Identification
NamePembrolizumab
Accession NumberDB09037
TypeBiotech
GroupsApproved
Description

Pembrolizumab is a humanized monoclonal antibody that blocks the interaction between PD-1 and its ligands, PD-L1 and PD-L2. It is used for the treatment of several types of cancer such as, Melanoma, Non-Small Cell Lung Cancer and Head and Neck Cancer.

Due to its success in clinical trials, pembrolizumab was approved early to allow quick patient access and was given breakthrough therapy and orphan drug designation. Pembrolizumab (as Keytruda) was approved by the U.S. Food and Drug Administration to treat advanced cases of the most common type of lung malignancy, non-small cell lung cancer on Oct. 2, 2015. Keytruda was additionally approved for the treatment of Classical Hodgkin Lymphoma (cHL) in March, 2017.

Protein structureDb09037
Related Articles
Protein chemical formulaC6504H10004N1716O2036S46
Protein average weight146286.2902 Da
Sequences
>Heavy Chain Sequence
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNF
NEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG
NVFSCSVMHEALHNHYTQKSLSLSLGK
>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLES
GVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Lambrolizumab
External IDs lambrolizumab / MK 3475 / MK-3475 / MK3475
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
KeytrudaPowder, for solution50 mgIntravenousMerck Ltd.2015-06-01Not applicableCanada
KeytrudaInjection, solution25 mg/mLIntravenousMerck Sharp & Dohme Limited2015-01-15Not applicableUs
KeytrudaInjection, powder, for solution50 mgIntravenousMerck Sharp & Dohme Limited2015-07-17Not applicableEu
KeytrudaInjection, powder, lyophilized, for solution50 mg/2mLIntravenousMerck Sharp & Dohme Limited2014-09-04Not applicableUs
KeytrudaInjection, solution, concentrate25 mg/mlIntravenousMerck Sharp & Dohme Limited2015-07-17Not applicableEu
KeytrudaSolution25 mgIntravenousMerck Ltd.2017-07-13Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNIIDPT0O3T46P
CAS number1374853-91-4
Pharmacology
Indication

Pembrolizumab is a programmed death receptor-1 (PD-1)-blocking antibody indicated for the treatment of:  patients with unresectable or metastatic melanoma.  patients with metastatic NSCLC whose tumors have high PD-L1 expression [(Tumor Proportion Score (TPS) ≥50%)] as determined by an FDA-approved test, with no EGFR or ALK genomic tumor aberrations, and no prior systemic chemotherapy treatment for metastatic NSCLC.  patients with metastatic NSCLC whose tumors express PD-L1 (TPS ≥1%) as determined by an FDA-approved test, with disease progression on or after platinum-containing chemotherapy. Patients with EGFR or ALK genomic tumor aberrations should have disease progression on FDA-approved therapy for these aberrations prior to receiving KEYTRUDA.  patients with recurrent or metastatic HNSCC with disease progression on or after platinum-containing chemotherapy. This indication is approved under accelerated approval based on tumor response rate and durability of response. Continued approval for this indication may be contingent upon verification and description of clinical benefit in the confirmatory trials.

Structured Indications
Pharmacodynamics

Based on dose/exposure efficacy and safety relationships, there are no clinically significant differences in efficacy and safety between pembrolizumab doses of 200 mg or 2 mg/kg every 3 weeks in patients with NSCLC. Pembrolizumab binds with high affinity (29 pM) to PD-1, antagonizing the interaction between PD-1 and its known ligands, PD-L1 and PD-L2, with a half maximal inhibitory concentration between 500 pM and 1 nM. Engagement of PD-1 on T cells with PDL1 or PD-L2 inhibits TCR-mediated T cell proliferation and cytokine production. Intracellularly, PD-1 activation inhibits CD28 signalling through the PI3K/AKT pathway, likely via the recruitment of the SHP-2 and SHP-1 phosphatases to the immune synapse, blocking the upregulation of pro-inflammatory mediators (e.g., IL-2 and IFNγ) and survival signals (e.g. Bcl-xl). The inhibitory role of the PD-1 pathway has been shown to be essential in maintaining self-tolerance, minimizing collateral damage during physiologic responses to pathogens, and inducing maternal tolerance to fetal tissue. By inhibiting this inhibitor in the treatment of cancer, pembrolizumab aims to shift the balance toward immune reactivity, enhancing tumor immunosurveillance and antitumor immune responses.

Mechanism of action

Pembrolizumab is an antibody drug that targets the cell surface receptor programmed cell death protein 1 (PD-1) found on T cells. By preventing the binding of its ligands (PD-L1 and PD-L2), pembrolizumab induces an antitumor immune response. Upregulation of PD-1 ligands is a mechanism for tumours to evade antitumor immune response; when PD-1 binds its ligand, the T cell receives an inhibitory signal leading to T cell anergy and blockade of anti tumour immune response. Instead of directly targeting tumor tissue to induce tumor cell death, pembrolizumab acts as a checkpoint inhibitor to stimulate immune responses to eliminate cancer cells.

TargetKindPharmacological actionActionsOrganismUniProt ID
Programmed cell death protein 1Proteinyes
antagonist
antibody
HumanQ15116 details
Related Articles
Absorption

Steady-state concentrations of pembrolizumab were reached by 19 weeks of repeated dosing with an every 3-week regimen and the systemic accumulation was 2.2-fold. The peak concentration (Cmax), trough concentration (Cmin), and area under the plasma concentration versus time curve at steady state (AUCss) of pembrolizumab increased dose proportionally in the dose range of 2 to 10 mg/kg every 3 weeks.

Volume of distribution

volume of distribution at steady state is 6.1 L

Protein binding

As an intravenously administered antibody, the drug is immediately and completely bioavailable and is not expected to bind to plasma proteins in a specific manner.

Metabolism

Pembrolizumab undergoes catabolism to small peptides and single amnio acids via general protein degradation routes and does not rely on metabolism for clearance.

Route of eliminationNot Available
Half life

23 days

Clearance

0.22 L/day

Toxicity

Since therapy with pembrolizumab induces tumour regression by stimulation of immune responses, side effects may be caused by activating potentially self-reactive T cells. This includes immune-mediated pneumonitis, colitis, hypophysitis, nephritis and renal failure, hyperthyroidism and hypothyroidism, and hepatitis. Other adverse events such as myasthenic syndrome, optic neuritis, uveitis, arthritis, pancreatitis, partial seizures, and rhabdomnyolysis were reported to occur in less than 1% of patients during clinical trials. Female patients are advised to use highly effective contraception during and for 4 months following treatment due to the risk of fetal harm.

