Identification

Name
Nivolumab
Accession Number
DB09035  (DB06132)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Nivolumab is a fully human IgG4 monoclonal antibody that acts as an immunomodulator by blocking ligand activation of programmed cell death 1 (PD-1) receptor on T cells. It is indicated for use in patients with unresectable (cannot be surgically removed) or metastatic melanoma who no longer respond to other drugs. Nivolumab is administered as an intravenous infusion over 60 minutes every 2 weeks.

Protein structure
Db09035
Protein chemical formula
C6362H9862N1712O1995S42
Protein average weight
143597.3811 Da
Sequences
>Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK
>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
External IDs
BMS-936558 / GTPL7335 / MDX-1106 / ONO-4538
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada
OpdivoInjection10 mg/mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUs
OpdivoSolution10 mgIntravenousBristol Myers Squibb2015-10-23Not applicableCanada
OpdivoInjection10 mg/mLIntravenousE.R. Squibb & Sons, L.L.C.2014-12-22Not applicableUs
Categories
UNII
31YO63LBSN
CAS number
946414-94-4

Pharmacology

Indication

Nivolumab is indicated for the treatment of unresectable or metastatic melanoma for patients who no longer respond to treatment with other drugs. It is intended for use in patients who have been previously treated with ipilimumab and is used for melanoma patients after treatment with ipilimumab and a BRAF inhibitor in patients whose tumors express BRAF V600 gene mutations. Historically there have been very few effective treatments for advanced melanoma, which is why this product was approved under an FDA accelerated program to allow earlier patient access.

Structured Indications
Pharmacodynamics
Not Available
Mechanism of action

Nivolumab is a human immunoglobulin G4 (IgG4) monoclonal antibody that binds to the programmed cell death 1 (PD-1) receptor and selectively blocks interaction with its programmed death ligands PD-L1 and PD-L2. Upregulation of PD-1 ligands occurs in some tumors and signalling through this pathway can contribute to inhibition of active T-cell immune surveillance of tumour tissue. The inhibitory effect of PD-1 and its ligands occurs through the promotion of apoptosis in antigen specific T cells while simultaneously blocking apoptosis in suppressor T cells. Blocking PD-1 activity has been shown to lead to decreased tumour growth in mouse tumour models.

TargetActionsOrganism
AProgrammed cell death protein 1
antibody
Human
Absorption

The intended route of administration is intravenous, therefore bioavailability is expected to be 100%.

Volume of distribution

8.0 L

Protein binding
Not Available
Metabolism

As nivolumab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of elimination

Renal clearance is negligible as vedolizumab is a high molecular weight protein.

Half life

26.7 days

Clearance

9.5 mL/hr

Toxicity

Based on data from animal studies, there is risk of fetal harm when administered to pregnant women. It is therefore advisable for pregnant women to use contraception during treatment and for 5 months afterwards. There have been reported cases of severe pneumonitis or interstitial lung disease, including fatal cases, with the use of nivolumab during clinical trials. Therefore, patients taking this drug should be monitored for signs and symptoms of pneumonitis. During clinical trials there have also been reports of the development of immune-mediated colitis, immune-mediated hepatitis with increased liver test abnormalities, immune-mediated nephritis and renal dysfunction, immune-mediated hypothyroidism and hyperthyroidism, and rare cases of other immune-mediated reactions such as pancreatitis, uveitis, demyelination, autoimmune neuropathy, adrenal insufficiency, and facial and abducens nerve paresis.

Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Nivolumab.Approved
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Nivolumab.Experimental
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Nivolumab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Nivolumab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Nivolumab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Nivolumab.Approved
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Nivolumab.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Nivolumab.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Nivolumab.Approved, Investigational
CymarinCymarin may decrease the cardiotoxic activities of Nivolumab.Experimental
DeslanosideDeslanoside may decrease the cardiotoxic activities of Nivolumab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Nivolumab.Approved, Investigational
DigoxinDigoxin may decrease the cardiotoxic activities of Nivolumab.Approved
Digoxin Immune Fab (Ovine)Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nivolumab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Nivolumab.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Nivolumab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Nivolumab.Investigational
GitoformateGitoformate may decrease the cardiotoxic activities of Nivolumab.Experimental
Hepatitis A VaccineThe therapeutic efficacy of Hepatitis A Vaccine can be decreased when used in combination with Nivolumab.Approved
Hepatitis B Vaccine (Recombinant)The therapeutic efficacy of Hepatitis B Vaccine (Recombinant) can be decreased when used in combination with Nivolumab.Approved, Withdrawn
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Nivolumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Nivolumab.Investigational
Lanatoside CLanatoside C may decrease the cardiotoxic activities of Nivolumab.Experimental
MetildigoxinMetildigoxin may decrease the cardiotoxic activities of Nivolumab.Experimental
OleandrinOleandrin may decrease the cardiotoxic activities of Nivolumab.Experimental, Investigational
OuabainOuabain may decrease the cardiotoxic activities of Nivolumab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Nivolumab.Approved, Vet Approved
PeruvosidePeruvoside may decrease the cardiotoxic activities of Nivolumab.Experimental
ProscillaridinProscillaridin may decrease the cardiotoxic activities of Nivolumab.Experimental
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Nivolumab.Approved
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Nivolumab.Investigational
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Nivolumab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Nivolumab.Approved
Salmonella typhi ty21a live antigenThe therapeutic efficacy of Salmonella typhi ty21a live antigen can be decreased when used in combination with Nivolumab.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Nivolumab.Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Nivolumab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Nivolumab.Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Nivolumab.Approved, Investigational
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Nivolumab.Approved
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Nivolumab.Approved
Food Interactions
Not Available

