastric and Esophagogastric Junction Adenocarcinoma1
2Not Yet RecruitingTreatmentGiant Cell Glioblastoma / Gliosarcoma / Oligodendrogliomas / Recurrent Glioblastoma / Small Cell Glioblastoma1
2Not Yet RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Not Yet RecruitingTreatmentHepatocellular Carcinoma (HCC)1
2Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
2Not Yet RecruitingTreatmentInoperable œsophageal Cancer1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2Not Yet RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2Not Yet RecruitingTreatmentLymphoma, B-Cell1
2Not Yet RecruitingTreatmentLymphoma, Hodgkins1
2Not Yet RecruitingTreatmentMSI-H Tumors / Refractory MSI - H Solid Tumors Prior of PD-(L) 1 Therapy1
2Not Yet RecruitingTreatmentMelanoma Stage Iv1
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers1
2Not Yet RecruitingTreatmentMultiple Myeloma (MM)1
2Not Yet RecruitingTreatmentNasopharyngeal Carcinoma1
2Not Yet RecruitingTreatmentNeuroendocrine Carcinomas1
2Not Yet RecruitingTreatmentPan Tumor1
2Not Yet RecruitingTreatmentProstate Cancer1
2Not Yet RecruitingTreatmentRecurrent Diffuse Large B-Cell Lymphoma / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Recurrent Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma1
2Not Yet RecruitingTreatmentRecurrent Glioblastoma1
2Not Yet RecruitingTreatmentRenal Cell Carcinoma, Metastatic1
2Not Yet RecruitingTreatmentSmall Cell Lung Carcinoma / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
2Not Yet RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Not Yet RecruitingTreatmentStage IV Melanoma / Unresectable Stage III Melanoma1
2Not Yet RecruitingTreatmentUrinary Bladder Cancer1
2Not Yet RecruitingTreatmentVarious Advanced Cancer1
2RecruitingTreatmentActivated B-Cell-Like Diffuse Large B-Cell Lymphoma / ALK-Positive Large B-Cell Lymphoma / Atypical Burkitt/Burkitt-Like Lymphoma / Burkitt-Like Lymphoma With 11q Aberration / Diffuse Large B-Cell Lymphoma Activated B-Cell Type / Diffuse Large B-Cell Lymphoma Associated With Chronic Inflammation / Diffuse Large B-Cell Lymphoma Germinal Center B-Cell Type / Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Mucocutaneous Ulcer / Epstein-Barr Virus Positive Diffuse Large B-Cell Lymphoma of the Elderly / Epstein-Barr Virus-Positive Mucocutaneous Ulcer / Epstein-Barr Virus-Positive Neoplastic Cells Present / Germinal Center B-Cell-Like Diffuse Large B-Cell Lymphoma / High-Grade B-Cell Lymphoma With MYC and BCL2 and/or BCL6 Rearrangements / High-Grade B-Cell Lymphoma With MYC, BCL2, and BCL6 Rearrangements / Human Herpes Virus 8-Related Malignant Neoplasm / Human Herpesvirus 8-Positive Neoplastic Cells Present / Human Herpesvirus-8-Positive Neoplastic Cells Present / Intravascular Large B-Cell Lymphoma / Large B-Cell Lymphoma With IRF4 Rearrangement / MYC-Negative B-Cell Lymphoma With 11q Aberration Resembling Burkitt Lymphoma / Plasmablastic Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma, Leg Type / Primary Diffuse Large B-Cell Lymphoma of the Central Nervous System / Primary Effusion Lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classic Hodgkin Lymphoma / Recurrent B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classical Hodgkin Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Lymphomatoid Granulomatosis / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Recurrent Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classic Hodgkin Lymphoma / Refractory B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classical Hodgkin Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Skin Ulcers / Small Intestinal B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Burkitt Lymphoma / Small Intestinal High Grade B-Cell Lymphoma, Not Otherwise Specified / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma1
2RecruitingTreatmentAcinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Carcinoma, Adenoid Cystic / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Desmoid-Type Fibromatosis / Endometrial Adenocarcinomas / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Gastric Undifferentiated Carcinoma / Gastrointestinal Stromal Tumors / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metaplastic breast carcinoma / Metastatic Malignant Neoplasm of Unknown Primary Origin / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Rare Disorder / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Carcinoma / Vulvar Squamous Cell Carcinoma1
2RecruitingTreatmentAcute Bilineal Leukemia / Acute Biphenotypic Leukemia (ABL) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute, recurrent Myeloid Leukemia / Acute, secondary Myeloid Leukemia / Chronic Myelomonocytic Leukemia / Leukemias / Myelodysplastic Syndrome / Refractory Acute Myeloid Leukemia / Therapy-Related Acute Myeloid Leukemia1
2RecruitingTreatmentAcute myeloid leukaemia (in remission) / Adult Acute Myeloid Leukemia in Remission1
2RecruitingTreatmentAdenocarcinoma of the Lung / Lung Cancers / Non-Squamous Non-Small Cell Lung Cancer (NSCLC) / Squamous Cell Carcinoma of Lung1
2RecruitingTreatmentAdenocarcinoma of the Pancreas1
2RecruitingTreatmentAdenocarcinoma of the Stomach / Esophageal Cancers / Gastrooesophageal Cancer / HER2 Positive Gastric Cancer / Malignant Neoplasm of Stomach / Metastatic Gastric Cancers1
2RecruitingTreatmentAdenocarcinomas1
2RecruitingTreatmentAdnexal Carcinoma / Apocrine Carcinoma / Carcinoma, Adenoid Cystic / Eccrine Porocarcinoma / Extraocular Cutaneous Sebaceous Carcinoma / Hidradenocarcinoma / Keratoacanthoma / Malignant sweat gland neoplasm / Microcystic Adnexal Carcinoma / Neuroendocrine Carcinoma of the Skin / NK-Cell Lymphoma, Unclassifiable / Non-Melanomatous Lesion / Paget's Disease / Papillary Adenocarcinoma / Primary Cutaneous Mucinous Carcinoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Refractory T-Cell Non-Hodgkin Lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Sezary Syndrome / Signet Ring Cell Carcinoma / Skin Basal Cell Carcinoma / Skin Basosquamous Cell Carcinoma / Skin Squamous Cell Carcinoma / Spiradenocarcinoma / Squamous Cell Carcinoma of Unknown Primary Origin / Stage III Skin Cancer / Stage IV Skin Cancer / Sweat Gland Carcinoma / Trichilemmocarcinoma / Vulvar Squamous Cell Carcinoma1
2RecruitingTreatmentAdrenocortical Carcinoma / Genitourinary Cancers / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell1
2RecruitingTreatmentAdult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / CD30-Positive Neoplastic Cells Present / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Post-Transplant Lymphoproliferative Disorder / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Hodgkin Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Non-Hodgkin Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Refractory Hodgkin Lymphoma / Refractory Non-Hodgkin's lymphoma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)1
2RecruitingTreatmentAdvanced Gastric Cancer1
2RecruitingTreatmentAdvanced Malignant Neoplasm / Advanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Uterine Neoplasm / Melanoma / Oesophageal Carcinoma / Ovarian Carcinoma / Plasma Cell Myeloma / Prostate Cancer / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Solid Neoplasm / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Neoplasm / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Solid Neoplasms / Thyroid Gland Carcinoma / Uterine Corpus Cancer1
2RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
2RecruitingTreatmentAdvanced Pancreatic Cancer1
2RecruitingTreatmentAdvanced Renal Cell Carcinoma1
2RecruitingTreatmentAdvanced Solid Tumors1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentAdvanced Stage Non-small Cell Lung Cancer1
2RecruitingTreatmentAdvanced or Metastatic Non-clear Cell Renal Cell Carcinoma1
2RecruitingTreatmentAnal Basaloid Carcinoma / Anal Canal Cloacogenic Carcinoma / Anal Margin Squamous Cell Carcinoma / Stage II Anal Canal Cancer AJCC v6 and v7 / Stage IIB Anal Cancer AJCC v8 / Stage III Anal Canal Cancer AJCC v6 and v7 / Stage IIIA Anal Canal Cancer AJCC v6 and v7 / Stage IIIB Anal Canal Cancer AJCC v6 and v71
