Nivolumab is a fully humanized IgG4 antibody targeting the immune checkpoint programmed death receptor-1 (PD-1). This molecule was produced entirely on mice and grafted onto human kappa and IgG4 Fc region with the mutation S228P for additional stability and reduced variability.^[2] It is developed by Bristol Myers Squibb and originally FDA approved on December 22, 2014. Since this approval, nivolumab has been approved for a variety of other uses related to cancer therapy. On 2017, was notably approved for the treatment of hepatocellular carcinoma^[8] and on July 11, 2018, the FDA approved this agent in combination with low doses of Ipilimumab for the treatment of MSI-H/dMMR metastatic colorectal cancer.^[7]

Protein structure

Protein chemical formula

C₆₃₆₂H₉₈₆₂N₁₇₁₂O₁₉₉₅S₄₂

Protein average weight

143597.3811 Da

Sequences

>Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY
ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPS
VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT
VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSV
MHEALHNHYTQKSLSLSLGK

>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Download FASTA Format

Synonyms

Not Available

External IDs

BMS-936558 / GTPL7335 / MDX-1106 / ONO-4538

Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Opdivo	Solution	10 mg	Intravenous	Bristol Myers Squibb	2015-10-23	Not applicable
Opdivo	Injection	10 mg/1mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2014-12-22	Not applicable
Opdivo	Injection	10 mg/1mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2017-12-08	Not applicable
Opdivo	Solution	10 mg	Intravenous	Bristol Myers Squibb	2015-10-23	Not applicable
Opdivo	Injection	10 mg/1mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2014-12-22	Not applicable

Categories

UNII

31YO63LBSN

CAS number

946414-94-4

Pharmacology

Indication

Nivolumab is indicated as a single agent for the treatment of:

BRAF V600 wild-type unresectable or metastatic melanoma.
BRAF V600 mutation-positive unresectable or metastatic melanoma.
metastatic non-small cell lung cancer and progression on or after platinum-based chemotherapy. Patients with EGFR or ALK genomic tumor aberrations should have disease progression on disease-specific FDA therapy.
advanced renal cell carcinoma with prior anti-angiogenic therapy.
classical Hodgkin lymphoma in adults that has relapsed or progressed after autologous hematopoietic stem cell transplantation and brentuximab vedotin or 3 or more lines of systemic therapy that includes autologous hematopoietic stem cell transplantation.
recurrent or metastatic squamous cell carcinoma of the head and neck with disease progression on or after platinum-based therapy.
locally advanced or metastatic urothelial carcinoma with disease progression during or after platinum-containing chemotherapy or disease progression within 12 months of neoadjuvant or adjuvant treatment with platinum-containing chemotherapy.
microsatellite instability-high (MSI-H) or mismatch repair deficient (dMMR) metastatic colorectal cancer in patients 12 years or older that progressed following treatment with fluoropyrimidine, oxaliplatin and irinotecan.
hepatocellular carcinoma previously treated with sorafenib.^[Label]

In combination with Ipilimumab, nivolumab is indicated for the treatment of:

unresectable or metastatic melanoma.
melanoma with lymph node involvement or metastatic disease that has gone through complete resection.
intermediate or poor risk, previously untreated advanced renal cell carcinoma.
microsatellite instability-high (MSI-H) or mismatch repair deficient (dMMR) metastatic colorectal cancer in patients 12 years or older that progressed following treatment with fluoropyrimidine, oxaliplatin and irinotecan.^[Label]

Associated Conditions

Pharmacodynamics

In vitro testing showed a nivolumab-induced cytokine upregulation as well as an antigen-specific response of PD-1-positive T cells. The invitro pharmacodynamics studies were based on the occupancy on circulating CD3 positive T cells and they indicated a maximal occupancy of 85%. Initial clinical trials have shown that in patients with non-small-cell lung cancer, melanoma and renal cell carcinoma nivolumab presented an overall survival rate of 42%, 63% and 70% respectively.^[1]

In phase I clinical trials, patients with non-small cell lung cancer, the objective response rate (ORR) was registered to be of maximum 18% with a median overall survival (mOS) of 9.4 months. When nivolumab was used as a first-line treatment for non-small cell lung cancer, the objective response rate was 30% and the median progression-free survival (mPFS) was 29.6% with a mOS of 9.9 months. In melanoma, the combination of Ipilimumab and nivolumab or nivolumab monotherapy on patients pre-treated with Ipilimumab was 40% and 20% respectively. In metastatic renal cell carcinoma, the median duration of response was 12.9 month while the response rate for Hodgkin's lymphoma was 87% with a ratio of stable disease of 13%.^[3]

In phase II clinical trials in lung cancer, the mPFS and mOS was 1.9 and 8.2 months respectively. In melanoma, the ORR of the combination therapy with Ipilimumab was 61% as compared with 11% on the Ipilimumab monotherapy. The mPFS, ORR and mOS for the maximal concentration of nivolumab was 4.2 months, 20%, and 24.7 months respectively while the mPFS and mOS in ovarian cancer were reported to be 3.5 and 20 months respectively.^[3]

Phase III studies in lung cancer and renal cell carcinoma were performed showing a mOS of 9.2 and 25 months respectively; the mPFS for this conditions was 3.5 and 4.6 months respectively. In the case of melanoma, the ORR was 31.7% and the mPFS of nivolumab alone was 7 months.^[3]

The combination of nivolumab and Ipilimumab was studied in clinical trials and it was shown to produce an objective response in 40% of the patients studied which was significantly higher when compared to patients receiving nivolumab as a monotherapy when pretreated with Ipilimumab.^[2] In clinical trials, the results were based on the reports that indicated significant improvement in overall survival and objective response rate of 42%.^[9] This combination was also confirmed by trials with progression after therapy colorectal cancer which obtained an overall response rate of 46% and 89% of those has a response duration of over 6 months.^[7]

Mechanism of action

PD-1 is a member of the CD28 T-cell receptor family which makes it be expressed mainly in T-cells, B cells and myeloid cells. PD-1 is upregulated after chronic antigen stimulation and produces a state of T-cell exhaustion. The ligands for PD-1, PD-L1 and PD-L2, are induced by the presence of inflammatory cytokines such as interferon gamma. Tumor studies have shown to express both of the PD-1 ligands. When PD-L1 and PD-L2 are bound to PD-1, this produces an inhibitory signal in the T cells which interrupts the immune response. Therefore, nivolumab blocks the immune checkpoint PD-1. The strategy behind this mechanism is related to the reduction of the inhibitory signaling and to restore the patient's natural tumor-specific T-cell immune response.^[1]

The combination of nivolumab and Ipilimumab are based on the fact that PD-1 and CTLA-4 checkpoints have nonredundant roles on T-cell modulation.^[1]

Target	Actions	Organism
AProgrammed cell death protein 1	antibody	Human

Absorption

Pharmacokinetic studies have suggested that nivolumab presents linear pharmacokinetics with a dose-proportional increase in peak concentration and AUC. The time to peak plasma concentration ranges between 1-4 hours.^[1] The absorption pharmacokinetic properties respective to the administration of a dose of 10 mg/kg are reported to be Cmax, Tmax and AUC of 242 mcg/kg, 2.99 hours and 68100 mcg.h/ml respectively.^[5]

Volume of distribution

The volume of distribution at steady state when a dose of 10 mg/kg of nivolumab is administered is reported to be 91.1 ml/kg.^[5] At doses ranging from 0.1 to 20 mg/kg the volume of distribution is reported to be 8 L.^[6]

Protein binding

There is no information regarding the plasma protein binding of nivolumab.^[11]

Metabolism

There have not been formal studies regarding the specific metabolism of nivolumab but as a human monoclonal antibody, it has been suggested to not be metabolized by cytochrome P450 enzyme but to be degraded to small peptides and individual amino acids.^[10]

Route of elimination

There have not been studies regarding the specific elimination route of nivolumab.^[11]

Half life

Serum half-life is calculated to range around 20 days^[1] with an elimination half-life of 26.7 days.^[6]

Clearance

The estimated clearance rate for nivolumab is 9.4 ml/h.^[4] The clearance rate seems to be increased according to the body weight.^[6]

Toxicity

In vitro studies did not show antibody-dependent cell-mediated or complement-dependent cytotoxicity.^[1] Long-term studies with nivolumab have nos shown a significant effect of this agent in the fertility. No studies regarding the carcinogenicity, genotoxicity or short-term effect on fertility have been performed. Some of the most serious effects are related to an increased severity of infectious and inflammatory response.^[Label]

Affected organisms

Humans and other mammals

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

Drug	Interaction
Abciximab	The risk or severity of adverse effects can be increased when Abciximab is combined with Nivolumab.
Abituzumab	The risk or severity of adverse effects can be increased when Nivolumab is combined with Abituzumab.
Adalimumab	The risk or severity of adverse effects can be increased when Adalimumab is combined with Nivolumab.
Adecatumumab	The risk or severity of adverse effects can be increased when Adecatumumab is combined with Nivolumab.
Aducanumab	The risk or severity of adverse effects can be increased when Nivolumab is combined with Aducanumab.
Afelimomab	The risk or severity of adverse effects can be increased when Afelimomab is combined with Nivolumab.
Alemtuzumab	The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Nivolumab.
Alirocumab	The risk or severity of adverse effects can be increased when Nivolumab is combined with Alirocumab.
Amatuximab	The risk or severity of adverse effects can be increased when Nivolumab is combined with Amatuximab.
AMG 108	The risk or severity of adverse effects can be increased when AMG 108 is combined with Nivolumab.

Food Interactions

Not Available

References

General References

Brahmer JR, Hammers H, Lipson EJ: Nivolumab: targeting PD-1 to bolster antitumor immunity. Future Oncol. 2015;11(9):1307-26. doi: 10.2217/fon.15.52. Epub 2015 Mar 23. [PubMed:25798726]
Mashima E, Inoue A, Sakuragi Y, Yamaguchi T, Sasaki N, Hara Y, Omoto D, Ohmori S, Haruyama S, Sawada Y, Yoshioka M, Nishio D, Nakamura M: Nivolumab in the treatment of malignant melanoma: review of the literature. Onco Targets Ther. 2015 Aug 6;8:2045-51. doi: 10.2147/OTT.S62102. eCollection 2015. [PubMed:26273207]
Guo L, Zhang H, Chen B: Nivolumab as Programmed Death-1 (PD-1) Inhibitor for Targeted Immunotherapy in Tumor. J Cancer. 2017 Feb 10;8(3):410-416. doi: 10.7150/jca.17144. eCollection 2017. [PubMed:28261342]
Bajaj G, Wang X, Agrawal S, Gupta M, Roy A, Feng Y: Model-Based Population Pharmacokinetic Analysis of Nivolumab in Patients With Solid Tumors. CPT Pharmacometrics Syst Pharmacol. 2017 Jan;6(1):58-66. doi: 10.1002/psp4.12143. Epub 2016 Dec 26. [PubMed:28019091]
Lee KW, Lee DH, Kang JH, Park JO, Kim SH, Hong YS, Kim ST, Oh DY, Bang YJ: Phase I Pharmacokinetic Study of Nivolumab in Korean Patients with Advanced Solid Tumors. Oncologist. 2018 Feb;23(2):155-e17. doi: 10.1634/theoncologist.2017-0528. Epub 2017 Nov 20. [PubMed:29158363]
Solimando DA Jr, Waddell JA: Nivolumab and Olaparib. Hosp Pharm. 2015 May;50(5):356-66. doi: 10.1310/hpj5005-356. [PubMed:26405320]
FDA news [Link]
FDA 2017 new drug approvals [Link]
FDA news [Link]
EMA label [File]
OPDIVO monograph [File]

