Identification

Name
Pembrolizumab
Accession Number
DB09037
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Pembrolizumab is a highly selective IgG4-kappa humanized monoclonal antibody against PD-1 receptor. It was generated by grafting the variable sequences of a very high-affinity mouse antihuman PD-1 antibody onto a human IgG4-kappa isotype with the containing a stabilizing S228P Fc mutation.[3] It contains 32 cysteine residues and the complete folded molecule includes 4 disulfide linkages as interchain bonds and 23 interchain bonds.[8] It was developed by Merck & Co and firstly approved for the treatment of metastatic malignant melanoma. This is the first approved therapy against PD-1.[2] It was approved firstly by the FDA on September 4, 2014.[6] Its approval in melanoma was extended to several countries such as Australia, Israel, Korea, Macau, the European Union and the United Arab Emirates.[4] On June 12, 2018, Pembrolizumab was approved for the treatment of cervical cancer under the status of accelerated approval.[7]

Protein structure
Db09037
Protein chemical formula
C6504H10004N1716O2036S46
Protein average weight
149000.0 Da
Sequences
>Heavy Chain Sequence
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNF
NEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG
NVFSCSVMHEALHNHYTQKSLSLSLGK
>Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLES
GVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Lambrolizumab
External IDs
Merck 3475 / MK 3475 / MK-3475 / MK3475 / Sch 900475 / SCH-900475
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
KeytrudaSolution25 mgIntravenousMerck Ltd.2017-07-13Not applicableCanada
KeytrudaPowder, for solution50 mgIntravenousMerck Ltd.2015-06-01Not applicableCanada
KeytrudaInjection, solution25 mg/1mLIntravenousMerck Sharp & Dohme Corp.2015-01-15Not applicableUs
KeytrudaInjection, solution, concentrate25 mg/mlIntravenousMerck Sharp & Dohme B.V.2015-07-17Not applicableEu
KeytrudaInjection, powder, lyophilized, for solution50 mg/2mLIntravenousMerck Sharp & Dohme Corp.2014-09-04Not applicableUs
KeytrudaInjection, powder, for solution50 mgIntravenousMerck Sharp & Dohme B.V.2015-07-17Not applicableEu
Categories
UNII
DPT0O3T46P
CAS number
1374853-91-4

Pharmacology

Indication

Pembrolizumab is indicated for the treatment of:

-Patients with unresectable or metastatic melanoma.[Label]

-As a single therapy, pembrolizumab is indicated for first-line treatment of patients with metastatic non-small cell lung cancer whose tumors have high PD-L1 expression [(Tumor Proportion Score (TPS) ≥50%)] as determined by an FDA-approved test, with no EGFR or ALK genomic tumor aberrations.[9]

-As a single therapy, pembrolizumab is indicated for first-line treatment of patients with metastatic non-small cell lung cancer whose tumors express PD-L1 (TPS ≥1%) as determined by an FDA-approved test, with disease progression on or after platinum-containing chemotherapy. Patients with EGFR or ALK genomic tumor aberrations should have disease progression on FDA-approved therapy for these aberrations prior to treatment.[9]

The following indications present the status of accelerated approval based on tumor response rate and durability of the response and thus, the approval of this indications are contingent upon verification and description of clinical benefit in confirmatory trials.

-Patients with recurrent or metastatic cervical cancer with disease progression on or after chemotherapy whose tumors express PD-L1 (CPS > 1) as determined by an FDA-approved test.[7]

-In combination with pemetrexed and carboplatin, is indicated for the first-line treatment of patients with metastatic nonsquamous non-small cell lung cancer.[9]

-Patients with recurrent or metastatic head and neck squamous cell carcinoma with disease progression on or after platinum-containing chemotherapy.[9]

-Treatment of adults and pediatric patients with refractory classical Hodgkin lymphoma or who have relapsed after 3 or more prior lines of therapy.[9]

-Treatment of adult and pediatric patients with refractory primary mediastinal large B-cell lymphoma or who have relapsed after 2 or more prior lines of therapy.[9]

-Treatment of patients with locally advanced or metastatic urothelial carcinoma who are not eligible for cisplatin-containing chemotherapy.[9]