2RecruitingTreatmentAnal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Recurrent Anal Canal Carcinoma / Stage IV Anal Canal Cancer / Stage IV Anal Canal Cancer AJCC v6 and v71
2RecruitingTreatmentAnn Arbor Stage I Hodgkin Lymphoma / Ann Arbor Stage IA Hodgkin Lymphoma / Ann Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Stage I Hodgkin Lymphoma / Stage IA Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma1
2RecruitingTreatmentAnn Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Ann Arbor Stage III Hodgkin Lymphoma / Ann Arbor Stage IIIA Hodgkin Lymphoma / Ann Arbor Stage IIIB Hodgkin Lymphoma / Ann Arbor Stage IV Hodgkin Lymphoma / Ann Arbor Stage IVA Hodgkin Lymphoma / Ann Arbor Stage IVB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Classical Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma / Stage III Hodgkin Lymphoma / Stage IIIA Hodgkin Lymphoma / Stage IIIB Hodgkin Lymphoma / Stage IV Hodgkin Lymphoma / Stage IVA Hodgkin Lymphoma / Stage IVB Hodgkin Lymphoma1
2RecruitingTreatmentBCL-2 Translocation / High-grade B-cell Lymphoma / Lymphoma, B-Cell / MYC Translocation / Non Hodgkin Lymphoma (NHL)1
2RecruitingTreatmentBiliary Tract Cancer / Biliary Tract Neoplasms1
2RecruitingTreatmentBiliary Tract Neoplasms1
2RecruitingTreatmentBladder Cancers3
2RecruitingTreatmentBladder Cancers / Bladder Tumors / Neoplasms, Bladder1
2RecruitingTreatmentBladder Cancers / Melanoma1
2RecruitingTreatmentBladder Cancers / Transitional Cell Carcinoma1
2RecruitingTreatmentBladder transitional cell carcinoma / Transitional Cell Carcinoma / Urothelial Carcinoma of the Renal Pelvis and Ureter / Urothelial Carcinoma Ureter / Urothelial Carcinoma Urethra1
2RecruitingTreatmentBlastic Plasmacytoid Dendritic Cell Neoplasm (BPDCN) / Hepatosplenic T-Cell Lymphoma / HTLV-1 Infection / NK-Cell Lymphoma, Unclassifiable / Primary Systemic Anaplastic Large Cell Lymphoma, ALK-Negative / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Angioimmunoblastic T-cell Lymphoma / Recurrent Enteropathy-Associated T-Cell Lymphoma / Recurrent Mycosis Fungoides / Refractory Adult T-Cell Leukemia/Lymphoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Angioimmunoblastic T-cell Lymphoma / Refractory Enteropathy-Associated T-Cell Lymphoma / Refractory Nasal Type Extranodal NK/T-Cell Lymphoma / Refractory Peripheral T-Cell Lymphoma, Not Otherwise Specified / Refractory, advanced Mycosis fungoides1
2RecruitingTreatmentBrain Metastases, Adult / Clear-cell Metastatic Renal Cell Carcinoma / Non Small Cell Lung Cancer Metastatic1
2RecruitingTreatmentCD (Cluster of Differentiation) 30-Positive Neoplastic Cells Present / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / TNFRSF8 Positive1
2RecruitingTreatmentCancer of the Ovary / Clear Cell Adenocarcinoma / Extra Renal Origin / Fallopian Tube Cancer / Primary Peritoneal Carcinoma1
2RecruitingTreatmentCancer of the Ovary / Malignant Neoplasm of Female Breast / Malignant Neoplasm of Stomach1
2RecruitingTreatmentCancer of the Stomach / Esophagogastric Junction / Malignant Neoplasm of Stomach1
2RecruitingTreatmentCancer, Advanced2
2RecruitingTreatmentCancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma1
2RecruitingTreatmentCancer, Breast3
2RecruitingTreatmentCancer, Breast / Luminal B1
2RecruitingTreatmentCancers1
2RecruitingTreatmentCancers / Neoplasia / Neoplasms / Tumors1
2RecruitingTreatmentCarcinoid Tumors / Neuroendocrine Tumors1
2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck1
2RecruitingTreatmentCarcinoma,Non-Small-Cell Lung / Large Cell Lung Carcinoma Metastatic / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Lung Adenocarcinoma / Metastatic Lung Cancer1
2RecruitingTreatmentCastration-Resistant Prostate Cancer (CRPC) / Metastatic Hormone Refractory Prostate Cancer / Prostate Cancer1
2RecruitingTreatmentCholangiocarcinomas / Malignant Neoplasm of Pancreas / Pancreatic Cancer Metastatic / Previously Treated Unresectable or Metastatic Cholangiocarcinoma and Pancreactic Cancer / Previously Treated Unresectable or Metastatic Cholangiocarcinoma and Pancreatic Cancer1