External Links

KEGG Drug: D10316
PubChem Substance: 347910393
ChEMBL: CHEMBL2108738
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Nivolumab

ATC Codes

L01XC17 — Nivolumab

AHFS Codes

10:00.00 — Antineoplastic Agents

FDA label

Download (2.51 MB)

MSDS

Download (1.26 MB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Active Not Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Cancer / Renal Cancers / Stage IV Renal Cell Cancer AJCC V7	1
0	Active Not Recruiting	Treatment	Melanoma (Skin) / Skin Cancers	1
0	Recruiting	Basic Science	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
0	Recruiting	Treatment	Human Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS) / Immunosuppression / Kaposi s Sarcoma (KS)	1
0	Recruiting	Treatment	Larynx / Lip, Oral Cavity and Pharynx	2
0	Recruiting	Treatment	Liver Cancer	1
0	Recruiting	Treatment	Lymphoma, Large B-Cell, Diffuse (DLBCL)	1
0	Recruiting	Treatment	Malignant Neoplasm of Pancreas	1
0	Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
0	Recruiting	Treatment	Sarcomas	1
0	Recruiting	Treatment	Squamous Cell Carcinoma Mouth / Squamous Cell Carcinoma of the Oral Cavity / Squamous Cell Carcinoma, Head And Neck	1
1	Active Not Recruiting	Basic Science	Advanced Melanoma / Metastatic Melanoma	1
1	Active Not Recruiting	Basic Science	Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Advanced Solid Tumors, Including But Not Limited to Lung Cancer / Cancer of the Ovary / Colorectal Cancers / Glioblastoma Multiforme (GBM) / Head and Neck Carcinoma / Head and Neck Squamous Cell Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Gliomas / Malignant Neoplasm of Pancreas / Melanoma / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Advanced Solid Tumors / Solid Tumor, Recurrent	1
1	Active Not Recruiting	Treatment	Astrocytomas / Glioblastomas / Malignant Gliomas	1
1	Active Not Recruiting	Treatment	B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Refractory Adult Acute Lymphoblastic Leukemia / Refractory Childhood Acute Lymphoblastic Leukemia	1
1	Active Not Recruiting	Treatment	BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
1	Active Not Recruiting	Treatment	Bladder Tumors / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Melanoma / Melanoma / Skin Cancers / Transitional Cell Carcinoma of the Bladder / Urinary Bladder Cancer	1
1	Active Not Recruiting	Treatment	Cancer of the Ovary / Cancer, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Prostate Cancer / Renal Cell Adenocarcinoma / Tumors, Solid	1
1	Active Not Recruiting	Treatment	Cancer of the Ovary / Fallopian Tubes / Primary Peritoneal Cancer / Recurrent Ovarian Cancer	1
1	Active Not Recruiting	Treatment	Cancer, Advanced	2
1	Active Not Recruiting	Treatment	Chronic Myeloid Leukemia (CML)	1
1	Active Not Recruiting	Treatment	Clear Cell Renal Cell Carcinoma	1
1	Active Not Recruiting	Treatment	CcRCC / Clear Cell Renal Cell Carcinoma / RCC / Renal Cancers / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Glioblastomas / Gliosarcoma / Supratentorial Glioblastoma	1
1	Active Not Recruiting	Treatment	Glioma, Malignant	1
1	Active Not Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1	Active Not Recruiting	Treatment	Chronic, recurrent Lymphocytic Leukemia / Hematopoietic Cell Transplantation Recipient / Myelodysplastic Syndrome / Myeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma	1
1	Active Not Recruiting	Treatment	Locally Advanced Cancer / Metastatic Cancers	1
1	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	3
1	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Castration-resistant Prostrate Cancer / Metastatic Castration-resistant Prostrate Cancer (mCRPC) / Metastatic Melanoma / Metastatic Melanoma (MEL) / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC)	1
1	Active Not Recruiting	Treatment	Malignant Lymphomas / Malignant Solid Tumours	1
1	Active Not Recruiting	Treatment	Malignant Melanoma	1
1	Active Not Recruiting	Treatment	Melanoma	1
1	Active Not Recruiting	Treatment	Melanoma (Skin)	2
1	Active Not Recruiting	Treatment	Tumors, Solid	1
1	Completed	Other	Severe Sepsis	1
1	Completed	Treatment	Advanced Solid Tumors / Solid Tumor, Recurrent	1
1	Completed	Treatment	Colorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma / Prostate Cancer / Renal Cancers	1
1	Completed	Treatment	Malignant Melanoma	1
1	Completed	Treatment	Malignant Solid Tumours	1
1	Completed	Treatment	Neoplasms by Site	1
1	Completed	Treatment	Neoplasms, Breast / Neoplasms, Pancreatic	1
1	Not Yet Recruiting	Treatment	Acute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / Refractory Acute Myeloid Leukemia	1
1	Not Yet Recruiting	Treatment	Autoimmune Diseases / Crohn's Disease (CD) / Disseminated Sclerosis / Giant Cells Arteritis / Lung Cancer Non-Small Cell Cancer (NSCLC) / Polymyalgia Rheumatica / Psoriasis / Rheumatoid Arthritis / Systemic Lupus Erythematosus (SLE) / Ulcerative Colitis (UC)	1
1	Not Yet Recruiting	Treatment	Breast Adenocarcinoma / Recurrent Breast Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Mycosis Fungoides / Recurrent Non-Hodgkin Lymphoma / Recurrent Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Nodal Marginal Zone Lymphoma / Refractory Non-Hodgkin's lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Breast Cancer AJCC v6 and v7	1
1	Not Yet Recruiting	Treatment	Cancer, Advanced	1
1	Not Yet Recruiting	Treatment	Colorectal neoplasms malignant / Hepatic Metastases	1
1	Not Yet Recruiting	Treatment	Glioblastoma Multiforme (GBM) / Glioblastomas	1
1	Not Yet Recruiting	Treatment	Glioblastomas	1
1	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1	Not Yet Recruiting	Treatment	Metastatic Squamous Cell Carcinoma of the Head or Neck / Platinum- and Cetuximab-Refractory Squamous Cell Carcinoma of the Head or Neck / Recurrent Squamous Cell Carcinoma of the Head or Neck / Squamous Cell Carcinoma (SCC)	1
1	Not Yet Recruiting	Treatment	Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v8	1
1	Not Yet Recruiting	Treatment	Recurrent Hepatocellular Carcinoma / Refractory Liver Carcinoma / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v8	1
1	Not Yet Recruiting	Treatment	Solid Tumor, Adult	1
1	Recruiting	Basic Science	Soft Tissue Sarcoma Adult	1
1	Recruiting	Other	Glioblastomas	1
1	Recruiting	Treatment	ALK-positive NSCLC	1
1	Recruiting	Treatment	Acral lentiginous melanoma / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Leptomeningeal Disease / Leptomeningeal Neoplasm / Melanoma and Other Malignant Neoplasms of Skin / Metastatic Melanoma / Metastatic Uveal Melanoma / Mucosal Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v8	1
1	Recruiting	Treatment	Acute Myeloid Leukemia and Myelodysplastic Syndrome	1
1	Recruiting	Treatment	Adenocarcinoma of the Pancreas / Colon Carcinoma Metastatic in the Liver / Colorectal Adenocarcinoma / Resectable Pancreatic Carcinoma / Stage I Pancreatic Cancer / Stage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage II Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer	1
1	Recruiting	Treatment	Adenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma	1
1	Recruiting	Treatment	Adenocarcinomas of the Gastroesophageal Junction / Hepatocellular,Carcinoma / Malignant Neoplasm of Stomach / Tumors, Solid	1
1	Recruiting	Treatment	Adenocarcinomas / Advanced NSCLC / Carcinoma, Adenosquamous / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Squamous Cell Carcinoma (SCC)	1
1	Recruiting	Treatment	Adrenocortical Carcinoma (Part G) / Advanced Solid Tumors (Part A/B/C/D) / High-circulating Myeloid-derived Suppressor Cells (Part H) / Melanoma (Part E) / Mesothelioma (Part G) / Non-small Cell Lung Cancer (NSCLC) and Melanoma (Part E) / Non-small Cell Lung Cancer (Part E) / Squamous Cell Cancer of the Head and Neck (Part E) / Triple Negative Breast Cancer (Part F)	1
1	Recruiting	Treatment	Adult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Recurrent Classic Hodgkin Lymphoma / Recurrent Classical Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Adult Solid Neoplasm / Childhood Solid Neoplasm / Neoplasms, Metastatic	1
1	Recruiting	Treatment	Advanced Cancers	1
1	Recruiting	Treatment	Advanced Malignancies	1
1	Recruiting	Treatment	Advanced Melanoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Renal Cell Adenocarcinoma	1
1	Recruiting	Treatment	Advanced Non Small Cell Lung Cancer	1
1	Recruiting	Treatment	Advanced Solid Tumors	3
1	Recruiting	Treatment	Advanced Solid Tumors / Advanced Solid Tumors Cancer	1
1	Recruiting	Treatment	Advanced Solid Tumors / Advanced Solid Tumors Cancer / Malignancies	1
1	Recruiting	Treatment	Advanced Solid Tumors / Head and Neck Carcinoma, Squamous Cell / Lung Cancer Non-Small Cell Cancer (NSCLC) / Triple-Negative Breast Neoplasms	1
1	Recruiting	Treatment	Advanced or Metastatic Solid Tumors	1
1	Recruiting	Treatment	Aggressive Non-Hodgkin Lymphoma / Neoplasms, Advanced Solid / Recurrent Solid Neoplasm / Refractory Mantle Cell Lymphoma / T-Cell Non-Hodgkin Lymphoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Ann Arbor Stage III Lymphoma / Ann Arbor Stage IV Lymphoma / Metastatic Malignant Solid Neoplasm	1
1	Recruiting	Treatment	B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Recurrent B Acute Lymphoblastic Leukemia / Refractory B Acute Lymphoblastic Leukemia	1
1	Recruiting	Treatment	Bladder Cancer TNM Staging Distant Metastasis (M) M0 / Bladder Cancer TNM Staging Primary Tumor (T) T2 / Bladder Cancer TNM Staging Primary Tumor (T) T2A / Bladder Cancer TNM Staging Primary Tumor (T) T2B / Bladder Cancer TNM Staging Primary Tumor (T) T3 / Bladder Cancer TNM Staging Primary Tumor (T) T3A / Bladder Cancer TNM Staging Primary Tumor (T) T3B / Bladder Cancer TNM Staging Regional Lymph Node (N) N0 / Bladder Cancer TNM Staging Regional Lymph Node (N) N1	1
1	Recruiting	Treatment	Bladder Cancers	1
1	Recruiting	Treatment	Bladder Carcinoma / Colorectal Cancers / Salivary Gland Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1	Recruiting	Treatment	Bladder Small Cell Neuroendocrine Carcinoma / Clear Cell Renal Cell Carcinoma / Infiltrating Bladder Urothelial Carcinoma Sarcomatoid Variant / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Kidney Medullary Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Renal Cell Carcinoma / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Sarcomatoid Renal Cell Carcinoma / Solid Neoplasms / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma / Stage III Bladder Adenocarcinoma AJCC v6 and v7 / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Penile Cancer / Stage III Penile Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer / Stage III Urethral Cancer AJCC v7 / Stage IIIa Penile Cancer / Stage IIIa Penile Cancer AJCC v7 / Stage IIIb Penile Cancer / Stage IIIb Penile Cancer AJCC v7 / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Adenocarcinoma AJCC v7 / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Squamous Cell Carcinoma AJCC v7 / Stage IV Bladder Urothelial Carcinoma / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Penile Cancer / Stage IV Penile Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer / Stage IV Urethral Cancer AJCC v7 / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma	1
1	Recruiting	Treatment	Blasts 30 Percent or Less of Bone Marrow Nucleated Cells / Chronic Myelomonocytic Leukemia / High Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Refractory Anemia	1
1	Recruiting	Treatment	Breast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Cancer, Advanced	2
1	Recruiting	Treatment	Cancer, Breast / Transitional Cell Carcinoma	1
1	Recruiting	Treatment	Chordomas	1
1	Recruiting	Treatment	Chronic Leukemias / Leukemia, Acute / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndromes	1