Affected organisms
  • Humans and other mammals
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Pembrolizumab.Approved
BelimumabThe risk or severity of adverse effects can be increased when Pembrolizumab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Pembrolizumab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Pembrolizumab.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Pembrolizumab.Approved, Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Pembrolizumab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Pembrolizumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Pembrolizumab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Pembrolizumab.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Pembrolizumab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Pembrolizumab.Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Pembrolizumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Pembrolizumab.Investigational
OleandrinAnvirzel may decrease the cardiotoxic activities of Pembrolizumab.Experimental
OuabainOuabain may decrease the cardiotoxic activities of Pembrolizumab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Pembrolizumab.Approved, Vet Approved
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Pembrolizumab.Approved
RindopepimutThe therapeutic efficacy of CDX-110 can be decreased when used in combination with Pembrolizumab.Investigational
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Pembrolizumab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Pembrolizumab.Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Pembrolizumab.Approved, Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Robert C, Ribas A, Wolchok JD, Hodi FS, Hamid O, Kefford R, Weber JS, Joshua AM, Hwu WJ, Gangadhar TC, Patnaik A, Dronca R, Zarour H, Joseph RW, Boasberg P, Chmielowski B, Mateus C, Postow MA, Gergich K, Elassaiss-Schaap J, Li XN, Iannone R, Ebbinghaus SW, Kang SP, Daud A: Anti-programmed-death-receptor-1 treatment with pembrolizumab in ipilimumab-refractory advanced melanoma: a randomised dose-comparison cohort of a phase 1 trial. Lancet. 2014 Sep 20;384(9948):1109-17. doi: 10.1016/S0140-6736(14)60958-2. Epub 2014 Jul 15. [PubMed:25034862 ]
  2. Hamid O, Robert C, Daud A, Hodi FS, Hwu WJ, Kefford R, Wolchok JD, Hersey P, Joseph RW, Weber JS, Dronca R, Gangadhar TC, Patnaik A, Zarour H, Joshua AM, Gergich K, Elassaiss-Schaap J, Algazi A, Mateus C, Boasberg P, Tumeh PC, Chmielowski B, Ebbinghaus SW, Li XN, Kang SP, Ribas A: Safety and tumor responses with lambrolizumab (anti-PD-1) in melanoma. N Engl J Med. 2013 Jul 11;369(2):134-44. doi: 10.1056/NEJMoa1305133. Epub 2013 Jun 2. [PubMed:23724846 ]
  3. Poole RM: Pembrolizumab: first global approval. Drugs. 2014 Oct;74(16):1973-81. doi: 10.1007/s40265-014-0314-5. [PubMed:25331768 ]
  4. Longoria TC, Tewari KS: Evaluation of the pharmacokinetics and metabolism of pembrolizumab in the treatment of melanoma. Expert Opin Drug Metab Toxicol. 2016 Oct;12(10):1247-53. doi: 10.1080/17425255.2016.1216976. Epub 2016 Aug 16. [PubMed:27485741 ]
  5. FDA label [Link]
External Links
ATC CodesL01XC18 — Pembrolizumab
AHFS Codes
  • 10:00
PDB EntriesNot Available
FDA labelDownload (589 KB)
MSDSDownload (134 KB)
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentCarcinoma, Intraductal, Noninfiltrating1
0Not Yet RecruitingBasic ScienceCancer, Breast / Hormone Receptor Negative Neoplasm / Triple Negative Breast Cancer (TNBC)1
0Not Yet RecruitingTreatmentMetastatic Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
0RecruitingTreatmentAcute Myeloid Leukaemias (AML) / B-cell Non-Hodgkin's Lymphomas / Classical Hodgkin Lymphoma / Myelodysplastic Syndromes1
0RecruitingTreatmentFallopian Tube Cancer / Neoplasms, Gynecologic / Ovarian Epithelial Cancer / Peritoneal Cancer / Uterine Endometrial Cancer1
0RecruitingTreatmentHepatocellular,Carcinoma1
0RecruitingTreatmentMalignant Melanoma, Metastatic1
0RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
0RecruitingTreatmentSmoldering Multiple Myeloma (SMM)1
1Active Not RecruitingTreatmentAdenocarcinoma of the Pancreas1
1Active Not RecruitingTreatmentAdvanced GI Cancer1
1Active Not RecruitingTreatmentAdvanced Solid Tumors1
1Active Not RecruitingTreatmentCancer, Breast / Cancer, Ovarian / Carcinoma, Colorectal / Carcinoma, Pancreatic / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Prostate Cancer / Renal Cell Adenocarcinoma / Tumors, Solid1
1Active Not RecruitingTreatmentCancers / Tumors, Solid1
1Active Not RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Non-Hodgkin's Lymphoma (NHL) / Primary Mediastinal B-Cell Lymphoma1
1Active Not RecruitingTreatmentLocally Advanced or Metastatic Solid Tumors1
1Active Not RecruitingTreatmentMalignant Melanoma / Melanoma / Melanoma Recurrent1
1Active Not RecruitingTreatmentMelanoma3
1Active Not RecruitingTreatmentNeuroblastomas1
1Active Not RecruitingTreatmentNon-Small-Cell Lung Cancer (NSCLC)1
1Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)2
1Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentSolid Tumor Cancers1
1Active Not RecruitingTreatmentStage IV Non-Small Cell Lung Cancer1
1Active Not RecruitingTreatmentTumors, Solid2
1CompletedTreatmentAdvanced Solid Tumors1
1Enrolling by InvitationTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1Not Yet RecruitingNot AvailableSquamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1Not Yet RecruitingHealth Services ResearchCastration-Resistant Prostatic Cancer / Non-Small-Cell Lung Carcinoma (NSCLC)1
1Not Yet RecruitingTreatmentAdvanced Solid Tumors1
1Not Yet RecruitingTreatmentBreast Carcinoma Metastatic in the Bone / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
1Not Yet RecruitingTreatmentCancer, Breast1
1Not Yet RecruitingTreatmentClear Cell Renal Cell Carcinoma / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
1Not Yet RecruitingTreatmentGastrointestinal Cancer Metastatic1
1Not Yet RecruitingTreatmentHead and Neck Carcinoma1
1Not Yet RecruitingTreatmentISS Stage I Plasma Cell Myeloma / ISS Stage II Plasma Cell Myeloma / ISS Stage III Plasma Cell Myeloma / Recurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
1Not Yet RecruitingTreatmentMetastatic Colorectal Cancers / MSS1
1Not Yet RecruitingTreatmentMalignant Lymphomas / Tumors, Solid1
1Not Yet RecruitingTreatmentMelanoma Stage Iii / Melanoma Stage Iv1
1Not Yet RecruitingTreatmentMetastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Unresectable Solid Neoplasm1
1Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)3
1Not Yet RecruitingTreatmentStage IIIA Non-Small Cell Lung Cancer1
1RecruitingNot AvailableInvasive Bladder Cancer1
1RecruitingNot AvailableThoracic Tumours1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingOtherHuman Immunodeficiency Virus (HIV) Infections1