-Patients with locally advanced or metastatic urothelial carcinoma who have disease progression during or following platinum-containing chemotherapy.[9]

-Treatment of adult and pediatric patients with unresectable or metastatic microsatellite instability-high or mismatch repair deficient with solid tumors that have progressed following previous treatment and colorectal cancer that has progressed following treatment with fluoropyrimidine, oxaliplatin, and irinotecan.[9]

-Patients with recurrent locally advanced or metastatic gastric or gastroesophageal junction adenocarcinoma whose tumors express PD-L1 (CPS >1) as determined by an FDA-approved test, with disease progression on or after two or more prior lines of therapy including fluoropyrimidine- and platinum-containing chemotherapy and if appropriate, HER2/neu-targeted therapy.[9]

Associated Conditions
Pharmacodynamics

Pembrolizumab pharmacodynamic reports indicate that there are not effector functions by binding to C1q and CD64 not by cytokine release.[3] On clinical trials, the objective response rate, defined as the proportion of patients with tumor size reduction of a predefined amount for a minimum time period, was assessed based on independent central review and a response duration. These studies performed for different classes of cancer showed a response either partial or complete in a range of 14.3-26% of the individuals. The response duration was estimated to be of 11 months and 45-91% of the patients had a response equal or greater than 6 months.[7, 3]

In other clinical trials, it was reported the progression-free survival, defined as the time during and after the treatment that the patient lives with the disease without worsening. The administration of pembrolizumab improved the progression-free survival when compared to patients assigned to regular chemotherapy. The increase reached 34% of the individuals while chemotherapy reports only 16%.[3]

The results mentioned above have been so clear and consistent that in phase III clinical trials the trial was stopped early to allow patients to switch to the treatment with pembrolizumab.[3]

Mechanism of action

Pembrolizumab, as an IgG4 subclass antibody, is preferred over other subclasses as it only induces weakly the complement and cell activation due to low affinity to C1q and Fc receptors. It binds with high affinity to the cell surface receptor programmed cell death protein 1 (PD-1) and it antagonizes its interaction with its known ligands PD-L1 and PD-L2. In normal circumstances, the binding of the ligands of PD-1 to the receptor inhibits the TCR-mediated T cell proliferation and cytokine production. This inhibitory signal seems to be essential for self-tolerance, collateral damage minimizing after immune response against a pathogen and maternal tolerance to fetal tissue. Therefore, the binding of pembrolizumab to PD-1 prevents the inhibitory pathway causing a physiological shift to immune reactivity and enhancing tumor immunosurveillance and anti-tumor immune response.[3]

TargetActionsOrganism
AProgrammed cell death protein 1
antagonist
antibody
Human
Absorption

When administered intravenously, pembrolizumab is completely bioavailable. When administered in repeated doses every 3 weeks, the systemic accumulation accounts for a 2.2 fold increase.[3] the reported time to reach steady-state is of 18 weeks.[8] The absorption profile of pembrolizumab is proportionally increased with increases in the dosage.[5]

Volume of distribution

The volume of distribution at steady state of pembrolizumab is 7.5 L which indicated a limited extravascular distribution.[8]

Protein binding

Pembrolizumab is not expected to bind to plasma proteins in a specific manner.[3]

Metabolism

Pembrolizumab is catalyzed into small peptides and single amino acids via general protein degradation but it does not rely on metabolism for clearance.[3]

Route of elimination
Not Available
Half life

The terminal half-life of pembrolizumab is 26 days.[8]

Clearance

Clearance is increased proportionally with the body weight and the mean clearance is registered to be 0.22 L/day. The renal clearance of pembrolizumab is not clinically modified in a significant manner by the presence of mild to moderate renal impairment.[3]

Toxicity

Pembrolizumab seems to be very well tolerated for a cancer therapy and the rate of discontinuations is reported to be of 14%. The presence of side effects of grade 3-4 is 10-14%. Due to the mechanism of action, the immune response was highly managed with treatment interruption and corticosteroid treatment.[3] even though fertility studies have not been performed, there are no notable effects in reproductive organs in not sexually mature animals.[Label]