1	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Stage I Renal Cell Cancer / Stage I Renal Cell Cancer AJCC v6 and v7 / Stage II Renal Cell Cancer / Stage II Renal Cell Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7	1
1	Recruiting	Treatment	Colorectal Cancers / Malignant Neoplasm of Colon / Metastatic Colorectal Cancers	1
1	Recruiting	Treatment	EBV Related Hodgkin's Lymphoma / EBV Related Lymphoma / EBV Related Non-Hodgkin's Lymphoma / EBV-Related PTLD / Lymphoma, Hodgkins / Lymphoproliferative Disorders / NonHodgkin Lymphoma	1
1	Recruiting	Treatment	Esophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Stomach	1
1	Recruiting	Treatment	Esophageal Cancers / Lung Cancers / Malignant Neoplasm of Stomach / Renal Cancers	1
1	Recruiting	Treatment	Fallopian Tubes / High Grade Serous Ovarian / Primary Peritoneal Cancer	1
1	Recruiting	Treatment	Follicular Lymphoma (FL)	2
1	Recruiting	Treatment	Glioblastomas	3
1	Recruiting	Treatment	Glioblastomas / Gliosarcoma / Recurrent Brain Neoplasm	1
1	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms / Renal Cell Adenocarcinoma / Urothelial Neoplasm	1
1	Recruiting	Treatment	Hepatocellular,Carcinoma	3
1	Recruiting	Treatment	High-Risk Resectable NSCLC	1
1	Recruiting	Treatment	Human Papillomavirus Positive Anal Carcinoma / Human Papillomavirus Positive Cervical Carcinoma / Human Papillomavirus Positive Oropharyngeal Carcinoma / Human Papillomavirus Positive Penile Carcinoma / Human Papillomavirus Positive Vulvar Carcinoma / Human Papillomavirus-Related Carcinoma	1
1	Recruiting	Treatment	Locally Advanced Hepatocellular Carcinoma	1
1	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
1	Recruiting	Treatment	Malignancies	3
1	Recruiting	Treatment	Malignancies, Hematologic	1
1	Recruiting	Treatment	Malignant Gliomas	1
1	Recruiting	Treatment	Malignant Peritoneal Neoplasm / Malignant Retroperitoneal Neoplasm / Peritoneal Carcinomatosis / Recurrent Cervical Carcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage IV Cervical Cancer AJCC v8 / Stage IV Fallopian Tube Cancer AJCC v8 / Stage IV Ovarian Cancer AJCC v8 / Stage IV Primary Peritoneal Cancer AJCC v8 / Stage IV Uterine Corpus Cancer AJCC v8 / Stage IVA Cervical Cancer AJCC v8 / Stage IVA Fallopian Tube Cancer AJCC v8 / Stage IVA Ovarian Cancer AJCC v8 / Stage IVA Primary Peritoneal Cancer AJCC v8 / Stage IVA Uterine Corpus Cancer AJCC v8 / Stage IVB Cervical Cancer AJCC v8 / Stage IVB Fallopian Tube Cancer AJCC v8 / Stage IVB Ovarian Cancer AJCC v8 / Stage IVB Primary Peritoneal Cancer AJCC v8 / Stage IVB Uterine Corpus Cancer AJCC v8	1
1	Recruiting	Treatment	Melanoma	1
1	Recruiting	Treatment	Metastases to soft tissue / Tumors, Solid	1
1	Recruiting	Treatment	Metastatic Colorectal Cancers	1
1	Recruiting	Treatment	Metastatic Hormone-sensitive Prostate Cancer	1
1	Recruiting	Treatment	Metastatic Malignant Neoplasm in the Brain / Metastatic Malignant Neoplasm in the Spine / Stage IV Skin Melanoma	1
1	Recruiting	Treatment	Metastatic Malignant Solid Neoplasm	1
1	Recruiting	Treatment	Metastatic Melanoma	2
1	Recruiting	Treatment	Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
1	Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
1	Recruiting	Treatment	Metastatic Solid Tumors / Treatment-Refractory Cancers	1
1	Recruiting	Treatment	Neoplasms Malignant	1
1	Recruiting	Treatment	Neoplasms, Malignant	1
1	Recruiting	Treatment	Neuroblastomas	1
1	Recruiting	Treatment	Newly Diagnosed Glioblastoma	1
1	Recruiting	Treatment	Recurrent Plasma Cell Myeloma	1
1	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	2
1	Recruiting	Treatment	Stage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma	1
1	Recruiting	Treatment	Stage IV Small Cell Lung Cancer	1
1	Recruiting	Treatment	Transitional Cell Carcinoma	1
1	Recruiting	Treatment	Tumors, Solid	1
1	Terminated	Basic Science	Neoplasms, Colorectal	1
1	Terminated	Other	Melanoma	1
1	Terminated	Treatment	Bladder Cancers	1
1	Terminated	Treatment	Multiple Myeloma (MM)	1
1	Withdrawn	Treatment	Malignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)	1
1	Withdrawn	Treatment	Metastatic Melanoma	1
1, 2	Active Not Recruiting	Treatment	Advanced B-cell NHL / Advanced Solid Tumors	1
1, 2	Active Not Recruiting	Treatment	Advanced Malignancies / Advanced or Metastatic Malignancies	1
1, 2	Active Not Recruiting	Treatment	Advanced Malignancies / Clear Cell Renal Cell Carcinoma / Renal Cancers / Select Advanced Malignancies	1
1, 2	Active Not Recruiting	Treatment	Advanced or Metastatic Solid Tumors	1
1, 2	Active Not Recruiting	Treatment	Advanced or Metastatic Solid Tumors / Tumors, Solid	1
1, 2	Active Not Recruiting	Treatment	B Cell NHL Including DLBCL / B-Cell Malignancies / Cancer of the Ovary / Carcinoma, Squamous Cell of Head and Neck / Colorectal Cancer (CRC) / CRC (Colorectal Cancer) / Glioblastomas / Head and Neck Carcinoma / HL / HNSCC (Head and Neck Squamous Cell Cancer / Hodgkin Lymphona (B-cell Malignancies) / I/O naïve Melanoma (MEL) / I/O Refractory MEL / I/O Relapsed MEL / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Lymphomas / Melanoma / Neoplasms, Colorectal / Neoplasms, Ovarian	1
1, 2	Active Not Recruiting	Treatment	Cancer, Advanced	2
1, 2	Active Not Recruiting	Treatment	Cancer,NOS	1
1, 2	Active Not Recruiting	Treatment	Clear Cell Renal Cell Carcinoma	1
1, 2	Active Not Recruiting	Treatment	Colorectal Cancer (CRC) / Colorectal Cancer (CRC)-Enrollment Completed / Glioblastoma (GBM) (Phase ll Only) / Glioblastoma (GBM) (Phase ll Only)-Enrollment Completed / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma of Head and Neck / Malignant Neoplasm of Colon / Melanoma / Ovarian Carcinoma / Ovarian Carcinoma-Enrollment Completed / Renal Cell Carcinoma (RCC) (Phase ll Only) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1, 2	Active Not Recruiting	Treatment	Extensive-Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)	1
1, 2	Active Not Recruiting	Treatment	Hepatocellular,Carcinoma	2
1, 2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1, 2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic or Advanced Non-Small Cell Lung Cancer (NSCLC)	1
1, 2	Active Not Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC)	1
1, 2	Active Not Recruiting	Treatment	Lymphoma, Hodgkins	1
1, 2	Active Not Recruiting	Treatment	MSS / RAS-mutant Colorectal Cancer	1
1, 2	Active Not Recruiting	Treatment	Malignancies	2
1, 2	Active Not Recruiting	Treatment	Metastatic Melanoma / Stage III Melanoma / Stage IV Melanoma	1
1, 2	Active Not Recruiting	Treatment	Neoplasms, Hematologic	1
1, 2	Active Not Recruiting	Treatment	Ovarian Cancer Metastatic	1
1, 2	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	1
1, 2	Active Not Recruiting	Treatment	Tumors, Solid	1
1, 2	Completed	Treatment	Melanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma	1
1, 2	Not Yet Recruiting	Treatment	Adenocarcinoma of the Prostate / Prostate Cancer	1
1, 2	Not Yet Recruiting	Treatment	Antibodies, Neoplasm	1
1, 2	Not Yet Recruiting	Treatment	Childhood Lymphoma / Childhood Solid Tumors	1
1, 2	Not Yet Recruiting	Treatment	Colorectal Adenocarcinoma / CpG Island Methylator Phenotype / Metastatic Microsatellite Stable Colorectal Carcinoma / Refractory Colorectal Carcinoma / Stage IV Colorectal Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v8	1
1, 2	Not Yet Recruiting	Treatment	Colorectal Cancers	1
1, 2	Not Yet Recruiting	Treatment	Gastrooesophageal Cancer / Immune Checkpoint Inhibition	1
1, 2	Not Yet Recruiting	Treatment	Grade II Meningioma / Grade III Meningioma / Recurrent Meningiomas	1
1, 2	Not Yet Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	2
1, 2	Not Yet Recruiting	Treatment	Hepatocellular,Carcinoma	1
1, 2	Not Yet Recruiting	Treatment	Human Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Stage II Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7	1
1, 2	Not Yet Recruiting	Treatment	In-Transit Metastasis / Melanoma	1
1, 2	Not Yet Recruiting	Treatment	Larynx / LIP / Oral Cavity Cancer / Pharynx Cancer	1
1, 2	Not Yet Recruiting	Treatment	Locally Advanced Pancreatic Ductal Adenocarcinoma (PDAC) / Pancreatic Ductal Adenocarcinoma	1
1, 2	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1, 2	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Stage II / Non-small Cell Lung Cancer Stage I	1
1, 2	Not Yet Recruiting	Treatment	Lung Cancers / Malignant Pleural Effusions / Stage IV Metastatic Cancer	1
1, 2	Not Yet Recruiting	Treatment	Malignant Neoplasm of Colon / Unresectable or Metastatic Microsatellite Stable (MSS) Solid Tumor Along With Microsatellite Stable (MSS) Colon Cancer	1
1, 2	Not Yet Recruiting	Treatment	Melanoma	1
1, 2	Not Yet Recruiting	Treatment	Metastatic Colorectal Cancers / Metastatic Solid Tumor Cancer / Recurrent Head and Neck Cancer	1
1, 2	Not Yet Recruiting	Treatment	Metastatic Hepatocellular Carcinoma / Stage III Hepatocellular Carcinoma AJCC v8 / Stage IIIA Hepatocellular Carcinoma AJCC v8 / Stage IIIB Hepatocellular Carcinoma AJCC v8 / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v8 / Unresectable Hepatocellular Carcinoma	1
1, 2	Not Yet Recruiting	Treatment	Osteosarcoma in Children / Recurrent Osteosarcoma / Sarcoma, Osteogenic / Sarcomas	1
1, 2	Recruiting	Prevention	Stage IIIC Skin Melanoma / Stage IV Skin Melanoma	1
1, 2	Recruiting	Treatment	ALK Gene Mutation / EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
1, 2	Recruiting	Treatment	ALK Gene Translocation / EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Translocation / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7	1
1, 2	Recruiting	Treatment	Adenocarcinoma of the Pancreas	1
1, 2	Recruiting	Treatment	Advanced Malignancies / Metastatic Cancers / Metastatic Malignancy	1
1, 2	Recruiting	Treatment	Advanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma	1
1, 2	Recruiting	Treatment	Advanced Tumors / Multiple Indications Cancer	1
1, 2	Recruiting	Treatment	Advanced and Metastatic Solid Tumor	1
1, 2	Recruiting	Treatment	Aggressive Non-Hodgkin Lymphoma / B-cell Non-Hodgkin's Lymphomas / CD20 Positive / Diffuse Large B-Cell Lymphoma Unclassifiable / Intravascular Large B-Cell Lymphoma / Primary Mediastinal (Thymic) Large B-cell Lymphoma / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma / Transformed Follicular Lymphoma to Diffuse Large B-Cell Lymphoma	1
1, 2	Recruiting	Treatment	Biallelic Mismatch Repair Deficiency (bMMRD) Positive Patients / Refractory or Recurrent Hypermutated Malignancies	1
1, 2	Recruiting	Treatment	Bladder Cancers / Malignancies / Melanoma (Skin) / Melanoma, Uveal / Microsatellite Instability / Mismatch Repair Deficiency / Non-Melanoma Skin Cancer (NMSC) / Ocular Melanoma	1
1, 2	Recruiting	Treatment	Broad Solid Tumor	1
1, 2	Recruiting	Treatment	Cancer of Rectum	1
1, 2	Recruiting	Treatment	Cancer of the Ovary / Colorectal Cancers / Melanoma / Neuroendocrine Carcinoma of the Skin / Renal Cell Adenocarcinoma / Sarcomas / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)	1
1, 2	Recruiting	Treatment	Cancer, Advanced	6
1, 2	Recruiting	Treatment	Cancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma	1
1, 2	Recruiting	Treatment	Cancer, Advanced / Solid Tumors and Hematologic Malignancy	1
1, 2	Recruiting	Treatment	Cancer, Breast / Triple-Negative Breast Cancer (TNBC)	1
1, 2	Recruiting	Treatment	Carcinoma NOS / HCC / Hepatocellular,Carcinoma / Malignancies / Tumors, Solid	1
1, 2	Recruiting	Treatment	Carcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal	1
1, 2	Recruiting	Treatment	Carcinoma，Non-Small-Cell Lung / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)	1
1, 2	Recruiting	Treatment	Cervical Cancers / Locally Advanced Cervical Cancer	1
1, 2	Recruiting	Treatment	Childhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Melanoma / Refractory Neuroblastoma / Refractory Non-Hodgkin's lymphoma / Refractory Osteosarcoma / Refractory Rhabdomyosarcoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