1RecruitingTreatmentAIDS Related Non-Hodgkin Lymphoma / Classical Hodgkin Lymphoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Locally Advanced Malignant Neoplasm / Metastatic Malignant Neoplasm / Recurrent Hepatocellular Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Kaposi's Sarcoma / Recurrent Malignant Neoplasm / Recurrent Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Hodgkin Lymphoma / Recurrent Non-Small Cell Lung Carcinoma / Refractory Hodgkin Lymphoma / Refractory Malignant Neoplasm / Solid Neoplasms / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Hepatocellular Carcinoma / Stage IIIA Hepatocellular Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma AJCC v7 / Stage IIIB Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Skin Melanoma / Stage IVA Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma AJCC v7 / Stage IVB Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma AJCC v71
1RecruitingTreatmentALK-positive Advanced NSCLC1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Biliary Tract Cancer / Gastric Adenocarcinoma / Non-Small-Cell Lung Carcinoma (NSCLC) / Transitional Cell Carcinoma1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Colorectal Adenocarcinoma / Non-Resectable Cholangiocarcinoma / Non-Resectable Hepatocellular Carcinoma / Pancreatic Adenocarcinoma Metastatic / Recurrent Cholangiocarcinoma / Recurrent Colorectal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Hepatocellular Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Small Intestinal Carcinoma / Small Intestinal Adenocarcinoma / Stage III Colorectal Cancer / Stage III Gastric Cancer / Stage III Hepatocellular Carcinoma / Stage III Pancreatic Cancer / Stage III Small Intestinal Cancer / Stage IIIA Colorectal Cancer / Stage IIIA Gastric Cancer / Stage IIIA Hepatocellular Carcinoma / Stage IIIA Small Intestinal Cancer / Stage IIIB Colorectal Cancer / Stage IIIB Gastric Cancer / Stage IIIB Hepatocellular Carcinoma / Stage IIIB Small Intestinal Cancer / Stage IIIC Gastric Cancer / Stage IV Colorectal Cancer / Stage IV Gastric Cancer / Stage IV Hepatocellular Carcinoma / Stage IV Pancreatic Cancer / Stage IV Small Intestinal Cancer / Stage IVA Colorectal Cancer / Stage IVA Hepatocellular Carcinoma / Stage IVA Pancreatic Cancer / Stage IVB Colorectal Cancer / Stage IVB Hepatocellular Carcinoma / Stage IVB Pancreatic Cancer / Unresectable Pancreatic Carcinoma / Unresectable Small Intestinal Carcinoma1
1RecruitingTreatmentAdult Solid Neoplasm / Bladder Carcinoma / Carcinoma, Pancreatic / Colon Carcinoma / Estrogen Receptor Negative / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular,Carcinoma / HER2/Neu Negative / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Progesterone Receptor Negative / Rectal Carcinoma / Renal Cell Adenocarcinoma / Soft Tissue Sarcoma (STS) / TP53 Gene Mutation / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentAdult Solid Neoplasm / Metastatic Melanoma / Metastatic Renal Cell Cancer / Recurrent Colorectal Carcinoma / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Ovarian Cancer / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
1RecruitingTreatmentAdvanced Cancers1
1RecruitingTreatmentAdvanced Solid Cancers1
1RecruitingTreatmentAdvanced Solid Tumors2
1RecruitingTreatmentAdvanced Solid Tumors / Endometrial Cancers / Head and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Melanoma / Microsatellite Unstable (MSI) Colorectal Cancer / MMR-deficient Tumors / Non-Small-Cell Lung Carcinoma (NSCLC) / Pancreatic Ductal Adenocarcinoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma of the Genitourinary Tract / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentAdvanced Solid Tumors / Malignant Neoplasm of Pancreas / Tumors, Solid1
1RecruitingTreatmentAdvanced or Unresectable Melanoma Progressing After PD1 Blockade1
1RecruitingTreatmentAnal Carcinoma / Cervical Cancers / Oropharyngeal Cancers / Penile Cancer / Vaginal Cancers1
1RecruitingTreatmentB-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classical Hodgkin Lymphoma / Grade 1 Follicular Lymphoma / Grade 2 Follicular Lymphoma / Grade 3a Follicular Lymphoma / Mediastinal Lymphoma / Recurrent B-Cell Non-Hodgkin Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory B-Cell Non-Hodgkin Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma1
1RecruitingTreatmentBladder Cancers1
1RecruitingTreatmentBone Neoplasms / Neoplasms, Breast1
1RecruitingTreatmentBreast Diseases / Chronic Lung Diseases / Digestive System Neoplasms / Endocrine Gland Neoplasms / Neoplasm, Bronchial / Neoplasms / Neoplasms by Histologic Type / Neoplasms, Glandular and Epithelial / Neoplasms, Lung / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Neoplasms / Respiratory Tract Neoplasms / Thoracic Neoplasms / Tumors, Solid1
1RecruitingTreatmentCancer of the Esophagus / Esophageal Cancers / Neoplasms, Esophageal1
1RecruitingTreatmentCancer, Advanced1
1RecruitingTreatmentCancer, Breast1
1RecruitingTreatmentCancer, Breast / Cancers / Head and Neck Carcinoma / Malignant Lymphomas / Melanoma / Triple-Negative Breast Cancer (TNBC)1
1RecruitingTreatmentCancer, Breast / Non-Small-Cell Lung Carcinoma (NSCLC)1
1RecruitingTreatmentCancer, Breast / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentCancer, Ovarian / Clear Cell Renal Cell Carcinoma / Head and Neck Carcinoma / Malignant Neoplasm of Colon / Malignant Neoplasm of Pancreas / Melanoma / Mesothelioma / Non-Small-Cell Lung Carcinoma (NSCLC) / Prostate Cancer / Soft Tissue Sarcoma (STS) / Thyroid Cancers / Triple Negative Breast Cancer (TNBC) / Urethelial Carcinoma1
1RecruitingTreatmentCancers2
1RecruitingTreatmentCancers / Carcinoma NOS / Carcinoma, Non-Small Cell / Follicular Lymphoma (FL) / Hodgkins Disease (HD) / Lymphoma, B-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignancies, Hematologic / Malignant Lymphomas / Melanoma / Metastatic Non-Small Cell Lung Cancer / Neoplasms / Neoplasms Metastasis / Neoplasms, Head and Neck / Neoplasms, Squamous Cell / Non-Hodgkin's Lymphoma (NHL) / Non-Small-Cell Lung Carcinoma (NSCLC) / Squamous Cell Cancer / Squamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Neoplasm1
1RecruitingTreatmentColorectal Adenocarcinoma / Colorectal Adeonocarcinoma / Colorectal Cancers / Metastatic Carcinoma in the Liver / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1RecruitingTreatmentColorectal Cancers1
1RecruitingTreatmentColorectal Cancers / Neoplasms1
1RecruitingTreatmentConstitutional Mismatch Repair Deficiency Syndrome / Diffuse Intrinsic Pontine Glioma (DIPG) / Lynch Syndrome / Malignant Gliomas / Mismatch Repair Gene Inactivation / Recurrent Brain Neoplasm / Recurrent Childhood Brain Neoplasm / Recurrent Diffuse Intrinsic Pontine Glioma / Refractory Brain Neoplasm / Refractory Diffuse Intrinsic Pontine Glioma1
1RecruitingTreatmentEndometrial Cancers / Endometrial Carcinoma / Neoplasms, Endometrial1
1RecruitingTreatmentEndometrial Cancers / Fallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
1RecruitingTreatmentGrade 3a Follicular Lymphoma / Grade 3b Follicular Lymphoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Classical Hodgkin Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma1
1RecruitingTreatmentHead and Neck Carcinoma / Hypopharynx Cancer / Laryngeal Cancer / Oral Cavity Cancer / Oropharynx Cancers / Squamous Cell Carcinoma (SCC)1
1RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Metastatic Renal Cell Cancer / Recurrent Head and Neck Carcinoma / Recurrent Lung Carcinoma / Recurrent Skin Carcinoma / Renal Cell Carcinoma Recurrent / Stage III Renal Cell Cancer / Stage IV Lung Cancer / Stage IV Skin Melanoma1