References

General References
  1. Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116]
  2. Tsai KK, Zarzoso I, Daud AI: PD-1 and PD-L1 antibodies for melanoma. Hum Vaccin Immunother. 2014;10(11):3111-6. doi: 10.4161/21645515.2014.983409. [PubMed:25625924]
  3. Topalian SL, Sznol M, McDermott DF, Kluger HM, Carvajal RD, Sharfman WH, Brahmer JR, Lawrence DP, Atkins MB, Powderly JD, Leming PD, Lipson EJ, Puzanov I, Smith DC, Taube JM, Wigginton JM, Kollia GD, Gupta A, Pardoll DM, Sosman JA, Hodi FS: Survival, durable tumor remission, and long-term safety in patients with advanced melanoma receiving nivolumab. J Clin Oncol. 2014 Apr 1;32(10):1020-30. doi: 10.1200/JCO.2013.53.0105. Epub 2014 Mar 3. [PubMed:24590637]
External Links
KEGG Drug
D10316
PubChem Substance
347910393
ChEMBL
CHEMBL2108738
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Nivolumab
ATC Codes
L01XC17 — Nivolumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (315 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Not Yet RecruitingTreatmentHIV / AIDS / Immunosuppression / Kaposi s Sarcoma (KS)1
0Not Yet RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
0RecruitingTreatmentLarynx / Lip, Oral Cavity and Pharynx1
0RecruitingTreatmentLiver Cancer1
0RecruitingTreatmentMelanoma (Skin) / Skin Cancers1
0RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
0RecruitingTreatmentRenal Cancers1
1Active Not RecruitingBasic ScienceAdvanced Melanoma / Metastatic Melanoma1
1Active Not RecruitingBasic ScienceRenal Cell Adenocarcinoma1
1Active Not RecruitingOtherSevere Sepsis1
1Active Not RecruitingTreatmentCancer, Breast / Cancer, Ovarian / Carcinoma, Colorectal / Carcinoma, Pancreatic / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Prostate Cancer / Renal Cell Adenocarcinoma / Tumors, Solid1
1Active Not RecruitingTreatmentChronic Myeloid Leukemia (CML)1
1Active Not RecruitingTreatmentCcRCC / Clear Cell Renal Cell Carcinoma / RCC / Renal Cancers / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentGlioblastomas / Gliosarcoma / Supratentorial Glioblastoma1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Castration-resistant Prostrate Cancer (mCRPC) / Metastatic Melanoma (MEL) / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1Active Not RecruitingTreatmentMalignant Lymphomas / Malignant Solid Tumours1
1Active Not RecruitingTreatmentMalignant Melanoma1
1Active Not RecruitingTreatmentMelanoma (Skin)2
1Active Not RecruitingTreatmentTumors, Solid1
1CompletedTreatmentAdvanced Solid Tumors / Recurrent Solid Tumors1
1CompletedTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma / Prostate Cancer / Renal Cancers1
1CompletedTreatmentMalignant Melanoma1
1CompletedTreatmentMalignant Solid Tumours1
1CompletedTreatmentNeoplasms by Site1
1Not Yet RecruitingTreatmentBladder Cancers1
1Not Yet RecruitingTreatmentCancer, Advanced1
1Not Yet RecruitingTreatmentFollicular Lymphoma (FL)1
1Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms / Renal Cell Adenocarcinoma / Urothelial Neoplasm1
1Not Yet RecruitingTreatmentLeptomeningeal Disease / Melanoma and Other Malignant Neoplasms of Skin1
1Not Yet RecruitingTreatmentLocally Advanced Hepatocellular Carcinoma1
1Not Yet RecruitingTreatmentNeuroblastomas1
1Not Yet RecruitingTreatmentRecurrent Non-small Cell Lung Cancer1
1RecruitingOtherMelanoma1
1RecruitingTreatmentALK-positive NSCLC1
1RecruitingTreatmentAcute Myeloid Leukemia and Myelodysplastic Syndrome1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
1RecruitingTreatmentAdenocarcinomas / Advanced NSCLC / Carcinoma, Adenosquamous / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Squamous Cell Carcinoma (SCC)1
1RecruitingTreatmentAdult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Recurrent Classical Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentAdult Solid Neoplasm / Childhood Solid Neoplasm / Neoplasms, Metastatic1
1RecruitingTreatmentAdvanced Cancers1
1RecruitingTreatmentAdvanced Malignancies1
1RecruitingTreatmentAdvanced Solid Tumors4
1RecruitingTreatmentAdvanced Solid Tumors (Part A/B/C/D) / Melanoma (Part E) / Non-small Cell Lung Cancer (NSCLC) and Melanoma (Part E) / Non-small Cell Lung Cancer (Part E) / Squamous Cell Cancer of the Head and Neck (Part E)1
1RecruitingTreatmentAdvanced Solid Tumors, Including But Not Limited to Lung Cancer / Cancer, Ovarian / Colorectal Cancers / Glioblastoma Multiforme / Head and Neck Carcinoma / Head and Neck Squamous Cell Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Gliomas / Malignant Neoplasm of Pancreas / Melanoma / Renal Cell Adenocarcinoma1
1RecruitingTreatmentAdvanced Solid Tumors / Cancers1
1RecruitingTreatmentAdvanced Solid Tumors / Head and Neck Carcinoma, Squamous Cell / Lung Cancer Non-Small Cell Cancer (NSCLC) / Triple-Negative Breast Neoplasms1
1RecruitingTreatmentAdvanced or Metastatic Solid Tumors2
1RecruitingTreatmentAggressive Non-Hodgkin Lymphoma / Neoplasms, Advanced Solid / Recurrent Solid Neoplasm / Refractory Mantle Cell Lymphoma / T-Cell Non-Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentB Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Refractory Adult Acute Lymphoblastic Leukemia / Refractory Childhood Acute Lymphoblastic Leukemia1
1RecruitingTreatmentB Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL11
1RecruitingTreatmentBRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1RecruitingTreatmentBladder Carcinoma / Colorectal Cancers / Salivary Gland Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentBladder Tumors / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Melanoma / Melanoma / Skin Cancers / Transitional Cell Carcinoma of the Bladder / Urinary Bladder Cancer1
1RecruitingTreatmentBreast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm1
1RecruitingTreatmentCancer, Advanced2
1RecruitingTreatmentCancer, Ovarian / Fallopian Tubes / Primary Peritoneal Cancer / Recurrent Ovarian Cancer1
1RecruitingTreatmentCancers1
1RecruitingTreatmentChordomas1
1RecruitingTreatmentClassical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Solid Neoplasms / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Urothelial Carcinoma / Stage III Penile Cancer / Stage III Renal Cell Cancer / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Urethral Cancer / Stage IIIa Penile Cancer / Stage IIIb Penile Cancer / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Urothelial Carcinoma / Stage IV Penile Cancer / Stage IV Renal Cell Cancer / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Urethral Cancer / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma / Stage I Renal Cell Cancer / Stage II Renal Cell Cancer / Stage III Renal Cell Cancer1
1RecruitingTreatmentEBV Related Hodgkin's Lymphoma / EBV Related Lymphoma / EBV Related Non-Hodgkin's Lymphoma / EBV-Related PTLD / Lymphoma, Hodgkins / Lymphoproliferative Disorders / NonHodgkin Lymphoma1
1RecruitingTreatmentEsophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Stomach1
1RecruitingTreatmentEsophageal Cancers / Lung Cancers / Malignant Neoplasm of Stomach / Renal Cancers1
1RecruitingTreatmentFallopian Tubes / High Grade Serous Ovarian / Primary Peritoneal Cancer1
1RecruitingTreatmentFollicular Lymphoma (FL)1
1RecruitingTreatmentGlioblastomas2
1RecruitingTreatmentGlioblastomas / Gliosarcoma / Recurrent Brain Neoplasm1
1RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1RecruitingTreatmentHematopoietic Cell Transplantation Recipient / Myelodysplastic Syndrome / Myeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Lymphocytic Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma1
1RecruitingTreatmentHepatocellular,Carcinoma1
1RecruitingTreatmentHuman Papillomavirus Positive Anal Carcinoma / Human Papillomavirus Positive Cervical Carcinoma / Human Papillomavirus Positive Oropharyngeal Carcinoma / Human Papillomavirus Positive Penile Carcinoma / Human Papillomavirus Positive Vulvar Carcinoma / Human Papillomavirus-Related Carcinoma1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1RecruitingTreatmentLymphoma, Hodgkins1
1RecruitingTreatmentMalignancies, Hematologic1
1RecruitingTreatmentMalignant Gliomas1
1RecruitingTreatmentMalignant Lymphomas / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Metastatic Renal Cell Cancer / Recurrent Bladder Carcinoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Renal Cell Carcinoma Recurrent / Stage III Bladder Cancer / Stage III Lymphoma / Stage III Non-Small Cell Lung Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Bladder Cancer / Stage IV Lymphoma / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Bladder Cancer / Stage IVB Bladder Cancer / Stages III Skin Melanoma / Unresectable Head and Neck Squamous Cell Carcinoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentMelanoma2
1RecruitingTreatmentMetastatic Colorectal Cancers1
1RecruitingTreatmentMetastatic Malignant Neoplasm in the Brain / Metastatic Malignant Neoplasm in the Spine / Stage IV Skin Melanoma1
1RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
1RecruitingTreatmentMultiple Myeloma (MM)1
1RecruitingTreatmentNeoplasms Malignant1
1RecruitingTreatmentNeoplasms, Breast / Neoplasms, Pancreatic1
1RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentStage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma1
1RecruitingTreatmentStage IV Small Cell Lung Cancer1
1RecruitingTreatmentTumors, Solid1
1TerminatedBasic ScienceNeoplasms, Colorectal1
1TerminatedTreatmentAstrocytomas / Glioblastomas / Malignant Gliomas1
1Unknown StatusTreatmentAdvanced Solid Tumors / Recurrent Solid Tumors1
1WithdrawnTreatmentMalignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)1
1WithdrawnTreatmentMetastatic Melanoma1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1, 2Active Not RecruitingTreatmentCancer, Advanced1
1, 2Active Not RecruitingTreatmentCancer, Advanced / Hepatocellular,Carcinoma1
1, 2Active Not RecruitingTreatmentCancer, Breast / Triple-Negative Breast Cancer (TNBC)1
1, 2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1, 2Active Not RecruitingTreatmentLymphoma, Hodgkins1
1, 2Active Not RecruitingTreatmentMetastatic Cancers1
1, 2Not Yet RecruitingTreatmentAdenocarcinoma of the Lung / Lung Cancers1
1, 2Not Yet RecruitingTreatmentAdvanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm1
1, 2Not Yet RecruitingTreatmentAdvanced or Metastatic Malignancies1
1, 2Not Yet RecruitingTreatmentAntibodies, Neoplasm1
1, 2Not Yet RecruitingTreatmentCervical Cancers / Locally Advanced Cervical Cancer1
1, 2Not Yet RecruitingTreatmentChondrosarcomas / Ewing's Sarcoma (ES) / Liposarcoma / Sarcoma, Osteogenic / Undifferentiated Pleomorphic Sarcoma1
1, 2Not Yet RecruitingTreatmentColorectal Cancers1