1, 2	Recruiting	Treatment	Children, Adolescents and Young Adults With Refractory or Recurrent Malignancies	1
1, 2	Recruiting	Treatment	Chondrosarcomas / Ewing's Sarcoma (ES) / Liposarcoma / Sarcoma, Osteogenic / Undifferentiated Pleomorphic Sarcoma	1
1, 2	Recruiting	Treatment	Classical Hodgkin Lymphoma / Lymphoma, Hodgkins / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
1, 2	Recruiting	Treatment	Classical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Classic Hodgkin Lymphoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
1, 2	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma	1
1, 2	Recruiting	Treatment	Cohort 1a and 1b: Glioblastoma Multiforme / Cohort 1a and 1b: Glioma / Cohort 2a and 2b: Hepatobiliary Tumors (Hepatocellular Carcinoma, Bile Duct Carcinoma, Intrahepatic Cholangiocarcinoma, Other Hepatobiliary Carcinomas) / Cohort 3a and 3b: Chondrosarcoma / Cohort 4a and 4b: Intrahepatic Cholangiocarcinoma / Cohort 5a: Other Solid Tumors With IDH1 Mutations	1
1, 2	Recruiting	Treatment	Colorectal Cancers / Gastroesophageal Adenocarcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Transitional Cell Carcinoma / Tumors, Solid	1
1, 2	Recruiting	Treatment	Colorectal Cancers / Malignant Neoplasm of Pancreas	1
1, 2	Recruiting	Treatment	Cutaneous Melanoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Renal Cell Adenocarcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Transitional Cell Carcinoma	1
1, 2	Recruiting	Treatment	EGFR Gene Mutations / Recurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
1, 2	Recruiting	Treatment	Endometrial Cancers / Prostate Cancer	1
1, 2	Recruiting	Treatment	Esophageal Cancers	1
1, 2	Recruiting	Treatment	Gastroesophageal Junction Region (GEJ) Cancer / Malignant Neoplasm of Stomach	1
1, 2	Recruiting	Treatment	Glioblastomas / Non-Small Cell Lung Cancer Recurrent / Recurrent Hepatocellular Carcinoma / Tumors, Solid	1
1, 2	Recruiting	Treatment	Grade 3a Follicular Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory Burkitt Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma	1
1, 2	Recruiting	Treatment	Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1, 2	Recruiting	Treatment	Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / Squamous Cell Cancer / Squamous Cell Carcinoma of the Hypopharynx / Squamous Cell Carcinoma of the Larynx / Squamous Cell Carcinoma of the Oral Cavity / Squamous Cell Carcinoma of the Oropharynx / Squamous Cell Carcinoma of the Paranasal Sinus	1
1, 2	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
1, 2	Recruiting	Treatment	Hepatic Metastases / Uveal Melanoma	1
1, 2	Recruiting	Treatment	Hepatocellular Carcinoma (HCC)	1
1, 2	Recruiting	Treatment	Hepatocellular,Carcinoma / Renal Cell Adenocarcinoma	1
1, 2	Recruiting	Treatment	Immunotherapy / Neoplasms, Head and Neck	1
1, 2	Recruiting	Treatment	Leukemia Acute Myeloid Leukemia (AML) / Leukemias / Myelodysplastic Syndrome	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	3
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Refractory Thoracic Tumors / Thymic Carcinoma	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Tumors, Solid	1
1, 2	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers	1
1, 2	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC) / Small Cell Lung Cancer Extensive Stage	1
1, 2	Recruiting	Treatment	Lymphoma, Hodgkins	4
1, 2	Recruiting	Treatment	Lymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
1, 2	Recruiting	Treatment	Lymphoma, Large B-Cell, Diffuse (DLBCL)	1
1, 2	Recruiting	Treatment	Malignancies	4
1, 2	Recruiting	Treatment	Malignancies / Melanoma / Metastatic Melanoma / Neoplasm of Lung / Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Malignancies / Neoplasms / Tumors	1
1, 2	Recruiting	Treatment	Malignant Lymphomas / Multiple Myeloma (MM)	1
1, 2	Recruiting	Treatment	Malignant Neoplasm of Pancreas	1
1, 2	Recruiting	Treatment	Malignant Neoplasms of Urinary Tract / Other Disorders of Kidney and Ureter / Renal Cell Adenocarcinoma	1
1, 2	Recruiting	Treatment	Malignant Solid Tumours	2
1, 2	Recruiting	Treatment	Melanoma	2
1, 2	Recruiting	Treatment	Melanoma / Melanoma Stage Iii / Melanoma Stage Iv	1
1, 2	Recruiting	Treatment	Metastatic Brain Tumors / Metastatic Malignant Neoplasm in the Brain / Stage IV Non-Small Cell Lung Cancer AJCC v7	1
1, 2	Recruiting	Treatment	Metastatic Melanoma	1
1, 2	Recruiting	Treatment	Metastatic Renal Cell Cancer / Stage IV Renal Cell Cancer	1
1, 2	Recruiting	Treatment	Multiple Myeloma (MM)	1
1, 2	Recruiting	Treatment	Myelodysplastic Syndromes	1
1, 2	Recruiting	Treatment	Neoplasms by Site	2
1, 2	Recruiting	Treatment	Neoplasms, Hematologic	1
1, 2	Recruiting	Treatment	Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Non-Hodgkin's Disease	1
1, 2	Recruiting	Treatment	Non-small Cell Lung Cancer (NSCLC), Head and Neck Squamous Cell Carcinoma (HNSCC), Colorectal Cancer (CRC), Hepatocellular Carcinoma (HCC)	1
1, 2	Recruiting	Treatment	Ovarian Epithelial Cancer	1
1, 2	Recruiting	Treatment	Pancreatic Adenocarcinoma Metastatic	1
1, 2	Recruiting	Treatment	Pancreatic Ductal Adenocarcinoma	1
1, 2	Recruiting	Treatment	Peripheral T Cell Lymphoma (PTCL)	1
1, 2	Recruiting	Treatment	Prostate Cancer	1
1, 2	Recruiting	Treatment	Prostate Cancer / Prostate Disease	1
1, 2	Recruiting	Treatment	Recurrent Central Nervous System Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Refractory Central Nervous System Lymphoma / Refractory Diffuse Large B Cell Lymphoma	1
1, 2	Recruiting	Treatment	Refractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma	1
1, 2	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
1, 2	Recruiting	Treatment	Sarcoma, Bone / Soft Tissue Sarcoma (STS)	1
1, 2	Recruiting	Treatment	Sarcomas / Solid Tumor, Adult / Solid Tumor, Childhood	1
1, 2	Recruiting	Treatment	Squamous Cell Carcinoma of Esophagus	1
1, 2	Recruiting	Treatment	Stage III/IV Melanoma	1
1, 2	Recruiting	Treatment	Various Advanced Cancer	1
1, 2	Terminated	Other	Tumors, Solid	1
1, 2	Terminated	Treatment	Adenocarcinoma of the Lung	1
1, 2	Terminated	Treatment	Cancer, Advanced / Carcinoma, Colorectal / Endometrial / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Renal Cell Adenocarcinoma / Uterine	1
1, 2	Terminated	Treatment	Cancer, Advanced / Hepatocellular,Carcinoma	1
1, 2	Terminated	Treatment	Malignancies	1
1, 2	Terminated	Treatment	Metastatic Cancers	1
1, 2	Withdrawn	Treatment	Adenocarcinoma of the Lung / Lung Cancers	1
1, 2	Withdrawn	Treatment	Advanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage III Uveal Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm	1
1, 2	Withdrawn	Treatment	Squamous Non-Small Cell Lung Cancer	1
2	Active Not Recruiting	Other	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Active Not Recruiting	Treatment	Acute Adult T-Cell Leukemia/Lymphoma / Adult T-Cell Leukemia/Lymphoma / CD3 Positive / CD4-Positive Neoplastic Cells Present / Chronic Adult T-Cell Leukemia/Lymphoma / HTLV-1 Infection / Hypercalcemia / Lymphomatous Adult T-Cell Leukemia/Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Smoldering Adult T-Cell Leukemia/Lymphoma	1
2	Active Not Recruiting	Treatment	Adenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Recurrent, IV-B Cervical cancer / Stage IV Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v7	1
2	Active Not Recruiting	Treatment	Adenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma	1
2	Active Not Recruiting	Treatment	Advanced Non-Small Cell Lung Cancer	2
2	Active Not Recruiting	Treatment	Advanced or Metastatic Melanoma	1
2	Active Not Recruiting	Treatment	Cancer of the Ovary / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm	1
2	Active Not Recruiting	Treatment	Documented Stage III NSCLC, Amenable to Concomitant or Sequential Chemoradiotherapy / Locally Advanced Non-Small Cell Lung Cancer	1
2	Active Not Recruiting	Treatment	Extensive Stage Lung Small Cell Carcinoma / Extensive Stage Small Cell Lung Carcinoma / Recurrent Small Cell Lung Carcinoma	1
2	Active Not Recruiting	Treatment	Head and Neck Carcinoma	1
2	Active Not Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
2	Active Not Recruiting	Treatment	Hodgkins Disease (HD)	1
2	Active Not Recruiting	Treatment	Leukemias	1
2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Non-Small Cell Carcinoma of Lung, TNM Stage 4 / Non-Small-Cell Lung Cancer Metastatic / Recurrent Non Small Cell Lung Cancer	1
2	Active Not Recruiting	Treatment	Microsatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer	1
2	Active Not Recruiting	Treatment	Malignant Lymphomas	1
2	Active Not Recruiting	Treatment	Malignant Pleural Mesothelioma (MPM)	1
2	Active Not Recruiting	Treatment	Melanoma	4
2	Active Not Recruiting	Treatment	Melanoma / Metastatic Brain Tumors	1
2	Active Not Recruiting	Treatment	Melanoma / Metastatic Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Uveal Melanoma	1
2	Active Not Recruiting	Treatment	Mesothelioma	1
2	Active Not Recruiting	Treatment	Metastatic Carcinoma in the Adrenal Cortex / Recurrent Adrenal Cortex Carcinoma / Stage III Adrenal Cortex Carcinoma / Stage IV Adrenal Cortex Carcinoma	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Unresectable Melanoma	1
2	Active Not Recruiting	Treatment	Metastatic Renal Cell Carcinoma	1
2	Active Not Recruiting	Treatment	Multiple Myeloma (MM)	1
2	Active Not Recruiting	Treatment	Nasopharyngeal Nonkeratinizing Carcinoma / Recurrent Nasopharyngeal Undifferentiated Carcinoma / Recurrent Nasopharynx Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Nasopharyngeal Undifferentiated Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Nasopharyngeal Undifferentiated Carcinoma / Stage IVA Nasopharyngeal Carcinoma / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma / Stage IVC Nasopharyngeal Carcinoma AJCC v7	1
2	Active Not Recruiting	Treatment	Non-Hodgkin's Lymphoma (NHL)	1
2	Active Not Recruiting	Treatment	Previously Treated Metastatic Adenocarcinoma of the Pancreas	1
2	Active Not Recruiting	Treatment	Prostate Cancer	1
2	Active Not Recruiting	Treatment	Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma	1
2	Active Not Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
2	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	2
2	Active Not Recruiting	Treatment	Squamous Cell Non-small Cell Lung Cancer	1
2	Active Not Recruiting	Treatment	Tumors, Solid	1
2	Active Not Recruiting	Treatment	Uveal Melanoma	1
2	Active Not Recruiting	Treatment	Various Advanced Cancer	1
2	Completed	Treatment	Glioblastoma Multiforme (GBM)	1
2	Completed	Treatment	Malignant Pleural Mesothelioma (MPM)	1
2	Completed	Treatment	Metastatic Leiomyosarcoma / Unresectable Leiomyosarcoma / Uterine Corpus Leiomyosarcoma	1
2	Completed	Treatment	Refractory, metastatic Colorectal cancer	1
2	Enrolling by Invitation	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Carcinoma	1
2	Not Yet Recruiting	Treatment	Adenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Clinical Stage I Esophageal Adenocarcinoma AJCC v8 / Clinical Stage I Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v8	1
2	Not Yet Recruiting	Treatment	Advanced Melanoma / Metastatic Melanoma / Metastatic Melanoma Stratified by MHC-II Expression	1
2	Not Yet Recruiting	Treatment	Aggressive Non-Hodgkin Lymphoma / Ann Arbor Stage I Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Ann Arbor Stage II B-Cell Non-Hodgkin Lymphoma / Ann Arbor Stage II Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Ann Arbor Stage III B-Cell Non-Hodgkin Lymphoma / Ann Arbor Stage III Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Ann Arbor Stage IV B-Cell Non-Hodgkin Lymphoma / Ann Arbor Stage IV Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / High Grade B-Cell Lymphoma With MYC and BCL2 and/or BCL6 Rearrangements / High Grade B-Cell Lymphoma, Not Otherwise Specified / Indolent Non-Hodgkin's Lymphomas / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Mediastinal B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classic Hodgkin Lymphoma / Transformed Non-Hodgkin Lymphoma	1