1RecruitingTreatmentHepatocellular,Carcinoma1
1RecruitingTreatmentLocally Advanced or Metastatic Urothelial Cell Carcinoma / Urinary Bladder Diseases / Urological Diseases1
1RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Non-Small-Cell Lung Carcinoma (NSCLC) / Tumors, Solid1
1RecruitingTreatmentLung Cancers2
1RecruitingTreatmentLymphoma, Hodgkins1
1RecruitingTreatmentMalignant Gliomas1
1RecruitingTreatmentMalignant Lymphomas / Solid Neoplasms1
1RecruitingTreatmentMalignant Neoplasm of Pancreas1
1RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
1RecruitingTreatmentMelanoma6
1RecruitingTreatmentMetastatic Cancers1
1RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer / Prostatic Neoplasms1
1RecruitingTreatmentMetastatic Kidney Cancer / Renal Cell Adenocarcinoma1
1RecruitingTreatmentMetastatic Malignant Neoplasm in the Brain / Metastatic Melanoma / Mucosal Melanoma / Ocular Melanoma / Stage IV Non-Small Cell Lung Cancer / Stage IV Skin Melanoma1
1RecruitingTreatmentMetastatic Urothelial Cancer1
1RecruitingTreatmentMetastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Recurrent Bladder Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Stage III Bladder Urothelial Carcinoma / Stage III Urethral Cancer / Stage IV Bladder Urothelial Carcinoma / Stage IV Urethral Cancer / Urethral Urothelial Carcinoma1
1RecruitingTreatmentMultiple Myeloma (MM)1
1RecruitingTreatmentMyelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes1
1RecruitingTreatmentNeoplasms2
1RecruitingTreatmentNeoplasms / Neoplasms, Head and Neck / Non-Small Cell Lung Carcinoma (NSCLC) / Stomach Neoplasms / Urinary Bladder Neoplasms1
1RecruitingTreatmentNon Small Cell Lung Carcinoma (NSCLC) / Stage I / Stage II1
1RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
1RecruitingTreatmentPatients With Any Advanced Solid Tumors1
1RecruitingTreatmentPleural Mesotheliomas1
1RecruitingTreatmentRectal Carcinoma1
1RecruitingTreatmentRecurrent Bladder Carcinoma / Stage 0a Bladder Urothelial Carcinoma / Stage 0is Bladder Urothelial Carcinoma / Stage I Bladder Cancer1
1RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1RecruitingTreatmentRenal Cell Adenocarcinoma / Urinary Bladder Neoplasms1
1RecruitingTreatmentSoft Tissue Sarcoma (STS)1
1RecruitingTreatmentStage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer1
1RecruitingTreatmentStage III Melanoma / Stage IV Melanoma1
1RecruitingTreatmentStage IV Melanoma1
1RecruitingTreatmentStage IV Skin Melanoma1
1RecruitingTreatmentTriple Negative Breast Neoplasms1
1RecruitingTreatmentTumors, Solid2
1RecruitingTreatmentRrCLL / RrDLBCL / RrMM1
1SuspendedTreatmentCDKN2A-p16 Negative / Stage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oral Cavity Squamous Cell Carcinoma / Stage III Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Laryngeal Squamous Cell Carcinoma / Stage IV Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Oral Cavity Squamous Cell Carcinoma / Stage IV Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IV Oropharyngeal Squamous Cell Carcinoma / Stage IV Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Squamous Cell Carcinoma / Stage IVA Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Squamous Cell Carcinoma / Stage IVB Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v71
1TerminatedTreatmentBladder Cancers1
1TerminatedTreatmentBladder Cancers / Cancer, Ovarian / Colorectal Cancers / Malignant Neoplasm of Stomach / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC)1
1, 2Active Not RecruitingTreatmentAdult Glioblastoma1
1, 2Active Not RecruitingTreatmentBladder Cancers / Cancer, Ovarian / Gastrointestinal Stromal Tumors (GISTs) / GIST / Malignant Neoplasm of Stomach / Melanoma / Non-Small-Cell Lung Carcinoma (NSCLC) / Pancreatic Ductal Adenocarcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Triple-Negative Breast Cancer (TNBC)1
1, 2Active Not RecruitingTreatmentCancer, Advanced / Cancer, Breast / Lung Cancer Small Cell Lung Cancer (SCLC) / Malignant Neoplasm of Pancreas / Ovarian / Sarcomas1
1, 2Active Not RecruitingTreatmentCancer, Breast1
1, 2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1, 2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Recurrent Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Recurrent Nasopharynx Carcinoma / Recurrent Salivary Gland Carcinoma / Squamous Cell Carcinoma Metastatic in the Neck With Occult Primary / Stage III Major Salivary Gland Carcinoma / Stage III Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVC Major Salivary Gland Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma1
1, 2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
1, 2Active Not RecruitingTreatmentMetastatic Cancers1
1, 2Active Not RecruitingTreatmentMultiple Myeloma (MM)1
1, 2Active Not RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
1, 2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2Enrolling by InvitationTreatmentGlioblastomas1
1, 2Not Yet RecruitingOtherSarcomas1
1, 2Not Yet RecruitingTreatmentAdvanced Adult Hepatocellular Carcinoma / Child-Pugh Class A / Stage III Hepatocellular Carcinoma / Stage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IV Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma1
1, 2Not Yet RecruitingTreatmentAdvanced Malignancies / Metastatic Malignancy1
1, 2Not Yet RecruitingTreatmentAdvanced Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2Not Yet RecruitingTreatmentBreast Adenocarcinoma / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
1, 2Not Yet RecruitingTreatmentCutaneous T-Cell Lymphoma (CTCL) / Lymphoid Haematopoietic / Neoplasms, Malignant / Refractory peripheral cutaneous T-cell lymphoma1
1, 2Not Yet RecruitingTreatmentGlioblastoma, Adult1
1, 2Not Yet RecruitingTreatmentLung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2Not Yet RecruitingTreatmentLung Diseases Due to External Agents / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2Not Yet RecruitingTreatmentMalignant Melanoma2
1, 2Not Yet RecruitingTreatmentMelanoma1
1, 2Not Yet RecruitingTreatmentMesothelin Positive / Pleural Malignant Mesothelioma1
1, 2Not Yet RecruitingTreatmentMetastasis / Non-Small-Cell Lung Carcinoma (NSCLC) / Recurrences1
1, 2Not Yet RecruitingTreatmentMetastatic Colon Cancer / Tumors, Solid1
1, 2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers1
1, 2Not Yet RecruitingTreatmentMetastatic Renal Cell Carcinoma1
1, 2Not Yet RecruitingTreatmentPremenopausal Breast Cancer1
1, 2Not Yet RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2Not Yet RecruitingTreatmentStage IV Melanoma1
1, 2RecruitingTreatmentAdenocarcinoma of the Endometrium / Carcinoma, Squamous Cell of Head and Neck / Hepatocellular,Carcinoma / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignant Neoplasm of Stomach / Malignant Solid Tumours / Microsatellite-instability (MSI) High Colorectal Cancer / Neoplasms, Ovarian / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma of Genitourinary Tract / Transitional Cell Carcinoma of Urinary Tract / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentAdenocarcinoma, Prostate / Hormone-Resistant Prostate Cancer / Metastatic Hormone Refractory Prostate Cancer / Metastatic Malignant Neoplasm in the Bone / Metastatic Malignant Neoplasm in the Soft Tissues / Recurrent Prostate Carcinoma / Stage IV Prostate Cancer1