1, 2Not Yet RecruitingTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Not Yet RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Small Cell Lung Cancer Extensive Stage1
1, 2Not Yet RecruitingTreatmentMelanoma1
1, 2Not Yet RecruitingTreatmentMelanoma / Melanoma Stage Iii / Melanoma Stage Iv1
1, 2Not Yet RecruitingTreatmentMetastatic Melanoma1
1, 2Not Yet RecruitingTreatmentNon Small Cell Lung Cancer Metastatic1
1, 2Not Yet RecruitingTreatmentRefractory Diffuse Large B-Cell Lymphoma / Relapsed Diffuse Large B-Cell Lymphoma1
1, 2RecruitingPreventionStage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2RecruitingTreatmentALK Gene Mutation / EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1, 2RecruitingTreatmentALK Gene Translocation / EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Translocation / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v71
1, 2RecruitingTreatmentAdvanced B-cell NHL / Advanced Solid Tumors1
1, 2RecruitingTreatmentAdvanced Malignancies / Metastatic Malignancy1
1, 2RecruitingTreatmentAdvanced Malignancies / Select Advanced Malignancies1
1, 2RecruitingTreatmentAdvanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma1
1, 2RecruitingTreatmentAdvanced or Metastatic Colorectal Cancer (CRC) / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Ligand 1 (PD-L1) Inhibitor / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Protein 1 (PD-1) Inhibitor / Advanced or Metastatic Solid Tumors / Non-Small Cell Lung Cancer (NSCLC; Squamous or Nonsquamous) / Pancreatic Ductal Adenocarcinoma (PDAC)1
1, 2RecruitingTreatmentB Cell NHL Including DLBCL / Carcinoma, Squamous Cell of Head and Neck / Glioblastomas / HL / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms, Colorectal / Neoplasms, Ovarian1
1, 2RecruitingTreatmentBiallelic Mismatch Repair Deficiency (bMMRD) Positive Patients / Refractory or Recurrent Hypermutated Malignancies1
1, 2RecruitingTreatmentBroad Solid Tumor1
1, 2RecruitingTreatmentCANCER,NOS1
1, 2RecruitingTreatmentCancer of Rectum1
1, 2RecruitingTreatmentCancer, Advanced3
1, 2RecruitingTreatmentCancer, Advanced / Carcinoma, Colorectal / Endometrial / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Renal Cell Adenocarcinoma / Uterine1
1, 2RecruitingTreatmentCancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1, 2RecruitingTreatmentCancers4
1, 2RecruitingTreatmentCancers / Carcinoma NOS / HCC / Hepatocellular,Carcinoma / Tumors, Solid1
1, 2RecruitingTreatmentCancers / Malignancies / Neoplasms / Tumors1
1, 2RecruitingTreatmentCancers / Melanoma / Metastatic Melanoma / Neoplasm of Lung / Non Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentCarcinoma´╝îNon-Small-Cell Lung / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentChildhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Non-Hodgkin's lymphoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1, 2RecruitingTreatmentChildren, Adolescents and Young Adults With Refractory or Recurrent Malignancies1
1, 2RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1, 2RecruitingTreatmentClear Cell Renal Cell Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1, 2RecruitingTreatmentColorectal Cancer (CRC) / Colorectal Cancer (CRC)-Enrollment Completed / Glioblastoma (GBM) (Phase ll Only) / Glioblastoma (GBM) (Phase ll Only)-Enrollment Completed / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma of Head and Neck / Malignant Neoplasm of Colon / Melanoma / Ovarian Carcinoma / Renal Cell Carcinoma (RCC) (Phase ll Only) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentEGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1, 2RecruitingTreatmentExtensive-Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentGastroesophageal Junction Region (GEJ) Cancer / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentGlioblastomas / Hepatocellular Carcinoma Recurrent / Non-Small Cell Lung Cancer Recurrent / Tumors, Solid1
1, 2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2RecruitingTreatmentHepatic Metastases / Uveal Melanoma1
1, 2RecruitingTreatmentHepatocellular Carcinoma (HCC)1
1, 2RecruitingTreatmentHepatocellular,Carcinoma2
1, 2RecruitingTreatmentImmunotherapy / Neoplasms, Head and Neck1
1, 2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Leukemias / Myelodysplastic Syndrome1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Tumors, Solid1
1, 2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
1, 2RecruitingTreatmentMSS / RAS-mutant Colorectal Cancer1
1, 2RecruitingTreatmentMalignant Lymphomas / Multiple Myeloma (MM)1
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentMalignant Neoplasms of Urinary Tract / Other Disorders of Kidney and Ureter / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentMalignant Solid Tumours2
1, 2RecruitingTreatmentMelanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma1
1, 2RecruitingTreatmentMetastatic Brain Cancer1
1, 2RecruitingTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2RecruitingTreatmentMetastatic Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2RecruitingTreatmentMultiple Myeloma (MM)1
1, 2RecruitingTreatmentMyelodysplastic Syndromes1
1, 2RecruitingTreatmentNeoplasms by Site1
1, 2RecruitingTreatmentNeoplasms, Hematologic2
1, 2RecruitingTreatmentNon-Hodgkin's Disease1
1, 2RecruitingTreatmentOvarian Cancer Metastatic1