2	Not Yet Recruiting	Treatment	Appendiceal Tumor / Colorectal Tumors / Mucinous Neoplasm	1
2	Not Yet Recruiting	Treatment	Basal Cell Nevus Syndrome	1
2	Not Yet Recruiting	Treatment	Breast Neoplasm Female / Cancer, Breast / Carcinoma, Breast / Tumors, Breast	1
2	Not Yet Recruiting	Treatment	Cancer of the Stomach / Gastroesophageal Junction / Malignant Neoplasm of Stomach	1
2	Not Yet Recruiting	Treatment	Cancer, Breast	1
2	Not Yet Recruiting	Treatment	Central Nervous System B-Cell Non-Hodgkin Lymphoma / Recurrent Central Nervous System Lymphoma / Refractory Central Nervous System Lymphoma	1
2	Not Yet Recruiting	Treatment	Cervical Cancers	1
2	Not Yet Recruiting	Treatment	Chondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)	1
2	Not Yet Recruiting	Treatment	Chordomas / Locally Advanced Chordoma / Metastatic Chordoma / Unresectable Chordoma	1
2	Not Yet Recruiting	Treatment	Circulating Tumor DNA / Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Not Yet Recruiting	Treatment	Classic Kaposi Sarcoma	1
2	Not Yet Recruiting	Treatment	Cutaneous Melanoma, Stage III / Cutaneous Melanoma, Stage IV / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Unresectable Melanoma	1
2	Not Yet Recruiting	Treatment	Gastric and Esophagogastric Junction Adenocarcinoma	1
2	Not Yet Recruiting	Treatment	Giant Cell Glioblastoma / Gliosarcoma / Oligodendrogliomas / Recurrent Glioblastoma / Small Cell Glioblastoma	1
2	Not Yet Recruiting	Treatment	Glioblastomas / Gliomas / High Grage Glioma / Low Grade Glioma (LGG) / Malignant Gliomas	1
2	Not Yet Recruiting	Treatment	Grade I Neuroendocrine Carcinoma / Grade II Neuroendocrine Carcinoma / Grade III Neuroendocrine Carcinoma / Large Cell Neuroendocrine Carcinoma / Lung Cancer Small Cell Lung Cancer (SCLC) / Lung carcinoma cell type unspecified stage IV / Metastatic Neuroendocrine Carcinoma / Metastatic Small Cell Lung Cancer / Neuroendocrine Carcinomas / Neuroendocrine Tumors / Recurrent Small Cell Lung Carcinoma / Refractory Small Cell Lung Carcinoma	1
2	Not Yet Recruiting	Treatment	Head and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
2	Not Yet Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
2	Not Yet Recruiting	Treatment	Hepatocellular Carcinoma (HCC)	1
2	Not Yet Recruiting	Treatment	Inoperable œsophageal Cancer	1
2	Not Yet Recruiting	Treatment	Locally Advanced Head and Neck Carcinoma / Recurrent Head and Neck Carcinoma	1
2	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Not Yet Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC)	1
2	Not Yet Recruiting	Treatment	Lymphoma, B-Cell	1
2	Not Yet Recruiting	Treatment	Lymphoma, Hodgkins	1
2	Not Yet Recruiting	Treatment	Melanoma	1
2	Not Yet Recruiting	Treatment	Melanoma Stage Iv	1
2	Not Yet Recruiting	Treatment	Multiple Myeloma (MM)	1
2	Not Yet Recruiting	Treatment	Nasopharyngeal Carcinoma	1
2	Not Yet Recruiting	Treatment	Neuroendocrine Carcinomas	1
2	Not Yet Recruiting	Treatment	Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Recurrent Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma	1
2	Not Yet Recruiting	Treatment	Renal Cell Carcinoma, Metastatic	1
2	Not Yet Recruiting	Treatment	Resectable Biliary Tract Cancer	1
2	Not Yet Recruiting	Treatment	Soft Tissue Sarcoma (STS)	1
2	Not Yet Recruiting	Treatment	Squamous Cell Carcinoma of the Oral Cavity	1
2	Not Yet Recruiting	Treatment	Urinary Bladder Cancer	1
2	Not Yet Recruiting	Treatment	Various Advanced Cancer	1
2	Recruiting	Prevention	Colon Adenomas / Colon Carcinoma / Lynch Syndrome / MLH1 Gene Mutation / MSH2 Gene Mutation	1
2	Recruiting	Prevention	Oral Leukoplakia	1
2	Recruiting	Treatment	Activated B-Cell-Like Diffuse Large B-Cell Lymphoma / ALK-Positive Large B-Cell Lymphoma / Atypical Burkitt/Burkitt-Like Lymphoma / Burkitt-Like Lymphoma With 11q Aberration / Diffuse Large B-Cell Lymphoma Activated B-Cell Type / Diffuse Large B-Cell Lymphoma Associated With Chronic Inflammation / Diffuse Large B-Cell Lymphoma Germinal Center B-Cell Type / Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Diffuse Large B-Cell Lymphoma, Not Otherwise Specified / EBV-Positive Mucocutaneous Ulcer / Epstein-Barr Virus Positive Diffuse Large B-Cell Lymphoma of the Elderly / Epstein-Barr Virus-Positive Mucocutaneous Ulcer / Epstein-Barr Virus-Positive Neoplastic Cells Present / Germinal Center B-Cell-Like Diffuse Large B-Cell Lymphoma / High-Grade B-Cell Lymphoma With MYC and BCL2 and/or BCL6 Rearrangements / High-Grade B-Cell Lymphoma With MYC, BCL2, and BCL6 Rearrangements / Human Herpes Virus 8-Related Malignant Neoplasm / Human Herpesvirus 8-Positive Neoplastic Cells Present / Human Herpesvirus-8-Positive Neoplastic Cells Present / Intravascular Large B-Cell Lymphoma / Large B-Cell Lymphoma With IRF4 Rearrangement / MYC-Negative B-Cell Lymphoma With 11q Aberration Resembling Burkitt Lymphoma / Plasmablastic Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma / Primary Cutaneous Diffuse Large B-Cell Lymphoma, Leg Type / Primary Diffuse Large B-Cell Lymphoma of the Central Nervous System / Primary Effusion Lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classic Hodgkin Lymphoma / Recurrent B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classical Hodgkin Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Lymphomatoid Granulomatosis / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Recurrent Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classic Hodgkin Lymphoma / Refractory B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classical Hodgkin Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Primary Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Skin Ulcers / Small Intestinal B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Burkitt Lymphoma / Small Intestinal High Grade B-Cell Lymphoma, Not Otherwise Specified / T-Cell/Histiocyte-Rich Large B-Cell Lymphoma	1
2	Recruiting	Treatment	Acinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Carcinoma, Adenoid Cystic / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Desmoid-Type Fibromatosis / Endometrial Adenocarcinomas / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Gastric Undifferentiated Carcinoma / Gastrointestinal Stromal Tumors / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metaplastic breast carcinoma / Metastatic Malignant Neoplasm of Unknown Primary Origin / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Rare Disorder / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Carcinoma / Vulvar Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Acute Bilineal Leukemia / Acute Biphenotypic Leukemia (ABL) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute, recurrent Myeloid Leukemia / Chronic Myelomonocytic Leukemia / Leukemias / Myelodysplastic Syndrome / Refractory Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Therapy-Related Acute Myeloid Leukemia	1
2	Recruiting	Treatment	Acute myeloid leukaemia (in remission) / Adult Acute Myeloid Leukemia in Remission	1
2	Recruiting	Treatment	Adenocarcinoma of the Lung / Lung Cancers / Non-Squamous Non-Small Cell Lung Cancer (NSCLC) / Squamous Cell Carcinoma of Lung	1
2	Recruiting	Treatment	Adenocarcinoma of the Pancreas	1
2	Recruiting	Treatment	Adenocarcinoma of the Stomach / Esophageal Cancers / Gastrooesophageal Cancer / HER2 Positive Gastric Cancer / Malignant Neoplasm of Stomach / Metastatic Gastric Cancers	1
2	Recruiting	Treatment	Adenocarcinoma of the Stomach / Gastrooesophageal Cancer	1
2	Recruiting	Treatment	Adenocarcinomas	1
2	Recruiting	Treatment	Adnexal Carcinoma / Apocrine Carcinoma / Carcinoma, Adenoid Cystic / Eccrine Porocarcinoma / Extraocular Cutaneous Sebaceous Carcinoma / Hidradenocarcinoma / Keratoacanthoma / Malignant sweat gland neoplasm / Microcystic Adnexal Carcinoma / Neuroendocrine Carcinoma of the Skin / NK-Cell Lymphoma, Unclassifiable / Non-Melanomatous Lesion / Paget's Disease / Papillary Adenocarcinoma / Primary Cutaneous Mucinous Carcinoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Refractory T-Cell Non-Hodgkin Lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Sezary Syndrome / Signet Ring Cell Carcinoma / Skin Basal Cell Carcinoma / Skin Basosquamous Cell Carcinoma / Skin Squamous Cell Carcinoma / Spiradenocarcinoma / Squamous Cell Carcinoma of Unknown Primary Origin / Stage III Skin Cancer / Stage IV Skin Cancer / Sweat Gland Carcinoma / Trichilemmocarcinoma / Vulvar Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Adrenocortical Carcinoma / Genitourinary Cancers / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell	1
2	Recruiting	Treatment	Adult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / CD30-Positive Neoplastic Cells Present / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Post Transplant Lymphoproliferative Disorder / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Hodgkin Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Non-Hodgkin Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Refractory Hodgkin Lymphoma / Refractory Non-Hodgkin's lymphoma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)	1
2	Recruiting	Treatment	Advanced Gastric Cancer	1
2	Recruiting	Treatment	Advanced Malignant Neoplasm / Advanced Malignant Solid Neoplasm / Bladder Carcinoma / Carcinoma, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Cervical Carcinoma / Colon Carcinoma / Endometrial Carcinoma / Gastric Carcinoma / Gliomas / Head and Neck Carcinoma / Liver and Intrahepatic Bile Duct Carcinoma / Lung, Carcinoma / Malignant Lymphomas / Malignant Uterine Neoplasm / Melanoma / Oesophageal Carcinoma / Ovarian Carcinoma / Plasma Cell Myeloma / Prostate Cancer / Rectal Carcinoma / Recurrent Bladder Carcinoma / Recurrent Breast Carcinoma / Recurrent Cervical Carcinoma / Recurrent Colon Carcinoma / Recurrent Colorectal Carcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Gliomas / Recurrent Head and Neck Carcinoma / Recurrent Liver Carcinoma / Recurrent Lung Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Plasma Cell Myeloma / Recurrent Prostate Carcinoma / Recurrent Rectal Carcinoma / Recurrent Skin Carcinoma / Recurrent Solid Neoplasm / Recurrent Thyroid Gland Carcinoma / Recurrent Uterine Corpus Carcinoma / Refractory Lymphomas / Refractory Malignant Neoplasm / Refractory Malignant Solid Neoplasm / Refractory Plasma Cell Myeloma / Renal Carcinoma / Skin Carcinoma / Solid Neoplasms / Thyroid Gland Carcinoma / Uterine Corpus Cancer	1
2	Recruiting	Treatment	Advanced Metastatic Cancer	1
2	Recruiting	Treatment	Advanced Non-Small Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers	1
2	Recruiting	Treatment	Advanced Pancreatic Cancer	1
2	Recruiting	Treatment	Advanced Renal Cell Carcinoma	1
2	Recruiting	Treatment	Advanced Solid Tumors	1
2	Recruiting	Treatment	Advanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
2	Recruiting	Treatment	Advanced Stage Non-small Cell Lung Cancer	1
2	Recruiting	Treatment	Advanced or Metastatic Non-clear Cell Renal Cell Carcinoma	1
2	Recruiting	Treatment	Anal Basaloid Carcinoma / Anal Canal Cloacogenic Carcinoma / Anal Margin Squamous Cell Carcinoma / Stage II Anal Canal Cancer AJCC v6 and v7 / Stage IIB Anal Cancer AJCC v8 / Stage III Anal Canal Cancer AJCC v6 and v7 / Stage IIIA Anal Canal Cancer AJCC v6 and v7 / Stage IIIB Anal Canal Cancer AJCC v6 and v7	1