1, 2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Cardia Adenocarcinoma / Gastroesophageal Junction Adenocarcinoma / Stage IB Gastric Cancer / Stage IB Gastric Cancer AJCC v7 / Stage II Gastric Cancer / Stage II Gastric Cancer AJCC v7 / Stage IIA Gastric Cancer / Stage IIA Gastric Cancer AJCC v7 / Stage IIB Gastric Cancer / Stage IIB Gastric Cancer AJCC v7 / Stage IIIA Gastric Cancer / Stage IIIA Gastric Cancer AJCC v7 / Stage IIIB Gastric Cancer / Stage IIIB Gastric Cancer AJCC v71
1, 2RecruitingTreatmentAdvanced Breast Cancer / Cancer, Breast / Cancer, Ovarian / Fallopian Tube Cancer / Metastatic Breast Cancer (MBC) / Peritoneal Cancer / Stage IV Breast Cancer / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentAdvanced Liver Cancer / Malignant Neoplasms of Digestive Organs1
1, 2RecruitingTreatmentAdvanced Solid Tumors2
1, 2RecruitingTreatmentAdvanced or Metastatic Breast Cancer / Malignant Solid Tumours / Triple Negative Breast Cancer (TNBC) / Triple-Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentAdvanced or Metastatic Colorectal Cancer (CRC) / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Ligand 1 (PD-L1) Inhibitor / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Protein 1 (PD-1) Inhibitor / Advanced or Metastatic Solid Tumors / Non-Small Cell Lung Cancer (NSCLC; Squamous or Nonsquamous) / Pancreatic Ductal Adenocarcinoma (PDAC)1
1, 2RecruitingTreatmentAggressive Non-Hodgkin Lymphoma / Indolent Non-Hodgkin's Lymphomas / Recurrent Adult Non-Hodgkin Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Recurrent T-Cell Non-Hodgkin Lymphoma / Small Lymphocytic Lymphoma (SLL)1
1, 2RecruitingTreatmentAgnogenic Myeloid Metaplasia / Chronic Lymphocytic Leukaemia (CLL) / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL) / Richter's Syndrome / Waldenstrom's Macroglobulinemia (WM)1
1, 2RecruitingTreatmentB-Cell Acute Lymphoblastic Leukemia, Adult1
1, 2RecruitingTreatmentBladder Cancers / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentCD19+ Diffuse Large B-cell Lymphomas / Follicular Lymphoma (FL) / Mantle Cell Lymphomas1
1, 2RecruitingTreatmentCancer, Advanced / Cancer, Breast / Colorectal Cancers / Esophageal Cancers / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentCancer, Breast / Cholangiocarcinomas / Malignant Solid Tumours / MPN / Multiple Myeloma (MM) / Neoplasms, Endometrial / Non-Small-Cell Lung Carcinoma (NSCLC) / Stomach Neoplasms / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentCancers2
1, 2RecruitingTreatmentCancers / Prostate Cancer1
1, 2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
1, 2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Mantle Cell Lymphoma (MCL)1
1, 2RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentFollicular Lymphoma (Marginal Zone Allowed During Dose Escalation Only) / Follicular Lymphoma (Marginal Zone B Cell Lymphoma)1
1, 2RecruitingTreatmentGastroenteropancreatic Neuroendocrine Tumors1
1, 2RecruitingTreatmentHead Neck Cancer / Metastatic Melanoma1
1, 2RecruitingTreatmentHead and Neck Carcinoma2
1, 2RecruitingTreatmentLung Cancers2
1, 2RecruitingTreatmentLung Cancers / Melanoma1
1, 2RecruitingTreatmentLung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentMalignant Gliomas1
1, 2RecruitingTreatmentMalignant Lymphomas / Melanoma / Tumors, Solid1
1, 2RecruitingTreatmentMalignant Melanoma1
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentMalignant Neoplasm of Stomach1
1, 2RecruitingTreatmentMelanoma4
1, 2RecruitingTreatmentMelanoma and Other Malignant Neoplasms of Skin / Metastatic Melanoma1
1, 2RecruitingTreatmentMelanoma / Mismatch Repair-Proficient Colorectal Cancer / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentMelanoma / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentMelanoma / Tumors, Solid1
1, 2RecruitingTreatmentMesothelioma / Neoplasms, Pancreatic / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentMetastatic Colorectal Cancers1
1, 2RecruitingTreatmentMetastatic Colorectal Cancers / Pancreatic Cancer Metastatic1
1, 2RecruitingTreatmentMetastatic Melanoma1
1, 2RecruitingTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)4
1, 2RecruitingTreatmentNon-muscle Invasive Bladder Cancer (NMIBC)1
1, 2RecruitingTreatmentNonsmall Cell Lung Cancer / Relapsed or Refractory Solid Tumors1
1, 2RecruitingTreatmentRecurrent Colorectal Carcinoma / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1, 2RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
1, 2RecruitingTreatmentRelapsed Acute Myeloid Leukemia1
1, 2RecruitingTreatmentRelapsed Hodgkin Lymphoma / Relapsed Non-Hodgkin's Lymphoma1
1, 2RecruitingTreatmentSarcomas1
1, 2RecruitingTreatmentStage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentTumors1
1, 2RecruitingTreatmentTumors, Solid1
1, 2WithdrawnTreatmentAdvanced Triple Negative Breast Cancer / Lung Cancer Small Cell Lung Cancer (SCLC) / Malignant Melanoma / Mesothelioma / Non-Small-Cell Lung Carcinoma (NSCLC) / Urothelial Cancer1
1, 2WithdrawnTreatmentLymphoma, Hodgkins / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
1, 2WithdrawnTreatmentMyeloma Multiple1
2Active Not RecruitingDiagnosticNon-Small-Cell Lung Carcinoma (NSCLC)1
2Active Not RecruitingTreatmentCancer, Breast1
2Active Not RecruitingTreatmentCancer, Breast / Metastatic Triple Negative1
2Active Not RecruitingTreatmentCarcinoma, Colorectal1
2Active Not RecruitingTreatmentColorectal Cancers1
2Active Not RecruitingTreatmentEsophagogastric Junction Carcinoma / Oesophageal Carcinoma1
2Active Not RecruitingTreatmentExtensive Stage Small Cell Lung Carcinoma1
2Active Not RecruitingTreatmentGastric Adenocarcinoma / Gastroesophageal Junction Adenocarcinoma1
2Active Not RecruitingTreatmentGenital Neoplasms, Female / Genital Neoplasms, Male / Germ Cell Neoplasms / Mediastinal Neoplasms / Neoplasms, Ovarian / Non Seminomatous Germ Cell Tumors / Testicular Neoplasms1
2Active Not RecruitingTreatmentGlioblastomas1
2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Active Not RecruitingTreatmentHepatocellular,Carcinoma1
2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2Active Not RecruitingTreatmentLymphoma, Hodgkins1
2Active Not RecruitingTreatmentMalignant Melanoma1
2Active Not RecruitingTreatmentMetastatic Colorectal Cancers1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)2
2Active Not RecruitingTreatmentNK-Cell Lymphoma / T-Cell Lymphomas1
2Active Not RecruitingTreatmentNeoplasms, Ovarian1
2Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)3
2Active Not RecruitingTreatmentPlasma Cell Myeloma1
2Active Not RecruitingTreatmentRecurrent Merkel Cell Carcinoma / Stage III Merkel Cell Carcinoma AJCC v7 / Stage IIIA Merkel Cell Carcinoma / Stage IIIA Merkel Cell Carcinoma AJCC v7 / Stage IIIB Merkel Cell Carcinoma / Stage IIIB Merkel Cell Carcinoma AJCC v7 / Stage IV Merkel Cell Carcinoma / Stage IV Merkel Cell Carcinoma AJCC v71