1, 2RecruitingTreatmentPancreatic Adenocarcinoma Metastatic1
1, 2RecruitingTreatmentProstate Cancer1
1, 2RecruitingTreatmentRenal Cell Adenocarcinoma2
1, 2RecruitingTreatmentSarcoma, Bone / Soft Tissue Sarcoma (STS)1
1, 2RecruitingTreatmentSquamous Cell Carcinoma of Esophagus1
1, 2RecruitingTreatmentStage III/IV Melanoma1
1, 2RecruitingTreatmentTumors, Solid1
1, 2RecruitingTreatmentVarious Advanced Cancer1
1, 2SuspendedTreatmentGrade 3a Follicular Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma1
1, 2TerminatedOtherTumors, Solid1
1, 2WithdrawnTreatmentSquamous Non-Small Cell Lung Cancer1
2Active Not RecruitingOtherLung Cancer Non-Small Cell Cancer (NSCLC)1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Stage IV Cervical Cancer / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer1
2Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
2Active Not RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer2
2Active Not RecruitingTreatmentAdvanced or Metastatic Melanoma1
2Active Not RecruitingTreatmentAnal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Recurrent Anal Canal Carcinoma / Stage IV Anal Canal Cancer1
2Active Not RecruitingTreatmentDocumented Stage III NSCLC, Amenable to Concomitant or Sequential Chemoradiotherapy / Locally Advanced Non-Small Cell Lung Cancer1
2Active Not RecruitingTreatmentHodgkins Disease (HD)1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Metastatic Lung Cancer1
2Active Not RecruitingTreatmentMalignant Lymphomas1
2Active Not RecruitingTreatmentMelanoma1
2Active Not RecruitingTreatmentMelanoma / Metastatic Brain Tumors1
2Active Not RecruitingTreatmentMelanoma / Oligometastatic Melanoma1
2Active Not RecruitingTreatmentMesothelioma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Unresectable Melanoma1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)1
2Active Not RecruitingTreatmentMyeloproliferative Disorders1
2Active Not RecruitingTreatmentNasopharyngeal Nonkeratinizing Carcinoma / Recurrent Nasopharyngeal Undifferentiated Carcinoma / Recurrent Nasopharynx Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Nasopharyngeal Undifferentiated Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Nasopharyngeal Undifferentiated Carcinoma / Stage IVA Nasopharyngeal Carcinoma / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma / Stage IVC Nasopharyngeal Carcinoma AJCC v71
2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
2Active Not RecruitingTreatmentPreviously Treated Metastatic Adenocarcinoma of the Pancreas1
2Active Not RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
2Active Not RecruitingTreatmentSquamous Cell Non-small Cell Lung Cancer1
2Active Not RecruitingTreatmentTumors, Solid1
2Active Not RecruitingTreatmentVarious Advanced Cancer1
2Active Not RecruitingTreatmentRefractory, metastatic Colorectal cancer1
2CompletedTreatmentGlioblastoma Multiforme1
2CompletedTreatmentMalignant Pleural Mesothelioma (MPM)1
2Enrolling by InvitationTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Carcinoma1
2Not Yet RecruitingTreatmentActivated B-Cell-Like Diffuse Large B-Cell Lymphoma / ALK-Positive Large B-Cell Lymphoma / Atypical Burkitt/Burkitt-Like Lymphoma / Burkitt-Like Lymphoma With 11q Aberration / Diffuse Large B-Cell Lymphoma Activated B-Cell Type / Diffuse Large B-Cell Lymphoma Associated With Chronic Inflammation / Diffuse Large B-Cell Lymphoma Germinal Center B-Cell Type / Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Mucocutaneous Ulcer / Epstein-Barr Virus Positive Diffuse Large B-Cell Lymphoma of the Elderly / Epstein-Barr Virus-Positive Mucocutaneous Ulcer / Epstein-Barr Virus-Positive Neoplastic Cells Present / Germinal Center B-Cell-Like Diffuse Large B-Cell Lymphoma / High-Grade B-Cell Lymphoma With MYC and BCL2 and/or BCL6 Rearrangements / High-Grade B-Cell Lymphoma With MYC, BCL2, and BCL6 Rearrangements / Human Herpes Virus 8-Related Malignant Neoplasm / Human Herpesvirus-8-Positive Neoplastic Cells Present / Intravascular Large B-Cell Lymphoma / Large B-Cell Lymphoma With IRF4 Rearrangement / MYC-Negative B-Cell Lymphoma With 11q Aberration Resembling Burkitt Lymphoma / Plasmablastic Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma, Leg Type / Primary Diffuse Large B-Cell Lymphoma of the Central Nervous System / Primary Effusion Lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Lymphomatoid Granulomatosis / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Skin Ulcers / Small Intestinal B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Burkitt Lymphoma / Small Intestinal High Grade B-Cell Lymphoma, Not Otherwise Specified / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma1
2Not Yet RecruitingTreatmentAcral lentiginous melanoma / Mucosal Melanoma1
2Not Yet RecruitingTreatmentAdrenocortical Carcinoma / Genitourinary Cancers / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell1
2Not Yet RecruitingTreatmentAdvanced Pancreatic Cancer1
2Not Yet RecruitingTreatmentAnal Basaloid Carcinoma / Anal Canal Cloacogenic Carcinoma / Anal Margin Squamous Cell Carcinoma / Stage II Anal Canal Cancer AJCC v6 and v7 / Stage III Anal Canal Cancer AJCC v6 and v7 / Stage IIIA Anal Canal Cancer AJCC v6 and v7 / Stage IIIB Anal Canal Cancer AJCC v6 and v71
2Not Yet RecruitingTreatmentCancer, Breast1