2	Recruiting	Treatment	Anal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Recurrent Anal Canal Carcinoma / Stage IV Anal Canal Cancer / Stage IV Anal Canal Cancer AJCC v6 and v7	1
2	Recruiting	Treatment	Ann Arbor Stage I Hodgkin Lymphoma / Ann Arbor Stage I Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage I Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage I Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IA Hodgkin Lymphoma / Ann Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage II Lymphocyte-Depleted Classic Hodgkin Lymphoma / Ann Arbor Stage II Mixed Cellularity Classic Hodgkin Lymphoma / Ann Arbor Stage II Nodular Sclerosis Classic Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Lymphocyte-Rich Classic Hodgkin Lymphoma	1
2	Recruiting	Treatment	Ann Arbor Stage I Hodgkin Lymphoma / Ann Arbor Stage IA Hodgkin Lymphoma / Ann Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Stage I Hodgkin Lymphoma / Stage IA Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma	1
2	Recruiting	Treatment	Ann Arbor Stage IB Hodgkin Lymphoma / Ann Arbor Stage II Hodgkin Lymphoma / Ann Arbor Stage IIA Hodgkin Lymphoma / Ann Arbor Stage IIB Hodgkin Lymphoma / Ann Arbor Stage III Hodgkin Lymphoma / Ann Arbor Stage IIIA Hodgkin Lymphoma / Ann Arbor Stage IIIB Hodgkin Lymphoma / Ann Arbor Stage IV Hodgkin Lymphoma / Ann Arbor Stage IVA Hodgkin Lymphoma / Ann Arbor Stage IVB Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Classical Hodgkin Lymphoma / Stage IB Hodgkin Lymphoma / Stage II Hodgkin Lymphoma / Stage IIA Hodgkin Lymphoma / Stage IIB Hodgkin Lymphoma / Stage III Hodgkin Lymphoma / Stage IIIA Hodgkin Lymphoma / Stage IIIB Hodgkin Lymphoma / Stage IV Hodgkin Lymphoma / Stage IVA Hodgkin Lymphoma / Stage IVB Hodgkin Lymphoma	1
2	Recruiting	Treatment	BCL-2 Translocation / High-grade B-cell Lymphoma / Lymphoma, B-Cell / MYC Translocation / Non Hodgkin Lymphoma (NHL)	1
2	Recruiting	Treatment	BRAF Gene Mutation / BRAF wt Allele / Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
2	Recruiting	Treatment	Basal Cell Carcinoma (BCC)	1
2	Recruiting	Treatment	Biliary Tract Cancer	1
2	Recruiting	Treatment	Biliary Tract Cancer / Biliary Tract Neoplasms	1
2	Recruiting	Treatment	Biliary Tract Neoplasms	1
2	Recruiting	Treatment	Bladder Cancers	3
2	Recruiting	Treatment	Bladder Cancers / Bladder Tumors / Neoplasms, Bladder	1
2	Recruiting	Treatment	Bladder Cancers / Melanoma	1
2	Recruiting	Treatment	Bladder Cancers / Transitional Cell Carcinoma	1
2	Recruiting	Treatment	Bladder transitional cell carcinoma / Transitional Cell Carcinoma / Urothelial Carcinoma of the Renal Pelvis and Ureter / Urothelial Carcinoma Ureter / Urothelial Carcinoma Urethra	1
2	Recruiting	Treatment	Blastic Plasmacytoid Dendritic Cell Neoplasm (BPDCN) / Hepatosplenic T-Cell Lymphoma / HTLV-1 Infection / NK-Cell Lymphoma, Unclassifiable / Primary Systemic Anaplastic Large Cell Lymphoma, ALK-Negative / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Anaplastic Large Cell Lymphoma / Recurrent Angioimmunoblastic T-cell Lymphoma / Recurrent Enteropathy-Associated T-Cell Lymphoma / Recurrent Mycosis Fungoides / Refractory Adult T-Cell Leukemia/Lymphoma / Refractory Anaplastic Large Cell Lymphoma / Refractory Angioimmunoblastic T-cell Lymphoma / Refractory Enteropathy-Associated T-Cell Lymphoma / Refractory Nasal Type Extranodal NK/T-Cell Lymphoma / Refractory Peripheral T-Cell Lymphoma, Not Otherwise Specified / Refractory, advanced Mycosis fungoides	1
2	Recruiting	Treatment	Brain Metastases, Adult / Clear-cell Metastatic Renal Cell Carcinoma / Non Small Cell Lung Cancer Metastatic	1
2	Recruiting	Treatment	Bronchial dysplasia / History of Head and Neck Cancer / History of Non-Small Cell Lung Cancer / Tobacco Smoking Behavior	1
2	Recruiting	Treatment	CD (Cluster of Differentiation) 30-Positive Neoplastic Cells Present / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / TNFRSF8 Positive	1
2	Recruiting	Treatment	Cancer of the Ovary / Clear Cell Adenocarcinoma / Extra Renal Origin / Fallopian Tube Cancer / Primary Peritoneal Carcinoma	1
2	Recruiting	Treatment	Cancer of the Ovary / Malignant Neoplasm of Female Breast / Malignant Neoplasm of Stomach	1
2	Recruiting	Treatment	Cancer of the Stomach / Esophagogastric Junction / Malignant Neoplasm of Stomach	1
2	Recruiting	Treatment	Cancer, Advanced	2
2	Recruiting	Treatment	Cancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma	1
2	Recruiting	Treatment	Cancer, Breast	3
2	Recruiting	Treatment	Cancer, Breast / Luminal B	1
2	Recruiting	Treatment	Carcinoid Tumors / Neuroendocrine Tumors	1
2	Recruiting	Treatment	Carcinoma, Squamous Cell of Head and Neck / Oropharynx Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Carcinoma, Squamous Cell of Head and Neck / Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck	1
2	Recruiting	Treatment	Carcinoma，Non-Small-Cell Lung / Large Cell Lung Carcinoma Metastatic / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Lung Adenocarcinoma / Metastatic Lung Cancer	1
2	Recruiting	Treatment	Castration-Resistant Prostate Cancer (CRPC) / Metastatic Hormone Refractory Prostate Cancer / Prostate Cancer	1
2	Recruiting	Treatment	Cholangiocarcinomas / Malignant Neoplasm of Pancreas / Pancreatic Cancer Metastatic / Previously Treated Unresectable or Metastatic Cholangiocarcinoma and Pancreactic Cancer / Previously Treated Unresectable or Metastatic Cholangiocarcinoma and Pancreatic Cancer	1
2	Recruiting	Treatment	Chordomas / Ependymomas / Meningiomas	1
2	Recruiting	Treatment	Chromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma	1
2	Recruiting	Treatment	Chronic Lymphocytic Leukaemia (CLL) / Leukemias	1
2	Recruiting	Treatment	Classical Hodgkin Lymphoma	2
2	Recruiting	Treatment	Classical Hodgkin Lymphoma / Hematopoietic Cell Transplantation Recipient / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
2	Recruiting	Treatment	Clear Cell Metastatic Renal Cell Carcinoma	1
2	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma	1
2	Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
2	Recruiting	Treatment	Coexisting Medical Conditions / Lymphoma, Hodgkins	1
2	Recruiting	Treatment	Colon Carcinoma	1
2	Recruiting	Treatment	Colorectal Adenocarcinoma / Microsatellite Stable (MSS) Colorectal Adenocarcinomas	1
2	Recruiting	Treatment	Colorectal neoplasms malignant	1
2	Recruiting	Treatment	Cutaneous Melanoma / Melanoma / Mucosal Melanoma / Ocular Melanoma / Oligometastatic Melanoma / Stage III Acral Lentiginous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Uveal Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Uveal Melanoma AJCC v7 / Stage IV Acral Lentiginous Melanoma AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma AJCC v7	1
2	Recruiting	Treatment	Disorders, Lymphoproliferative / Epstein-Barr Virus Infections / Lymphoproliferative Disorders / Malignant Lymphomas	1
2	Recruiting	Treatment	EGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Esophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Esophagus / Metastatic Esophageal Cancer / Metastatic Oesophageal Cancer / Oesophageal Cancer Nos	1
2	Recruiting	Treatment	Eye and Orbit	1
2	Recruiting	Treatment	GBM / MGMT-unmethylated Glioblastoma (GBM)	1
2	Recruiting	Treatment	Gastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours	1
2	Recruiting	Treatment	Gastrointestinal Stromal Tumors	1
2	Recruiting	Treatment	Germ Cell Tumors	1
2	Recruiting	Treatment	Glioblastomas	2
2	Recruiting	Treatment	Gliomas	1
2	Recruiting	Treatment	HER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma	1
2	Recruiting	Treatment	HNSCC / HPV-Related Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Haematological Malignancies	1
2	Recruiting	Treatment	Head and Neck Carcinoma	2
2	Recruiting	Treatment	Hepatic Carcinoma / Hepatocellular Cancer / Hepatocellular,Carcinoma	1
2	Recruiting	Treatment	Hepatocellular,Carcinoma	3
2	Recruiting	Treatment	Hepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs	1
2	Recruiting	Treatment	Higher Risk Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML)	1
2	Recruiting	Treatment	Hodgkins Disease (HD)	2
2	Recruiting	Treatment	Human Immunodeficiency Virus Infection(HIV)/Acquired Immunodeficiency Syndrome (AIDS) / Non Small Cell Lung Cancer Metastatic / Non Small Cell Lung Cancer Stage IIIB	1
2	Recruiting	Treatment	Kidney Cancer Metastatic / Kidney Cancer, Stage IV / Renal Cancers	1
2	Recruiting	Treatment	Leptomeningeal Carcinomatosis / Melanoma	1
2	Recruiting	Treatment	Leukemia Acute Myeloid Leukemia (AML)	1
2	Recruiting	Treatment	Leukemia Acute Myeloid Leukemia (AML) / Leukemias	1
2	Recruiting	Treatment	Leukemias / Myelodysplastic Syndrome	1
2	Recruiting	Treatment	Limited Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)	1
2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	13
2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs	1
2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Non-squamous Cell Lung Cancer / Squamous Cell Carcinoma of Lung	1
2	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers / Relapsed Small cell lung cancer	1
2	Recruiting	Treatment	Lung Cancers	1
2	Recruiting	Treatment	Lung Squamous Cell Carcinoma Stage IV / Metastatic Uveal Melanoma / Nonsquamous Nonsmall Cell Neoplasm of Lung	1
2	Recruiting	Treatment	Lymph Node Cancer / Melanoma	1
2	Recruiting	Treatment	Lymphoma, Hodgkins	2
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer	1
2	Recruiting	Treatment	MSI-H Tumors / Refractory MSI - H Solid Tumors Prior of PD-(L) 1 Therapy	1
2	Recruiting	Treatment	Major Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma	1
2	Recruiting	Treatment	Malignancies	1
2	Recruiting	Treatment	Malignancies / Neoplasms / Tumors	1
2	Recruiting	Treatment	Malignant Lymphomas	1
2	Recruiting	Treatment	Malignant Lymphomas / Metastatic Bladder Cancer / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Metastatic Renal Cell Cancer / Recurrent Bladder Carcinoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Renal Cell Carcinoma Recurrent / Stage III Bladder Cancer / Stage III Lymphoma / Stage III Non-Small Cell Lung Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Lymphoma / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Bladder Cancer / Stage IVB Bladder Cancer / Stages III Skin Melanoma / Unresectable Head and Neck Squamous Cell Carcinoma / Unresectable Solid Neoplasm	1
2	Recruiting	Treatment	Malignant Melanoma	2
2	Recruiting	Treatment	Malignant Melanoma Stage III	1
2	Recruiting	Treatment	Malignant Neoplasm of Colon	1
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas	4
2	Recruiting	Treatment	Melanoma	5
2	Recruiting	Treatment	Melanoma (Skin)	1
2	Recruiting	Treatment	Meningiomas	1
2	Recruiting	Treatment	Mesothelioma, Malignant	1
2	Recruiting	Treatment	Metastatic Adult Soft Tissue Sarcoma	1
2	Recruiting	Treatment	Metastatic Biliary Tract Cancer / Pancreatic Cancer Metastatic	1
2	Recruiting	Treatment	Metastatic Brain Tumors / Metastatic Melanoma	1
2	Recruiting	Treatment	Metastatic Cancer Colorectal	1
2	Recruiting	Treatment	Metastatic Cancers / Metastatic Castration Resistant Prostate Cancer	1
2	Recruiting	Treatment	Metastatic Cancers / Recurrent Cancer / Salivary Gland Carcinoma	1
2	Recruiting	Treatment	Metastatic Clear Cell Renal Cell Carcinoma	1
2	Recruiting	Treatment	Metastatic Colorectal Cancers	2
2	Recruiting	Treatment	Metastatic Melanoma	3
2	Recruiting	Treatment	Metastatic Melanoma / Stage IV Melanoma	1
2	Recruiting	Treatment	Metastatic Renal Cancer	1
2	Recruiting	Treatment	Metastatic Renal Cell Cancer / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Skin Melanoma	1
2	Recruiting	Treatment	Metastatic Renal Cell Carcinoma	2
2	Recruiting	Treatment	Metastatic Renal Cell Carcinoma / Renal Cell Carcinoma Associated With Xp11.2 Translocations/TFE3 Gene Fusions / Stage III Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / TFE3 Gene Translocation / TFEB Gene Translocation	1