2RecruitingTreatmentChordomas / Ependymomas / Meningiomas1
2RecruitingTreatmentChromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
2RecruitingTreatmentClassical Hodgkin Lymphoma2
2RecruitingTreatmentClassical Hodgkin Lymphoma / Hematopoietic Cell Transplantation Recipient / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
2RecruitingTreatmentClear Cell Metastatic Renal Cell Carcinoma1
2RecruitingTreatmentClear Cell Renal Cell Carcinoma1
2RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
2RecruitingTreatmentCoexisting Medical Conditions / Lymphoma, Hodgkins1
2RecruitingTreatmentColon Adenomas / Colon Carcinoma / Lynch Syndrome / MLH1 Gene Mutation / MSH2 Gene Mutation1
2RecruitingTreatmentColon Carcinoma1
2RecruitingTreatmentColorectal neoplasms malignant1
2RecruitingTreatmentDisorders, Lymphoproliferative / Epstein-Barr Virus Infections / Lymphoproliferative Disorders / Malignant Lymphomas1
2RecruitingTreatmentEGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentEsophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Esophagus / Metastatic Esophageal Cancer / Metastatic Oesophageal Cancer / Oesophageal Cancer Nos1
2RecruitingTreatmentExtensive Stage Small Cell Lung Carcinoma1
2RecruitingTreatmentEye and Orbit1
2RecruitingTreatmentGBM / MGMT-unmethylated Glioblastoma (GBM)1
2RecruitingTreatmentGastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours1
2RecruitingTreatmentGastrointestinal Stromal Tumors1
2RecruitingTreatmentGlioblastomas1
2RecruitingTreatmentGliomas1
2RecruitingTreatmentHER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma1
2RecruitingTreatmentHNSCC / HPV-Related Squamous Cell Carcinoma1
2RecruitingTreatmentHaematological Malignancies1
2RecruitingTreatmentHead and Neck Carcinoma2
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentHepatic Carcinoma / Hepatocellular Cancer / Hepatocellular,Carcinoma1
2RecruitingTreatmentHepatocellular,Carcinoma2
2RecruitingTreatmentHepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs1
2RecruitingTreatmentHigher Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML)1
2RecruitingTreatmentHodgkins Disease (HD)2
2RecruitingTreatmentHuman Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS) / Non Small Cell Lung Cancer Metastatic / Non Small Cell Lung Cancer Stage IIIB1
2RecruitingTreatmentKidney Cancer Metastatic / Kidney Cancer, Stage IV / Renal Cancers1
2RecruitingTreatmentLeptomeningeal Carcinomatosis / Melanoma1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Leukemias1
2RecruitingTreatmentLeukemias / Myelodysplastic Syndrome1
2RecruitingTreatmentLimited Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)13
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-squamous Cell Lung Cancer / Squamous Cell Carcinoma of Lung1
2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers / Relapsed Small cell lung cancer1
2RecruitingTreatmentLung Cancers1
2RecruitingTreatmentLung Squamous Cell Carcinoma Stage IV / Metastatic Uveal Melanoma / Nonsquamous Nonsmall Cell Neoplasm of Lung1
2RecruitingTreatmentLymph Node Cancer / Melanoma1
2RecruitingTreatmentLymphoma, Hodgkins2
2RecruitingTreatmentMalignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer1
2RecruitingTreatmentMajor Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma1
2RecruitingTreatmentMalignant Lymphomas1
2RecruitingTreatmentMalignant Lymphomas / Metastatic Bladder Cancer / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Metastatic Renal Cell Cancer / Recurrent Bladder Carcinoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Renal Cell Carcinoma Recurrent / Stage III Bladder Cancer / Stage III Lymphoma / Stage III Non-Small Cell Lung Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Lymphoma / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Bladder Cancer / Stage IVB Bladder Cancer / Stages III Skin Melanoma / Unresectable Head and Neck Squamous Cell Carcinoma / Unresectable Solid Neoplasm1
2RecruitingTreatmentMalignant Melanoma2
2RecruitingTreatmentMalignant Melanoma Stage III1
2RecruitingTreatmentMalignant Neoplasm of Colon1