2Not Yet RecruitingTreatmentCervical Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oesophageal Carcinoma / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma1
2Not Yet RecruitingTreatmentChondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentClassic Kaposi Sarcoma1
2Not Yet RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
2Not Yet RecruitingTreatmentEpstein-Barr Virus Infections / Malignant Lymphomas1
2Not Yet RecruitingTreatmentGastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours1
2Not Yet RecruitingTreatmentGiant Cell Glioblastoma / Gliosarcoma / Oligodendrogliomas / Recurrent Glioblastoma / Small Cell Glioblastoma1
2Not Yet RecruitingTreatmentHIV / AIDS / Non Small Cell Lung Cancer Metastatic / Non Small Cell Lung Cancer Stage IIIB1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2Not Yet RecruitingTreatmentLung Cancers1
2Not Yet RecruitingTreatmentLymphoma, Hodgkins1
2Not Yet RecruitingTreatmentMalignant Neoplasm of Pancreas2
2Not Yet RecruitingTreatmentMelanoma1
2Not Yet RecruitingTreatmentMelanoma Stage Iv1
2Not Yet RecruitingTreatmentMelanoma / Metastatic Melanoma1
2Not Yet RecruitingTreatmentMuscle Invasive Bladder Cancer1
2Not Yet RecruitingTreatmentNasopharyngeal Carcinoma1
2Not Yet RecruitingTreatmentNon Small Cell Lung Cancer Stage IIIB1
2Not Yet RecruitingTreatmentOther Disorders of Kidney and Ureter / Renal Medullary Carcinoma1
2Not Yet RecruitingTreatmentPreviously Treated Unresectable or Metastatic Cholangiocarcinoma and Pancreactic Cancer1
2Not Yet RecruitingTreatmentProstate Cancer3
2Not Yet RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2Not Yet RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer2
2Not Yet RecruitingTreatmentRecurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
2Not Yet RecruitingTreatmentRenal Cell Adenocarcinoma2
2Not Yet RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentStage I Hodgkin Lymphoma / Stage IA Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma1
2Not Yet RecruitingTreatmentStage IV Melanoma / Unresectable Stage III Melanoma1
2Not Yet RecruitingTreatmentThymic Carcinoma / Thymoma Type B3 / Type B3 Thymoma and Thymic Carcinoma1
2Not Yet RecruitingTreatmentVarious Advanced Cancer1
2RecruitingDiagnosticBrain Metastasis / Melanoma1
2RecruitingTreatmentAcinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Endometrial Adenocarcinomas / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metastatic Malignant Neoplasm of Unknown Primary Origin / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Squamous Cell Carcinoma1
2RecruitingTreatmentAcute Adult T-Cell Leukemia/Lymphoma / Adult T-Cell Leukemia/Lymphoma / CD3 Positive / CD4-Positive Neoplastic Cells Present / Chronic Adult T-Cell Leukemia/Lymphoma / HTLV-1 Infection / Hypercalcemia / Lymphomatous Adult T-Cell Leukemia/Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Smoldering Adult T-Cell Leukemia/Lymphoma1
2RecruitingTreatmentAdenocarcinoma of the Lung / Lung Cancers / Non-Squamous Non-Small Cell Lung Cancer (NSCLC)1
2RecruitingTreatmentAdenocarcinoma of the Pancreas1
2RecruitingTreatmentAdenocarcinomas1
2RecruitingTreatmentAdnexal Carcinoma / Apocrine Carcinoma / Carcinoma, Adenoid Cystic / Eccrine Porocarcinoma / Extraocular Cutaneous Sebaceous Carcinoma / Hidradenocarcinoma / Keratoacanthoma / Malignant sweat gland neoplasm / Microcystic Adnexal Carcinoma / Neuroendocrine Carcinoma of the Skin / NK-Cell Lymphoma, Unclassifiable / Non-Melanomatous Lesion / Paget's Disease / Papillary Adenocarcinoma / Primary Cutaneous Mucinous Carcinoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Refractory Mycosis Fungoides / Refractory Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory T-Cell Non-Hodgkin Lymphoma / Sezary Syndrome / Signet Ring Cell Carcinoma / Skin Basal Cell Carcinoma / Skin Basosquamous Cell Carcinoma / Skin Squamous Cell Carcinoma / Spiradenocarcinoma / Squamous Cell Carcinoma of Unknown Primary Origin / Stage III Skin Cancer / Stage IV Skin Cancer / Sweat Gland Carcinoma / Trichilemmocarcinoma / Vulvar Squamous Cell Carcinoma1
2RecruitingTreatmentAdult Acute Myeloid Leukemia in Remission1
2RecruitingTreatmentAdult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / CD30-Positive Neoplastic Cells Present / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Post-Transplant Lymphoproliferative Disorder / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Hodgkin Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Non-Hodgkin Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Refractory Hodgkin Lymphoma / Refractory Non-Hodgkin's lymphoma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2RecruitingTreatmentAdvanced Gastric Cancer1
2RecruitingTreatmentAdvanced Malignant Neoplasm / Advanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Uterine Neoplasm / Melanoma / Oesophageal Carcinoma / Ovarian Carcinoma / Plasma Cell Myeloma / Prostate Cancer / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Solid Neoplasm / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Neoplasm / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Solid Neoplasms / Thyroid Gland Carcinoma / Uterine Corpus Cancer1
2RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
2RecruitingTreatmentAdvanced Renal Cell Carcinoma1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentAdvanced Stage Non-small Cell Lung Cancer1