2	Recruiting	Treatment	Metastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic	1
2	Recruiting	Treatment	Metastatic Urothelial Cancer	1
2	Recruiting	Treatment	Microsatellite Instability / Neoplasms, Head and Neck / Penile Neoplasms / Renal Cell Adenocarcinoma / Skin Neoplasms	1
2	Recruiting	Treatment	Mucosal Melanoma	1
2	Recruiting	Treatment	Muscle Invasive Bladder Cancer	1
2	Recruiting	Treatment	Name Human Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Stage II Oropharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Oral Cavity Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Laryngeal Squamous Cell Carcinoma / Stage IV Oral Cavity Squamous Cell Carcinoma / Stage IV Oropharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Oral Cavity Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Oral Cavity Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVC Hypopharyngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Oral Cavity Squamous Cell Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Nasopharyngeal Carcinoma	2
2	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin	1
2	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin / Skin Cancers	1
2	Recruiting	Treatment	Non Small Cell Lung Cancer Stage IIIB	1
2	Recruiting	Treatment	Non-Small Lung Cancer, Epigenetic Therapy	1
2	Recruiting	Treatment	Non-Squamous Non-Small Cell Lung Carcinoma / Stage I Non-Small Cell Lung Cancer / Stage I Non-Small Cell Lung Cancer AJCC v7 / Stage IA Non-Small Cell Lung Carcinoma / Stage IA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7	1
2	Recruiting	Treatment	Oral Cavity SCC	1
2	Recruiting	Treatment	Other Disorders of Kidney and Ureter / Renal Medullary Carcinoma	1
2	Recruiting	Treatment	Pan Tumor	1
2	Recruiting	Treatment	Prostate Cancer	5
2	Recruiting	Treatment	Prostate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma	1
2	Recruiting	Treatment	Recurrent Glioblastoma	1
2	Recruiting	Treatment	Recurrent Head and Neck Cancer	1
2	Recruiting	Treatment	Recurrent Head and Neck Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer	1
2	Recruiting	Treatment	Recurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma	1
2	Recruiting	Treatment	Recurrent Uterine Corpus Carcinoma / Stage III Uterine Corpus Cancer AJCC v7 / Stage IIIA Uterine Corpus Cancer AJCC v7 / Stage IIIB Uterine Corpus Cancer AJCC v7 / Stage IIIC Uterine Corpus Cancer AJCC v7 / Stage IIIC1 Uterine Corpus Cancer AJCC v7 / Stage IIIC2 Uterine Corpus Cancer AJCC v7 / Stage IV Uterine Corpus Cancer AJCC v7 / Stage IVA Uterine Corpus Cancer AJCC v7 / Stage IVB Uterine Corpus Cancer AJCC v7	1
2	Recruiting	Treatment	Renal Cancers	1
2	Recruiting	Treatment	Renal Cell Adenocarcinoma	3
2	Recruiting	Treatment	Salivary Gland Cancers	1
2	Recruiting	Treatment	Sarcomas	1
2	Recruiting	Treatment	Small Cell Lung Carcinoma / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v8	1
2	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
2	Recruiting	Treatment	Stage II Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage IV Bladder Urothelial Carcinoma AJCC v7	1
2	Recruiting	Treatment	Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
2	Recruiting	Treatment	Stage III Hepatocellular Carcinoma AJCC v8 / Stage IIIA Hepatocellular Carcinoma AJCC v8 / Stage IIIB Hepatocellular Carcinoma AJCC v7 / Stage IIIC Hepatocellular Carcinoma AJCC v7 / Stage IV Hepatocellular Carcinoma AJCC v8 / Stage IVA Hepatocellular Carcinoma AJCC v8 / Stage IVB Hepatocellular Carcinoma AJCC v8	1
2	Recruiting	Treatment	Stage IV Melanoma / Unresectable Stage III Melanoma	1
2	Recruiting	Treatment	Systemic Connective Tissue Disorders	1
2	Recruiting	Treatment	Thymic Carcinoma / Thymoma Type B3 / Type B3 Thymoma and Thymic Carcinoma	1
2	Recruiting	Treatment	Thyroid Cancers	1
2	Recruiting	Treatment	Triple Negative Breast Cancer (TNBC)	1
2	Recruiting	Treatment	Untreated Metastatic Pancreatic Ductal Adenocarcinoma	1
2	Recruiting	Treatment	Various Advanced Cancer	1
2	Suspended	Treatment	Gastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Metastatic Liposarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Liposarcoma	1
2	Suspended	Treatment	C-MET Gene Amplification / MET Exon 14 Mutation / Metastatic Lung Non-Squamous Non-Small Cell Carcinoma / Metastatic Non-Squamous Non-Small Cell Lung Carcinoma / Recurrent Non-Squamous Non-Small Cell Lung Carcinoma / RET/PTC Rearrangement / ROS1 Gene Rearrangement / Stage IV Non-Small Cell Lung Cancer AJCC v7	1
2	Suspended	Treatment	Smoldering Multiple Myeloma (SMM)	1
2	Terminated	Diagnostic	Brain Metastasis / Melanoma	1
2	Terminated	Treatment	Hepatomegaly / Myelofibrosis Transformation in Essential Thrombocythemia / Myeloproliferative Disorders / Polycythemia Vera, Post-Polycythemic Myelofibrosis Phase / Primary Myelofibrosis / Splenomegaly	1
2	Terminated	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Metastatic Lung Cancer	1
2	Terminated	Treatment	Solid Tumors Induced by Prior Radiation Exposure	1
2	Withdrawn	Treatment	Advanced Non-Small Cell Lung Cancer / Metastatic Non-Small Cell Lung Cancer / Neoplasms, Lung	1
2	Withdrawn	Treatment	Cervical Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oesophageal Carcinoma / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma	1
2	Withdrawn	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
2	Withdrawn	Treatment	Lung Cancer, Nonsmall Cell, Stage I	1
2	Withdrawn	Treatment	Melanoma	1
2	Withdrawn	Treatment	Melanoma / Metastatic Melanoma	1
2	Withdrawn	Treatment	Multiple Myeloma (MM)	1
2	Withdrawn	Treatment	Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer	1
2	Withdrawn	Treatment	Renal Cell Adenocarcinoma	1
2, 3	Active Not Recruiting	Treatment	Malignant Neoplasm of Stomach	1
2, 3	Recruiting	Treatment	Colorectal Cancers	1
2, 3	Recruiting	Treatment	Melanoma	2
2, 3	Recruiting	Treatment	Non-Hodgkin's Lymphoma (NHL)	1
2, 3	Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v7	1
2, 3	Suspended	Treatment	Adult Myelodysplastic Syndrome / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Myelodysplastic Syndrome With Excess Blasts-2 / Untreated Adult Acute Myeloid Leukemia	1
2, 3	Suspended	Treatment	Recurrent Melanoma of the Skin / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
3	Active Not Recruiting	Treatment	Advanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
3	Active Not Recruiting	Treatment	Advanced or Metastatic (Medically or Surgically Unresectable) Clear-cell Renal Cell Carcinoma	1
3	Active Not Recruiting	Treatment	Hepatocellular,Carcinoma / I.V Advanced Cancer	1
3	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	3
3	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers	1
3	Active Not Recruiting	Treatment	Lung Cancers	3
3	Active Not Recruiting	Treatment	Malignant Neoplasm of Stomach	1
3	Active Not Recruiting	Treatment	Melanoma	6
3	Active Not Recruiting	Treatment	Melanoma / Skin Cancers	1
3	Active Not Recruiting	Treatment	Mesothelioma	1
3	Active Not Recruiting	Treatment	Multiple Myeloma (MM)	1
3	Active Not Recruiting	Treatment	Non-Squamous Cell Non-small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Recurrent Glioblastoma	1
3	Active Not Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	2
3	Active Not Recruiting	Treatment	Squamous Cell Non-small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Stage IV or Recurrent Non-Small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Unresectable or Metastatic Melanoma	2
3	Not Yet Recruiting	Treatment	Advanced Non Small Cell Lung Cancer	1
3	Not Yet Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
3	Not Yet Recruiting	Treatment	Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
3	Recruiting	Screening	Adenocarcinoma of the Lung / Adenosquamous Lung Carcinoma / Large Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Squamous Cell Lung Carcinoma / Stage IB Squamous Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage II Squamous Cell Lung Carcinoma / Stage II Squamous Cell Lung Carcinoma AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIA Squamous Cell Lung Carcinoma / Stage IIA Squamous Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Squamous Cell Lung Carcinoma / Stage IIB Squamous Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Squamous Cell Lung Carcinoma / Stage IIIA Squamous Cell Lung Carcinoma AJCC v7	1
3	Recruiting	Treatment	Bladder Cancers / BMS-986205 / Muscle-invasive Bladder Cancer	1
3	Recruiting	Treatment	BRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
3	Recruiting	Treatment	Brain Cancer	1
3	Recruiting	Treatment	Cancer, Advanced	1
3	Recruiting	Treatment	Complete Response / Fallopian Tube Cancer / FIGO Stage III-IV / Newly Diagnosed / Ovarian Epithelial Cancer / Partial Response / Primary Peritoneal	1
3	Recruiting	Treatment	Esophageal Cancers	1
3	Recruiting	Treatment	Gastroesophageal Junction Cancer / Malignant Neoplasm of Stomach	1
3	Recruiting	Treatment	Head and Neck Carcinoma	2
3	Recruiting	Treatment	Hepatocellular,Carcinoma / Liver Cancer	1
3	Recruiting	Treatment	Hodgkins Disease (HD)	1
3	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	5
3	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs	1
3	Recruiting	Treatment	Malignant Neoplasm of Stomach	1
3	Recruiting	Treatment	Melanoma	1
3	Recruiting	Treatment	Mesothelioma	1
3	Recruiting	Treatment	Metastatic Brain Tumors	1
3	Recruiting	Treatment	Neoplasms, Brain	1
3	Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v7	1
3	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
3	Recruiting	Treatment	Sarcomatoid Renal Cell Carcinoma / Stage II Renal Cell Cancer / Stage II Renal Cell Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Unclassified Renal Cell Carcinoma	1
3	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
3	Recruiting	Treatment	Squamous Non-Small Cell Lung Cancer	1
3	Recruiting	Treatment	Stage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7	1
3	Recruiting	Treatment	Urothelial Cancer	1
3	Recruiting	Treatment	Various Advanced Cancer	2
3	Terminated	Treatment	Head and Neck Carcinoma	1
3	Terminated	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers	1
3	Withdrawn	Treatment	Head and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
3	Withdrawn	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
3	Withdrawn	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers	1
4	Active Not Recruiting	Other	Renal Cell Adenocarcinoma	1
4	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	1
4	Not Yet Recruiting	Diagnostic	Lung Cancers / Melanoma / Non-small Cell	1
4	Not Yet Recruiting	Treatment	Pancreatic Cancer Stage IV	1
4	Recruiting	Not Available	Metastatic Melanoma	1
4	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Kidney / Renal Cancers / Renal Neoplasms	1
4	Recruiting	Treatment	Lung Cancers	1
Not Available	Active Not Recruiting	Not Available	Inflammation, Brain	1
Not Available	Active Not Recruiting	Treatment	Cancer, Breast	1
Not Available	Available	Not Available	Pediatric Cancer	1
Not Available	Completed	Not Available	Lung Cancer Non-Small Cell Cancer (NSCLC) / Nivolumab Treatment in Expanded Use in Real World	1
Not Available	Completed	Not Available	Melanoma	1
Not Available	No Longer Available	Not Available	Malignant Melanoma	1
Not Available	No Longer Available	Not Available	Non-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer	1
Not Available	No Longer Available	Not Available	Stage III (Unresectable) or Stage IV Advanced Melanoma	1
Not Available	Recruiting	Not Available	Acral lentiginous melanoma / Mucosal Melanoma	1
Not Available	Recruiting	Not Available	DNA Damage / DNA Double Strand Break / HNSCC	1
Not Available	Recruiting	Not Available	Metastatic Cancers	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage forms