2RecruitingTreatmentMalignant Neoplasm of Pancreas4
2RecruitingTreatmentMelanoma5
2RecruitingTreatmentMelanoma (Skin)1
2RecruitingTreatmentMeningiomas1
2RecruitingTreatmentMesothelioma, Malignant1
2RecruitingTreatmentMetastatic Adult Soft Tissue Sarcoma1
2RecruitingTreatmentMetastatic Biliary Tract Cancer / Pancreatic Cancer Metastatic1
2RecruitingTreatmentMetastatic Cancer Colorectal1
2RecruitingTreatmentMetastatic Cancers / Metastatic Castration Resistant Prostate Cancer1
2RecruitingTreatmentMetastatic Cancers / Recurrent Cancer / Salivary Gland Carcinoma1
2RecruitingTreatmentMetastatic Clear Cell Renal Cell Carcinoma1
2RecruitingTreatmentMetastatic Colorectal Cancers1
2RecruitingTreatmentMetastatic Melanoma3
2RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2RecruitingTreatmentMetastatic Renal Cancer1
2RecruitingTreatmentMetastatic Renal Cell Cancer / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Skin Melanoma1
2RecruitingTreatmentMetastatic Renal Cell Carcinoma3
2RecruitingTreatmentMetastatic Renal Cell Carcinoma / Renal Cell Carcinoma Associated With Xp11.2 Translocations/TFE3 Gene Fusions / Stage III Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / TFE3 Gene Translocation / TFEB Gene Translocation1
2RecruitingTreatmentMetastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic1
2RecruitingTreatmentMetastatic Urothelial Cancer1
2RecruitingTreatmentMicrosatellite Instability / Neoplasms, Head and Neck / Penile Neoplasms / Renal Cell Adenocarcinoma / Skin Neoplasms1
2RecruitingTreatmentMucosal Melanoma1
2RecruitingTreatmentMuscle Invasive Bladder Cancer1
2RecruitingTreatmentName Human Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Stage II Oropharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Oral Cavity Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Laryngeal Squamous Cell Carcinoma / Stage IV Oral Cavity Squamous Cell Carcinoma / Stage IV Oropharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Oral Cavity Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Oral Cavity Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVC Hypopharyngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Oral Cavity Squamous Cell Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma1
2RecruitingTreatmentNasopharyngeal Carcinoma2
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Skin Cancers1
2RecruitingTreatmentNon Small Cell Lung Cancer Stage IIIB1
2RecruitingTreatmentNon-Small Lung Cancer, Epigenetic Therapy1
2RecruitingTreatmentNon-Squamous Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage I Non-Small Cell Lung Cancer AJCC v7 / Stage IA Non-Small Cell Lung Carcinoma / Stage IA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v71
2RecruitingTreatmentOral Cavity SCC1
2RecruitingTreatmentOther Disorders of Kidney and Ureter / Renal Medullary Carcinoma1
2RecruitingTreatmentProstate Cancer4
2RecruitingTreatmentProstate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma1
2RecruitingTreatmentRecurrent Head and Neck Cancer1
2RecruitingTreatmentRecurrent Head and Neck Squamous Cell Carcinoma1
2RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentRecurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
2RecruitingTreatmentRecurrent Uterine Corpus Carcinoma / Stage III Uterine Corpus Cancer AJCC v7 / Stage IIIA Uterine Corpus Cancer AJCC v7 / Stage IIIB Uterine Corpus Cancer AJCC v7 / Stage IIIC Uterine Corpus Cancer AJCC v7 / Stage IIIC1 Uterine Corpus Cancer AJCC v7 / Stage IIIC2 Uterine Corpus Cancer AJCC v7 / Stage IV Uterine Corpus Cancer AJCC v7 / Stage IVA Uterine Corpus Cancer AJCC v7 / Stage IVB Uterine Corpus Cancer AJCC v71
2RecruitingTreatmentRenal Cancers1
2RecruitingTreatmentRenal Cell Adenocarcinoma3
2RecruitingTreatmentSalivary Gland Cancers1
2RecruitingTreatmentSarcomas1
2RecruitingTreatmentStage II Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage IV Bladder Urothelial Carcinoma AJCC v71
2RecruitingTreatmentStage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2RecruitingTreatmentStage III Hepatocellular Carcinoma AJCC v8 / Stage IIIA Hepatocellular Carcinoma AJCC v8 / Stage IIIB Hepatocellular Carcinoma AJCC v7 / Stage IIIC Hepatocellular Carcinoma AJCC v7 / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v81