2Active Not RecruitingTreatmentRecurrent Mycosis Fungoides and Sezary Syndrome / Stage IB Mycosis Fungoides and Sezary Syndrome / Stage IIA Mycosis Fungoides and Sezary Syndrome / Stage IIB Mycosis Fungoides and Sezary Syndrome / Stage IIIA Mycosis Fungoides and Sezary Syndrome / Stage IIIB Mycosis Fungoides and Sezary Syndrome / Stage IVA Mycosis Fungoides and Sezary Syndrome / Stage IVB Mycosis Fungoides and Sezary Syndrome1
2Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Active Not RecruitingTreatmentStage IIIA Uveal Melanoma / Stage IIIB Uveal Melanoma / Stage IIIC Uveal Melanoma / Stage IV Uveal Melanoma1
2Active Not RecruitingTreatmentUrothelial Cancer1
2Active Not RecruitingTreatmentUrothelial carcinoma ureter metastatic1
2Not Yet RecruitingTreatmentAdenocarcinoma Esophagus / Esophageal Cancers / Squamous Cell Esophagus Cancer1
2Not Yet RecruitingTreatmentAdenocarcinoma Of Esophagus1
2Not Yet RecruitingTreatmentAdenocarcinoma of the Lung / Lung Cancer Metastatic / NSCLC Stage IV1
2Not Yet RecruitingTreatmentAdvanced Cholangiocarcinoma1
2Not Yet RecruitingTreatmentAdvanced HER2-negative Breast Cancer1
2Not Yet RecruitingTreatmentAdvanced Ovarian Cancer1
2Not Yet RecruitingTreatmentAnaplastic Meningioma / Atypical Meningioma / Hemangiopericytoma1
2Not Yet RecruitingTreatmentBiliary Tract Cancer1
2Not Yet RecruitingTreatmentBiliary Tract Cancer / Cancer, Advanced / Gallbladder Cancer / Metastatic Cancers1
2Not Yet RecruitingTreatmentCLL / SLL1
2Not Yet RecruitingTreatmentCancer of Head and Neck1
2Not Yet RecruitingTreatmentCancer, Advanced / Cancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Carcinoma1
2Not Yet RecruitingTreatmentCancer, Breast1
2Not Yet RecruitingTreatmentCancer, Breast / Chest Wall Disease1
2Not Yet RecruitingTreatmentClassical Hodgkin Lymphoma / Lymphocyte-Depleted Classical Hodgkin Lymphoma / Lymphocyte-Rich Classical Hodgkin Lymphoma / Mixed Cellularity Classical Hodgkin Lymphoma / Nodular Sclerosis Classical Hodgkin Lymphoma1
2Not Yet RecruitingTreatmentColumnar Cell Variant Thyroid Gland Papillary Carcinoma / Follicular Variant Thyroid Gland Papillary Carcinoma / Poorly Differentiated Thyroid Gland Carcinoma / Recurrent Thyroid Gland Carcinoma / Stage III Differentiated Thyroid Gland Carcinoma / Stage III Thyroid Gland Follicular Carcinoma / Stage III Thyroid Gland Papillary Carcinoma / Stage IV Thyroid Gland Follicular Carcinoma / Stage IV Thyroid Gland Papillary Carcinoma / Stage IVA Differentiated Thyroid Gland Carcinoma / Stage IVA Thyroid Gland Follicular Carcinoma / Stage IVA Thyroid Gland Papillary Carcinoma / Stage IVB Differentiated Thyroid Gland Carcinoma / Stage IVB Thyroid Gland Follicular Carcinoma / Stage IVB Thyroid Gland Papillary Carcinoma / Stage IVC Differentiated Thyroid Gland Carcinoma / Stage IVC Thyroid Gland Follicular Carcinoma / Stage IVC Thyroid Gland Papillary Carcinoma / Tall Cell Variant Thyroid Gland Papillary Carcinoma / Thyroid Gland Oncocytic Follicular Carcinoma1
2Not Yet RecruitingTreatmentGastric Adenocarcinoma / Gastroesophageal Junction Adenocarcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Stage IV Esophageal Cancer AJCC v7 / Stage IV Gastric Cancer AJCC v7 / Unresectable Esophageal Carcinoma1
2Not Yet RecruitingTreatmentGlioblastomas / Gliosarcoma / Supratentorial Glioblastoma1
2Not Yet RecruitingTreatmentGray Zone Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL) / Primary Central Nervious System Lymphoma1
2Not Yet RecruitingTreatmentHead and Neck Carcinoma1
2Not Yet RecruitingTreatmentHematopoietic/Lymphoid Cancer / Myelodysplastic Syndrome1
2Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
2Not Yet RecruitingTreatmentHigh Grade Meningioma1
2Not Yet RecruitingTreatmentLung Adenocarcinoma, Stage I1
2Not Yet RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)2
2Not Yet RecruitingTreatmentLymphoma, Hodgkins1
2Not Yet RecruitingTreatmentMalignant Neoplasm of Pancreas1
2Not Yet RecruitingTreatmentMalignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Non-Hodgkin's Lymphoma (NHL)1
2Not Yet RecruitingTreatmentMelanoma3
2Not Yet RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers1
2Not Yet RecruitingTreatmentMetastatic Kidney Cancer / Renal Cell Carcinoma, Clear Cell1
2Not Yet RecruitingTreatmentMetastatic Melanoma1
2Not Yet RecruitingTreatmentMetastatic Uveal Melanoma1
2Not Yet RecruitingTreatmentMultiple Myeloma (MM)1
2Not Yet RecruitingTreatmentNeoplasms, Endometrial1
2Not Yet RecruitingTreatmentNeuroendocrine Tumors1
2Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)6
2Not Yet RecruitingTreatmentPD-L1 positive / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / TP53 Gene Mutation1
2Not Yet RecruitingTreatmentPancreatic Adenocarcinoma Metastatic1
2Not Yet RecruitingTreatmentRecurrent Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2Not Yet RecruitingTreatmentRecurrent Mycosis Fungoides and Sezary Syndrome / Refractory Mycosis Fungoides / Stage IB Mycosis Fungoides and Sezary Syndrome / Stage II Mycosis Fungoides and Sezary Syndrome / Stage IIA Mycosis Fungoides and Sezary Syndrome / Stage IIB Mycosis Fungoides and Sezary Syndrome / Stage III Mycosis Fungoides and Sezary Syndrome / Stage IIIA Mycosis Fungoides and Sezary Syndrome / Stage IIIB Mycosis Fungoides and Sezary Syndrome / Stage IV Mycosis Fungoides and Sezary Syndrome / Stage IVA Mycosis Fungoides and Sezary Syndrome / Stage IVB Mycosis Fungoides and Sezary Syndrome1
2Not Yet RecruitingTreatmentSmall Cell Lung Cancer Extensive Stage1
2Not Yet RecruitingTreatmentSolid Tumor, Adult1
2Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
2Not Yet RecruitingTreatmentStage IIIA Non-Small Cell Lung Cancer1
2Not Yet RecruitingTreatmentThymic Epithelial Tumors1
2Not Yet RecruitingTreatmentTransitional Cell Carcinoma1
2RecruitingBasic ScienceRecurrent Non-Small Cell Lung Carcinoma / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentALK Gene Mutation / BRAF Gene Mutation / EGFR Gene Mutations / Head and Neck Squamous Cell Carcinoma (HNSCC) / Metastatic Head and Neck Carcinoma / Recurrent Head and Neck Carcinoma / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Mutation / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentAcral lentiginous melanoma1
2RecruitingTreatmentAcute Myeloid Leukaemias (AML)3
2RecruitingTreatmentAcute Myeloid Leukemia, in Relapse1
2RecruitingTreatmentAdenocarcinoma Of Esophagus / Gastric Adenocarcinoma / Gastroesophageal Junction Adenocarcinoma1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma / Gastric Squamous Cell Carcinoma / Metastatic Malignant Neoplasm in the Stomach / Stage IV Esophageal Adenocarcinoma / Stage IV Esophageal Squamous Cell Carcinoma1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2RecruitingTreatmentAdrenocortical Carcinoma1
2RecruitingTreatmentAdult B Acute Lymphoblastic Leukemia / Adult T Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia1
2RecruitingTreatmentAdvanced Breast Cancer1
2RecruitingTreatmentAdvanced Cancers1
2RecruitingTreatmentAdvanced Melanoma / Triple-Negative Breast Cancer (TNBC)1
2RecruitingTreatmentAdvanced Solid Tumors / Malignant Melanoma / Ovarian Epithelial Cancer / Squamous Cell Cancer of Head and Neck / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentAlveolar Soft Part Sarcoma (ASPS) / Soft Tissue Sarcoma (STS)1
2RecruitingTreatmentAnal Carcinoma1
2RecruitingTreatmentAnaplastic Thyroid Cancers1