Form	Route	Strength
Injection	Intravenous	10 mg/1mL
Solution	Intravenous	10 mg

Prices

Not Available

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
US2013173223	No	2013-05-13	2033-05-13

Properties

State

Solid

Experimental Properties

Property	Value	Source
melting point (°C)	80-90 ºC (based on IgG properties)	McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282
boiling point (°C)	Fab and Fc domains denaturates at 60 and 70 ºC respectively	Arnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility	50 mg/ml	Human IgG purified. Product Information
isoelectric point	6.1-8.5	Agrisera Information about IgG antibodies.

Taxonomy

Description: Not Available
Kingdom: Organic Compounds
Super Class: Organic Acids
Class: Carboxylic Acids and Derivatives
Sub Class: Amino Acids, Peptides, and Analogues
Direct Parent: Peptides
Alternative Parents: Not Available
Substituents: Not Available
Molecular Framework: Not Available
External Descriptors: Not Available

Targets

Details1. Programmed cell death protein 1

Kind: Protein
Organism: Human
Pharmacological action: Yes
Actions: Antibody

General Function: Signal transducer activity
Specific Function: Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. ...
Gene Name: PDCD1
Uniprot ID: Q15116
Uniprot Name: Programmed cell death protein 1
Molecular Weight: 31646.635 Da

References

Taneja SS: Re: Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. J Urol. 2012 Dec;188(6):2149. [PubMed:23289116]

Drug created on February 24, 2015 16:02 / Updated on December 18, 2018 05:46