2RecruitingTreatmentSystemic Connective Tissue Disorders1
2RecruitingTreatmentThymic Carcinoma / Thymoma Type B3 / Type B3 Thymoma and Thymic Carcinoma1
2RecruitingTreatmentThyroid Cancers1
2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentUntreated Metastatic Pancreatic Ductal Adenocarcinoma1
2RecruitingTreatmentVarious Advanced Cancer1
2SuspendedTreatmentGastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Metastatic Liposarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Liposarcoma1
2SuspendedTreatmentC-MET Gene Amplification / MET Exon 14 Mutation / Metastatic Non-Squamous Non-Small Cell Lung Carcinoma / Recurrent Non-Squamous Non-Small Cell Lung Carcinoma / RET/PTC Rearrangement / ROS1 Gene Rearrangement / Stage IV Non-Small Cell Lung Cancer AJCC v71
2SuspendedTreatmentSmoldering Multiple Myeloma (SMM)1
2TerminatedDiagnosticBrain Metastasis / Melanoma1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Metastatic Lung Cancer1
2TerminatedTreatmentSolid Tumors Induced by Prior Radiation Exposure1
2WithdrawnTreatmentAdvanced Non-Small Cell Lung Cancer / Metastatic Non-Small Cell Lung Cancer / Neoplasms, Lung1
2WithdrawnTreatmentCervical Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oesophageal Carcinoma / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma1
2WithdrawnTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
2WithdrawnTreatmentLung Cancer, Nonsmall Cell, Stage I1
2WithdrawnTreatmentMelanoma1
2WithdrawnTreatmentMelanoma / Metastatic Melanoma1
2WithdrawnTreatmentMultiple Myeloma (MM)1
2WithdrawnTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2WithdrawnTreatmentRenal Cell Adenocarcinoma1
2, 3Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
2, 3RecruitingTreatmentAdult Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome With Excess Blasts-2 / Untreated Adult Acute Myeloid Leukemia1
2, 3RecruitingTreatmentColorectal Cancers1
2, 3RecruitingTreatmentMelanoma2
2, 3RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
2, 3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v71
2, 3SuspendedTreatmentRecurrent Melanoma of the Skin / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3Active Not RecruitingTreatmentAdvanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
3Active Not RecruitingTreatmentAdvanced or Metastatic (Medically or Surgically Unresectable) Clear-cell Renal Cell Carcinoma1
3Active Not RecruitingTreatmentHepatocellular,Carcinoma / I.V Advanced Cancer1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
3Active Not RecruitingTreatmentLung Cancers3
3Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
3Active Not RecruitingTreatmentMelanoma6
3Active Not RecruitingTreatmentMelanoma / Skin Cancers1
3Active Not RecruitingTreatmentMesothelioma1
3Active Not RecruitingTreatmentMultiple Myeloma (MM)1
3Active Not RecruitingTreatmentNon-Squamous Cell Non-small Cell Lung Cancer1
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
3Active Not RecruitingTreatmentSquamous Cell Non-small Cell Lung Cancer1
3Active Not RecruitingTreatmentStage IV or Recurrent Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentUnresectable or Metastatic Melanoma2
3Not Yet RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
3Not Yet RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
3Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
3RecruitingScreeningAdenocarcinoma of the Lung / Adenosquamous Lung Carcinoma / Large Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Squamous Cell Lung Carcinoma / Stage IB Squamous Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage II Squamous Cell Lung Carcinoma / Stage II Squamous Cell Lung Carcinoma AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIA Squamous Cell Lung Carcinoma / Stage IIA Squamous Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Squamous Cell Lung Carcinoma / Stage IIB Squamous Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Squamous Cell Lung Carcinoma / Stage IIIA Squamous Cell Lung Carcinoma AJCC v71