2RecruitingTreatmentBiliary Tract Cancer / Biliary Tract Neoplasms1
2RecruitingTreatmentBiliary Tract Neoplasms1
2RecruitingTreatmentBladder Cancers1
2RecruitingTreatmentBladder Cancers / Melanoma1
2RecruitingTreatmentBladder Cancers / Transitional Cell Carcinoma1
2RecruitingTreatmentBlastic Plasmacytoid Dendritic Cell Neoplasm (BPDCN) / Hepatosplenic T-Cell Lymphoma / HTLV-1 Infection / NK-Cell Lymphoma, Unclassifiable / Primary Systemic Anaplastic Large Cell Lymphoma, ALK-Negative / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Angioimmunoblastic T-cell Lymphoma / Recurrent Enteropathy-Associated T-Cell Lymphoma / Recurrent Mycosis Fungoides / Refractory Adult T-Cell Leukemia/Lymphoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Angioimmunoblastic T-cell Lymphoma / Refractory Enteropathy-Associated T-Cell Lymphoma / Refractory Mycosis Fungoides / Refractory Nasal Type Extranodal NK/T-Cell Lymphoma / Refractory Peripheral T-Cell Lymphoma, Not Otherwise Specified1
2RecruitingTreatmentBrain Metastases, Adult / Clear-cell Metastatic Renal Cell Carcinoma / Non Small Cell Lung Cancer Metastatic1
2RecruitingTreatmentCD (Cluster of Differentiation) 30-Positive Neoplastic Cells Present / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
2RecruitingTreatmentCancer, Advanced2
2RecruitingTreatmentCancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma1
2RecruitingTreatmentCancer, Breast1
2RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm1
2RecruitingTreatmentCancers1
2RecruitingTreatmentCancers / Neoplasia / Neoplasms / Tumors1
2RecruitingTreatmentCarcinoma´╝îNon-Small-Cell Lung / Large Cell Lung Carcinoma Metastatic / Lung adenocarcinoma metastatic / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Lung Cancer1
2RecruitingTreatmentChordomas / Ependymomas / Meningiomas1
2RecruitingTreatmentChromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
2RecruitingTreatmentClassical Hodgkin Lymphoma2
2RecruitingTreatmentClassical Hodgkin Lymphoma / Hematopoietic Cell Transplantation Recipient / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
2RecruitingTreatmentClassical Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma / Stage III Hodgkin Lymphoma / Stage IIIA Hodgkin Lymphoma / Stage IIIB Hodgkin Lymphoma / Stage IV Hodgkin Lymphoma / Stage IVA Hodgkin Lymphoma / Stage IVB Hodgkin Lymphoma1
2RecruitingTreatmentClear Cell Metastatic Renal Cell Carcinoma1
2RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
2RecruitingTreatmentColon Carcinoma1
2RecruitingTreatmentEGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentGastrointestinal Stromal Tumors1
2RecruitingTreatmentGastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Metastatic Liposarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Liposarcoma1
2RecruitingTreatmentHER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma1
2RecruitingTreatmentHaematological Malignancies1
2RecruitingTreatmentHead and Neck Carcinoma2
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentHepatocellular,Carcinoma1
2RecruitingTreatmentHepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs1
2RecruitingTreatmentHodgkins Disease (HD)2
2RecruitingTreatmentKidney Cancer Metastatic / Kidney Cancer, Stage IV / Renal Cancers1
2RecruitingTreatmentLeptomeningeal Carcinomatosis / Melanoma1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML) / Leukemias1
2RecruitingTreatmentLeukemias2
2RecruitingTreatmentLeukemias / Myelodysplastic Syndrome1
2RecruitingTreatmentLimited Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)10
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non Small Cell Lung Cancer Recurrent / Non-Small Cell Carcinoma of Lung, TNM Stage 4 / Non-Small-Cell Lung Cancer Metastatic1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-squamous Cell Lung Cancer / Squamous Cell Carcinoma of Lung1
2RecruitingTreatmentLung Squamous Cell Carcinoma Stage IV / Nonsquamous Nonsmall Cell Neoplasm of Lung1
2RecruitingTreatmentMalignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer1
2RecruitingTreatmentMicrosatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer1
2RecruitingTreatmentMajor Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma1
2RecruitingTreatmentMalignant Lymphomas1
2RecruitingTreatmentMalignant Melanoma1
2RecruitingTreatmentMalignant Melanoma Stage III1
2RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2RecruitingTreatmentMelanoma6
2RecruitingTreatmentMelanoma / Uveal Melanoma1
2RecruitingTreatmentMeningiomas1
2RecruitingTreatmentMetastatic Cancers / Recurrent Cancer / Salivary Gland Carcinoma1
2RecruitingTreatmentMetastatic Carcinoma in the Adrenal Cortex / Recurrent Adrenal Cortex Carcinoma / Stage III Adrenal Cortex Carcinoma / Stage IV Adrenal Cortex Carcinoma1
2RecruitingTreatmentMetastatic Clear Cell Renal Cell Carcinoma1
2RecruitingTreatmentMetastatic Melanoma2
2RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2RecruitingTreatmentMetastatic Renal Cell Cancer / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Non-Small Cell Lung Cancer / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma1
2RecruitingTreatmentMetastatic Renal Cell Carcinoma3
2RecruitingTreatmentMetastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic1