2RecruitingTreatmentAndrogen Receptor Positive / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentBiliary Cancer1
2RecruitingTreatmentBiliary Tract Cancer1
2RecruitingTreatmentBiphasic Mesothelioma / Epithelioid Mesothelioma / Peritoneal Malignant Mesothelioma / Pleural Biphasic Mesothelioma / Pleural Epithelioid Mesothelioma / Pleural Malignant Mesothelioma / Pleural Sarcomatoid Mesothelioma / Recurrent Peritoneal Malignant Mesothelioma / Recurrent Pleural Malignant Mesothelioma / Sarcomatoid Mesothelioma1
2RecruitingTreatmentBladder Cancers3
2RecruitingTreatmentBladder Cancers / Transitional Cell Carcinoma / Urothelial Cancer1
2RecruitingTreatmentBrain Cancer / Glioblastomas / Gliomas / Gliosarcoma / Malignant Brain Tumors / Neoplasm by Histologic Type / Neoplasm, Nerve Tissue / Neoplasm, Neuroepithelial / Neoplasms, Brain / Nervous System Diseases / Neuroectodermal Tumors1
2RecruitingTreatmentBreast - Female / Male Breast Cancer1
2RecruitingTreatmentBreast Cancer Metastatic1
2RecruitingTreatmentCancer of Head and Neck / Carcinoma, Squamous Cell of Head and Neck / Head and Neck Carcinoma / Neoplasms, Head and Neck / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Carcinoma, Head And Neck1
2RecruitingTreatmentCancer, Advanced1
2RecruitingTreatmentCancer, Breast4
2RecruitingTreatmentCancer, Breast / Neoplasms, Breast / Tumors, Breast1
2RecruitingTreatmentCancer, Ovarian3
2RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cancer1
2RecruitingTreatmentCancer, Ovarian / Ovarian Cancer Metastatic1
2RecruitingTreatmentCancers of the Head and Neck / Non-Small-Cell Lung Carcinoma (NSCLC) / Squamous Cell Carcinoma of Esophagus / Transitional Cell Carcinoma / Urinary Bladder Neoplasms1
2RecruitingTreatmentCancers / Glioblastomas / Neoplasms, Brain1
2RecruitingTreatmentCarcinoma, Adenoid Cystic1
2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Recurrent Head and Neck Cancer1
2RecruitingTreatmentCastration-Resistant Prostate Carcinoma / Hormone-Resistant Prostate Cancer / PSA Progression / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma / Stage IV Prostate Cancer1
2RecruitingTreatmentCentral Nervous System Neoplasms / Neoplasms, Germ Cell and Embryonal / Neoplasms, Ovarian / Neoplasms, Thyroid / Neuroendocrine Carcinomas / Sarcomas1
2RecruitingTreatmentCervical Cancers1
2RecruitingTreatmentCervical Cancers / Endometrial Cancers / Uterine Cancers1
2RecruitingTreatmentChronic Phase Myelofibrosis / Polycythemia Vera (PV) / Post Essential Thrombocythemia Myelofibrosis / Primary Myelofibrosis1
2RecruitingTreatmentCutaneous Squamous Cell Carcinoma / Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / HNSCC / Hypopharynx Cancer / Laryngeal Cancer / Lip SCC / Nasopharynx Cancer / Neoplasms, Head and Neck / Oral Cavity Cancer / Oropharynx Cancers / Sinonasal Carcinoma1
2RecruitingTreatmentDesmoplastic melanoma1
2RecruitingTreatmentEGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentEndometrial Adenocarcinomas / Endometrial Cancers1
2RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Negative / Progesterone Receptor Negative / Progesterone Receptor Positive / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentEstrogen Receptor Positive / HER2/Neu Negative / One to five years postmenopausal / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
2RecruitingTreatmentFallopian Tube Carcinoma / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
2RecruitingTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
2RecruitingTreatmentFollicular Lymphoma (FL)1
2RecruitingTreatmentGastric Adenocarcinoma / Gastroesophageal Junction Adenocarcinoma1
2RecruitingTreatmentGlioblastomas1
2RecruitingTreatmentHead and Neck Carcinoma3
2RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)2
2RecruitingTreatmentHepatocellular,Carcinoma1
2RecruitingTreatmentHigh Grade Malignant Neuroendocrine Carcinoma (Diagnosis)1
2RecruitingTreatmentHistory of Invasive Oral Cancer / Intra-epithelial Neoplasias / Oral Pre-malignant Lesion(s)1
2RecruitingTreatmentInflammatory carcinoma of breast stage IV / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentInflammatory carcinoma of the breast / Malignant Neoplasm of Breast1
2RecruitingTreatmentLocally Advanced Esophageal and Gastric Cancers (EGC)1
2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentLymphocyte-Rich Classical Hodgkin Lymphoma / Recurrent Lymphocyte-Depleted Classical Hodgkin Lymphoma / Recurrent Mixed Cellularity Classical Hodgkin Lymphoma / Recurrent Nodular Sclerosis Classical Hodgkin Lymphoma / Refractory Lymphocyte-Depleted Classical Hodgkin Lymphoma / Refractory Mixed Cellularity Classical Hodgkin Lymphoma / Refractory Nodular Sclerosis Classical Hodgkin Lymphoma1
2RecruitingTreatmentLymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Peripheral T-Cell Lymphoma (PTCL)1
2RecruitingTreatmentMSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer / MSI Positive Non-Colorectal Cancers1
2RecruitingTreatmentMalignant Lymphomas1
2RecruitingTreatmentMalignant Lymphomas / Refractory / Relapses1
2RecruitingTreatmentMalignant Neoplasm of Pancreas1
2RecruitingTreatmentMalignant Neoplasms of Digestive Organs / Pancreatic Cancer Metastatic1
2RecruitingTreatmentMalignant Peripheral Nerve Sheath Tumour (MPNST)1
2RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2RecruitingTreatmentMediastinal Large B-cell Lymphoma / Richter's Syndrome1
2RecruitingTreatmentMedullary Thyroid Cancer (MTC)1
2RecruitingTreatmentMelanoma4
2RecruitingTreatmentMelanoma and Other Malignant Neoplasms of Skin / Metastatic Melanoma1
2RecruitingTreatmentMelanoma / Metastatic Brain Tumors / Non-Small-Cell Lung Carcinoma (NSCLC)1
2RecruitingTreatmentMelanoma / Metastatic Melanoma / Stage III Melanoma / Stage IV Melanoma / Unresectable Malignant Neoplasm1
2RecruitingTreatmentMesothelioma1
2RecruitingTreatmentMetastatic Brain Tumors1
2RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer / Metastatic Castration-Resistant Prostate Cancer (mCRPC)1
2RecruitingTreatmentMetastatic Cholangiocarcinoma / Metastatic Colorectal Cancers / Metastatic Gastric Cancers / Metastatic Hepatocellular Carcinoma / Pancreatic Cancer Metastatic1
2RecruitingTreatmentMetastatic Colorectal Cancers1
2RecruitingTreatmentMetastatic Malignant Melanoma1
2RecruitingTreatmentMetastatic Melanoma2
2RecruitingTreatmentMetastatic Melanoma / Stage III Mucosal Melanoma of the Head and Neck / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck1
2RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2RecruitingTreatmentMetastatic Non Small Cell Lung Cancer1
2RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Metastatic Triple-negative Breast Cancer1
2RecruitingTreatmentMetastatic Non-Squamous Non-Small Cell Lung Carcinoma1
2RecruitingTreatmentMetastatic Small Intestinal Adenocarcinoma / Recurrent Small Intestinal Carcinoma / Unresectable Small Intestinal Carcinoma1
2RecruitingTreatmentMetastatic Squamous Non-small Cell Lung Cancer1
2RecruitingTreatmentMetastatic Triple Negative Breast Cancer1
2RecruitingTreatmentMultiple Myeloma (MM)1
2RecruitingTreatmentMuscle-invasive Urothelial Cancer of the Bladder1
2RecruitingTreatmentNeoplasms, Breast1
2RecruitingTreatmentNeuroendocrine Tumors1
2RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