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Pembrolizumab.
AbituzumabThe risk or severity of adverse effects can be increased when Pembrolizumab is combined with Abituzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Pembrolizumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Pembrolizumab.
AducanumabThe risk or severity of adverse effects can be increased when Pembrolizumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Pembrolizumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Pembrolizumab.
AlirocumabThe risk or severity of adverse effects can be increased when Pembrolizumab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Pembrolizumab is combined with Amatuximab.
AMG 108The risk or severity of adverse effects can be increased when AMG 108 is combined with Pembrolizumab.
Food Interactions
Not Available

References

General References
  1. Robert C, Ribas A, Wolchok JD, Hodi FS, Hamid O, Kefford R, Weber JS, Joshua AM, Hwu WJ, Gangadhar TC, Patnaik A, Dronca R, Zarour H, Joseph RW, Boasberg P, Chmielowski B, Mateus C, Postow MA, Gergich K, Elassaiss-Schaap J, Li XN, Iannone R, Ebbinghaus SW, Kang SP, Daud A: Anti-programmed-death-receptor-1 treatment with pembrolizumab in ipilimumab-refractory advanced melanoma: a randomised dose-comparison cohort of a phase 1 trial. Lancet. 2014 Sep 20;384(9948):1109-17. doi: 10.1016/S0140-6736(14)60958-2. Epub 2014 Jul 15. [PubMed:25034862]
  2. Poole RM: Pembrolizumab: first global approval. Drugs. 2014 Oct;74(16):1973-81. doi: 10.1007/s40265-014-0314-5. [PubMed:25331768]
  3. Longoria TC, Tewari KS: Evaluation of the pharmacokinetics and metabolism of pembrolizumab in the treatment of melanoma. Expert Opin Drug Metab Toxicol. 2016 Oct;12(10):1247-53. doi: 10.1080/17425255.2016.1216976. Epub 2016 Aug 16. [PubMed:27485741]
  4. Khoja L, Butler MO, Kang SP, Ebbinghaus S, Joshua AM: Pembrolizumab. J Immunother Cancer. 2015 Aug 18;3:36. doi: 10.1186/s40425-015-0078-9. eCollection 2015. [PubMed:26288737]
  5. Jazirehi AR, Lim A, Dinh T: PD-1 inhibition and treatment of advanced melanoma-role of pembrolizumab. Am J Cancer Res. 2016 Oct 1;6(10):2117-2128. eCollection 2016. [PubMed:27822406]
  6. FDA approval [Link]
  7. FDA news [Link]
  8. Keytruda monograph [File]
  9. Keytruda official monograph [File]
External Links
KEGG Drug
D10574
PubChem Substance
347910395
ChEMBL
CHEMBL3137343
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Pembrolizumab
ATC Codes
L01XC18 — Pembrolizumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (589 KB)
MSDS
Download (134 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Not Yet RecruitingBasic ScienceEndometrial Cancers / Uterine Malignancies1
0Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
0RecruitingBasic ScienceCancer, Breast / Hormone Receptor Negative Neoplasm / Triple Negative Breast Cancer (TNBC)1
0RecruitingBasic ScienceLung Cancer Non-Small Cell Cancer (NSCLC)1
0RecruitingTreatmentAdult Lymphoma / Adult Solid Tumor / Childhood Lymphoma / Childhood Solid Tumors / Refractory Cancer / Relapsed Cancer1
0RecruitingTreatmentAdvanced Gastroesophageal Adenocarcinoma / Diseases of Oesophagus Stomach and Duodenum1
0RecruitingTreatmentB-cell Non-Hodgkin's Lymphomas / Classical Hodgkin Lymphoma / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes1
0RecruitingTreatmentCancer, Breast1
0RecruitingTreatmentCarcinoma, Intraductal, Noninfiltrating1
0RecruitingTreatmentFallopian Tube Cancer / Malignant Peritoneal Neoplasm / Neoplasms, Gynecologic / Ovarian Epithelial Cancer / Uterine Endometrial Cancer1
0RecruitingTreatmentHepatocellular,Carcinoma1
0RecruitingTreatmentMalignant Melanoma, Metastatic1
0RecruitingTreatmentMalignant Neoplasm of Pancreas1
0RecruitingTreatmentMetastatic Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
0RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