2RecruitingTreatmentMetastatic or Advanced Non-Small Cell Lung Cancer (NSCLC)1
2RecruitingTreatmentMicrosatellite Instability / Neoplasms, Head and Neck / Penile Neoplasms / Renal Cell Adenocarcinoma / Skin Neoplasms1
2RecruitingTreatmentMucosal Melanoma1
2RecruitingTreatmentNasopharyngeal Carcinoma1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Skin Cancers1
2RecruitingTreatmentNon-Small Lung Cancer, Epigenetic Therapy1
2RecruitingTreatmentOral Cavity SCC1
2RecruitingTreatmentPancreatic Cancer Metastatic1
2RecruitingTreatmentProstate Cancer1
2RecruitingTreatmentProstate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma1
2RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentRenal Cancers1
2RecruitingTreatmentRenal Cell Adenocarcinoma2
2RecruitingTreatmentSalivary Gland Cancers1
2RecruitingTreatmentSarcomas1
2RecruitingTreatmentSmoldering Multiple Myeloma (SMM)1
2RecruitingTreatmentSolid Tumors Induced by Prior Radiation Exposure1
2RecruitingTreatmentStage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2RecruitingTreatmentSystemic Connective Tissue Disorders1
2RecruitingTreatmentThyroid Cancers1
2RecruitingTreatmentUntreated Metastatic Pancreatic Ductal Adenocarcinoma1
2RecruitingTreatmentUterine Corpus Leiomyosarcoma1
2RecruitingTreatmentUveal Melanoma1
2RecruitingTreatmentVarious Advanced Cancer1
2WithdrawnTreatmentAdvanced Non-Small Cell Lung Cancer / Metastatic Non-Small Cell Lung Cancer / Neoplasms, Lung1
2WithdrawnTreatmentLung Cancer, Nonsmall Cell, Stage I1
2WithdrawnTreatmentMelanoma1
2, 3Not Yet RecruitingTreatmentAdult Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome With Excess Blasts-2 / Untreated Adult Acute Myeloid Leukemia1
2, 3Not Yet RecruitingTreatmentMelanoma1
2, 3RecruitingTreatmentMalignant Neoplasm of Stomach1
2, 3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma1
2, 3SuspendedTreatmentRecurrent Melanoma of the Skin / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3Active Not RecruitingTreatmentAdvanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
3Active Not RecruitingTreatmentAdvanced or Metastatic (Medically or Surgically Unresectable) Clear-cell Renal Cell Carcinoma1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
3Active Not RecruitingTreatmentLung Cancers1
3Active Not RecruitingTreatmentMalignant Neoplasm of Stomach1
3Active Not RecruitingTreatmentMelanoma5
3Active Not RecruitingTreatmentMultiple Myeloma (MM)1
3Active Not RecruitingTreatmentNon-Squamous Cell Non-small Cell Lung Cancer1
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
3Active Not RecruitingTreatmentSquamous Cell Non-small Cell Lung Cancer1
3Active Not RecruitingTreatmentStage IV or Recurrent Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentUnresectable or Metastatic Melanoma2
3Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
3Not Yet RecruitingTreatmentMelanoma / Skin Cancers1
3RecruitingTreatmentBRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3RecruitingTreatmentBrain Cancer1
3RecruitingTreatmentCancer, Advanced1
3RecruitingTreatmentEsophageal Cancers1
3RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
3RecruitingTreatmentHead and Neck Carcinoma1
3RecruitingTreatmentHepatocellular,Carcinoma / I.V Advanced Cancer1
3RecruitingTreatmentHodgkins Disease (HD)1
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)6
3RecruitingTreatmentLung Cancers3
3RecruitingTreatmentMalignant Neoplasm of Stomach1
3RecruitingTreatmentMelanoma1
3RecruitingTreatmentMesothelioma2
3RecruitingTreatmentMetastatic Brain Tumors1
3RecruitingTreatmentNeoplasms, Brain1
3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma1
3RecruitingTreatmentRenal Cell Adenocarcinoma2
3RecruitingTreatmentSarcomatoid Renal Cell Carcinoma / Stage II Renal Cell Cancer / Stage III Renal Cell Cancer / Unclassified Renal Cell Carcinoma1
3RecruitingTreatmentStage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v71
3RecruitingTreatmentUrothelial Cancer1
3RecruitingTreatmentVarious Advanced Cancer2
4Active Not RecruitingOtherRenal Cell Adenocarcinoma1
4Not Yet RecruitingDiagnosticLung Cancers / Melanoma / Non-small Cell1
4RecruitingNot AvailableMetastatic Melanoma1
4RecruitingTreatmentRenal Cell Adenocarcinoma1
Not AvailableActive Not RecruitingNot AvailableInflammation, Brain1
Not AvailableActive Not RecruitingTreatmentCancer, Breast1
Not AvailableCompletedNot AvailableMelanoma1
Not AvailableNo Longer AvailableNot AvailableMalignant Melanoma1
Not AvailableNo Longer AvailableNot AvailableNon-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer1
Not AvailableNo Longer AvailableNot AvailableStage III (Unresectable) or Stage IV Advanced Melanoma1
Not AvailableRecruitingNot AvailableNivolumab Treatment in Expanded Use in Real World1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
InjectionIntravenous10 mg/mL
SolutionIntravenous10 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US2013173223No2013-05-132033-05-13Us

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Signal transducer activity
Specific Function
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. ...
Gene Name
PDCD1
Uniprot ID
Q15116
Uniprot Name
Programmed cell death protein 1
Molecular Weight
31646.635 Da
References
  1. Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116]

Drug created on February 24, 2015 16:02 / Updated on November 19, 2017 20:33