2RecruitingTreatmentNon-Small-Cell Lung Cancer (NSCLC)1
2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)5
2RecruitingTreatmentOvarian Epithelial Cancer1
2RecruitingTreatmentPatients With Leptomeningeal Disease1
2RecruitingTreatmentPenile Squamous Cell Carcinoma (PSCC)1
2RecruitingTreatmentPrimary Central Nervous System Lymphoma (PCNSL)1
2RecruitingTreatmentProstate Cancer1
2RecruitingTreatmentProstatic Neoplasms1
2RecruitingTreatmentRecurrent Chronic Lymphocytic Leukemia / Recurrent Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Nodal Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Recurrent Splenic Marginal Zone Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Nodal Marginal Zone Lymphoma / Refractory Small Lymphocytic Lymphoma / Refractory Splenic Marginal Zone Lymphoma / Richter's Syndrome / Waldenstrom's Macroglobulinemia (WM)1
2RecruitingTreatmentRecurrent Endometrial Cancer1
2RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2RecruitingTreatmentRecurrent Respiratory Papillomatosis1
2RecruitingTreatmentRecurrent Skin Carcinoma / Skin Squamous Cell Carcinoma1
2RecruitingTreatmentRenal Cancers1
2RecruitingTreatmentRenal Cell Adenocarcinoma1
2RecruitingTreatmentSarcoma, Bone / Soft Tissue Sarcoma (STS)1
2RecruitingTreatmentSarcoma, Osteogenic1
2RecruitingTreatmentSarcomas2
2RecruitingTreatmentSkin Basal Cell Carcinoma1
2RecruitingTreatmentSoft Tissue Sarcoma of the Extremity1
2RecruitingTreatmentSoft Tissue Sarcoma, Adult / Soft Tissue Sarcoma, Child1
2RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
2RecruitingTreatmentSquamous Cell Carcinoma of Esophagus1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
2RecruitingTreatmentStage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentStage IV Bladder Urothelial Carcinoma1
2RecruitingTreatmentStage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentStage IV Renal Cell Cancer AJCC V71
2RecruitingTreatmentThymic Carcinoma1
2RecruitingTreatmentThyroid Gland Undifferentiated (Anaplastic) Carcinoma1
2RecruitingTreatmentTransitional Cell Carcinoma1
2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentUrothelial Bladder Carcinoma1
2RecruitingTreatmentUveal Melanoma1
2SuspendedTreatmentLymphoma, T-Cell, Peripheral1
2SuspendedTreatmentMetastatic Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2TerminatedTreatmentAdenocarcinomas / Malignant Neoplasm of Stomach1
2WithdrawnTreatmentAdvanced Melanoma1
2WithdrawnTreatmentRectal Carcinoma / Rectal Neoplasms1
2, 3Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2, 3Not Yet RecruitingTreatmentStage III/IV Melanoma1
3Active Not RecruitingTreatmentGastric Adenocarcinoma1
3Active Not RecruitingTreatmentGastric Adenocarcinoma / Gastroesophageal Junction Adenocarcinoma1
3Active Not RecruitingTreatmentHead and Neck Squamous Cell Cancer1
3Active Not RecruitingTreatmentMelanoma3
3Active Not RecruitingTreatmentMetastatic Head and Neck Cancer / Recurrent Head and Neck Cancer1
3Active Not RecruitingTreatmentMetastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Mucosal Melanoma of the Head and Neck / Stage III Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVA Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVC Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck AJCC v7 / Stages III Skin Melanoma1
3Active Not RecruitingTreatmentMetastatic Triple Negative Breast Cancer1
3Active Not RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC) / Non-Small-Cell Lung Carcinoma (NSCLC)1
3Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
3Active Not RecruitingTreatmentUrothelial Cancer1
3Not Yet RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
3Not Yet RecruitingTreatmentHER2/Neu Positive / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
3Not Yet RecruitingTreatmentLocally Advanced or Metastatic Renal Cell Carcinoma1
3Not Yet RecruitingTreatmentPleural Mesothelioma Malignant Advanced1
3Not Yet RecruitingTreatmentStage II Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma1
3RecruitingTreatmentCarcinoma, Colorectal1
3RecruitingTreatmentEsophagogastric Junction Carcinoma / Oesophageal Carcinoma1
3RecruitingTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Invasive Breast Carcinoma / Progesterone Receptor Negative / Stage 0 Breast Cancer / Stage I Breast Carcinoma / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Triple-Negative Breast Carcinoma1
3RecruitingTreatmentGastroesophageal Junction Adenocarcinoma / Neoplasm, Gastric1
3RecruitingTreatmentHepatocellular,Carcinoma2
3RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
3RecruitingTreatmentLymphoma, Hodgkins1
3RecruitingTreatmentMelanoma1
3RecruitingTreatmentNasopharyngeal Neoplasms1
3RecruitingTreatmentNeoplasms, Esophageal1
3RecruitingTreatmentNeoplasms, Head and Neck1
3RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)4
3RecruitingTreatmentOcular Melanoma1
3RecruitingTreatmentRenal Cell Adenocarcinoma3
3RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
3RecruitingTreatmentTriple Negative Breast Neoplasms1
3RecruitingTreatmentUrothelial Carcinoma Associated 1 RNA, Human1
3SuspendedTreatmentMultiple Myeloma (MM)2
4Not Yet RecruitingTreatmentMetastatic Non-Small Cell Lung Carcinoma1
Not AvailableActive Not RecruitingTreatmentBrain Cancer1
Not AvailableActive Not RecruitingTreatmentStage IV Prostate Cancer1
Not AvailableEnrolling by InvitationNot AvailableMalignant Melanoma1
Not AvailableNo Longer AvailableNot AvailableMelanoma1
Not AvailableNot Yet RecruitingTreatmentUrothelial Cancer1
Not AvailableRecruitingNot AvailableCancer, Breast1
Not AvailableRecruitingNot AvailableMelanoma1
Not AvailableRecruitingNot AvailableMelanoma / Neoplasms1
Not AvailableRecruitingNot AvailableMetastatic Melanoma1
Not AvailableRecruitingTreatmentComposite Lymphoma / Grade 3b Follicular Lymphoma / Stage I Diffuse Large B-Cell Lymphoma / Stage I Follicular Lymphoma / Stage II Diffuse Large B-Cell Lymphoma / Stage II Follicular Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage III Follicular Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma / Stage IV Follicular Lymphoma1
Not AvailableRecruitingTreatmentGliomas / Recurrent Malignant Gliomas1
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntravenous50 mg
Injection, powder, lyophilized, for solutionIntravenous50 mg/2mL
Injection, solutionIntravenous25 mg/mL
Injection, solution, concentrateIntravenous25 mg/ml
Powder, for solutionIntravenous50 mg
SolutionIntravenous25 mg
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US2012135408 No2012-03-292032-03-29Us
Properties
StateSolid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonistantibody
General Function:
Signal transducer activity
Specific Function:
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. Possible cell death inducer, in association with other factors.
Gene Name:
PDCD1
Uniprot ID:
Q15116
Uniprot Name:
Programmed cell death protein 1
Molecular Weight:
31646.635 Da
References
  1. McDermott J, Jimeno A: Pembrolizumab: PD-1 inhibition as a therapeutic strategy in cancer. Drugs Today (Barc). 2015 Jan;51(1):7-20. doi: 10.1358/dot.2015.51.1.2250387. [PubMed:25685857 ]
Drug created on March 30, 2015 16:49 / Updated on June 22, 2017 15:34