3RecruitingTreatmentBladder Cancers / BMS-986205 / Muscle-invasive Bladder Cancer1
3RecruitingTreatmentBRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3RecruitingTreatmentBrain Cancer1
3RecruitingTreatmentCancer, Advanced1
3RecruitingTreatmentComplete Response / Fallopian Tube Cancer / FIGO Stage III-IV / Newly Diagnosed / Ovarian Epithelial Cancer / Partial Response / Primary Peritoneal1
3RecruitingTreatmentEsophageal Cancers1
3RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
3RecruitingTreatmentHead and Neck Carcinoma2
3RecruitingTreatmentHepatocellular,Carcinoma / Liver Cancer1
3RecruitingTreatmentHodgkins Disease (HD)1
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)5
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs1
3RecruitingTreatmentMalignant Neoplasm of Stomach1
3RecruitingTreatmentMelanoma1
3RecruitingTreatmentMesothelioma1
3RecruitingTreatmentMetastatic Brain Tumors1
3RecruitingTreatmentNeoplasms, Brain1
3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v71
3RecruitingTreatmentRenal Cell Adenocarcinoma2
3RecruitingTreatmentSarcomatoid Renal Cell Carcinoma / Stage II Renal Cell Cancer / Stage II Renal Cell Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Unclassified Renal Cell Carcinoma1
3RecruitingTreatmentSquamous Non-Small Cell Lung Cancer1
3RecruitingTreatmentStage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v71
3RecruitingTreatmentUrothelial Cancer1
3RecruitingTreatmentVarious Advanced Cancer2
3TerminatedTreatmentHead and Neck Carcinoma1
3TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
3WithdrawnTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
3WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
4Active Not RecruitingOtherRenal Cell Adenocarcinoma1
4Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
4Not Yet RecruitingDiagnosticLung Cancers / Melanoma / Non-small Cell1
4Not Yet RecruitingTreatmentPancreatic Cancer Stage IV1
4RecruitingNot AvailableMetastatic Melanoma1
4RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Kidney / Renal Cancers / Renal Neoplasms1
4RecruitingTreatmentLung Cancers1
Not AvailableActive Not RecruitingNot AvailableInflammation, Brain1
Not AvailableActive Not RecruitingNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC) / Nivolumab Treatment in Expanded Use in Real World1
Not AvailableActive Not RecruitingTreatmentCancer, Breast1
Not AvailableAvailableNot AvailablePediatric Cancer1
Not AvailableCompletedNot AvailableMelanoma1
Not AvailableNo Longer AvailableNot AvailableMalignant Melanoma1
Not AvailableNo Longer AvailableNot AvailableNon-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer1
Not AvailableNo Longer AvailableNot AvailableStage III (Unresectable) or Stage IV Advanced Melanoma1
Not AvailableRecruitingNot AvailableAcral lentiginous melanoma / Mucosal Melanoma1
Not AvailableRecruitingNot AvailableDNA Damage / DNA Double Strand Break / HNSCC1
Not AvailableRecruitingNot AvailableMetastatic Cancers1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
InjectionIntravenous10 mg/1mL
SolutionIntravenous10 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US2013173223No2013-05-132033-05-13Us

Properties

State
Solid
Experimental Properties
PropertyValueSource
melting point (°C)80-90 ºC (based on IgG properties)McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282
boiling point (°C)Fab and Fc domains denaturates at 60 and 70 ºC respectivelyArnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility50 mg/mlHuman IgG purified. Product Information
isoelectric point6.1-8.5 Agrisera Information about IgG antibodies.

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Signal transducer activity
Specific Function
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. ...
Gene Name
PDCD1
Uniprot ID
Q15116
Uniprot Name
Programmed cell death protein 1
Molecular Weight
31646.635 Da
References
  1. Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116]

Drug created on February 24, 2015 16:02 / Updated on October 23, 2018 21:48