0RecruitingTreatmentRefractory Acute Myeloid Leukemia1
0RecruitingTreatmentTransitional Cell Carcinoma1
1Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Biliary Tract Cancer / Gastric Adenocarcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Transitional Cell Carcinoma1
1Active Not RecruitingTreatmentAdult Solid Neoplasm / Bladder Carcinoma / Carcinoma, Pancreatic / Colon Carcinoma / Estrogen Receptor Negative / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular,Carcinoma / HER2/Neu Negative / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Progesterone Receptor Negative / Rectal Carcinoma / Renal Cell Adenocarcinoma / Soft Tissue Sarcoma (STS) / TP53 Gene Mutation / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm1
1Active Not RecruitingTreatmentAdvanced GI Cancer1
1Active Not RecruitingTreatmentAdvanced Solid Tumors2
1Active Not RecruitingTreatmentBladder Cancers / Castrate-resistant Prostate Cancer (CRPC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1Active Not RecruitingTreatmentBreast Diseases / Chronic Lung Diseases / Digestive System Neoplasms / Endocrine Gland Neoplasms / Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasm, Bronchial / Neoplasms / Neoplasms by Histologic Type / Neoplasms, Glandular and Epithelial / Neoplasms, Lung / Renal Neoplasms / Respiratory Tract Neoplasms / Thoracic Neoplasms / Tumors, Solid1
1Active Not RecruitingTreatmentCDKN2A-p16 Negative / Stage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oral Cavity Squamous Cell Carcinoma / Stage III Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Laryngeal Squamous Cell Carcinoma / Stage IV Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Oral Cavity Squamous Cell Carcinoma / Stage IV Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IV Oropharyngeal Squamous Cell Carcinoma / Stage IV Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Squamous Cell Carcinoma / Stage IVA Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Squamous Cell Carcinoma / Stage IVB Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v71
1Active Not RecruitingTreatmentCancer of the Ovary / Cancer, Breast / Carcinoma, Colorectal / Carcinoma, Pancreatic / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Prostate Cancer / Renal Cell Adenocarcinoma / Tumors, Solid1
1Active Not RecruitingTreatmentEndometrial Cancers / Endometrial Carcinoma / Neoplasms, Endometrial1
1Active Not RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Non-Hodgkin's Lymphoma (NHL) / Primary Mediastinal B-Cell Lymphoma1
1Active Not RecruitingTreatmentGBM / Giant Cell Glioblastoma / Glioblastoma Multiforme (GBM) / Glioblastoma With Oligodendroglial Features / Glioblastomas / Gliosarcoma / MGMT-methylated Glioblastoma / MGMT-unmethylated Glioblastoma1
1Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Metastatic Renal Cell Cancer / Recurrent Head and Neck Carcinoma / Recurrent Lung Carcinoma / Recurrent Skin Carcinoma / Renal Cell Carcinoma Recurrent / Stage III Renal Cell Cancer / Stage IV Lung Cancer / Stage IV Skin Melanoma1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Tumors, Solid1
1Active Not RecruitingTreatmentLymphoma, Hodgkins1
1Active Not RecruitingTreatmentMalignancies / Tumors, Solid1
1Active Not RecruitingTreatmentMalignant Gliomas1
1Active Not RecruitingTreatmentMelanoma3
1Active Not RecruitingTreatmentMetastatic Urothelial Cancer1
1Active Not RecruitingTreatmentMultiple Myeloma (MM)1
1Active Not RecruitingTreatmentNeuroblastomas1
1Active Not RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
1Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentSolid Tumor Cancers1
1Active Not RecruitingTreatmentStage III Melanoma / Stage IV Melanoma1
1Active Not RecruitingTreatmentStage IV Non-Small Cell Lung Cancer1
1Active Not RecruitingTreatmentTriple Negative Breast Neoplasms1
1Active Not RecruitingTreatmentTumors, Solid3
1CompletedTreatmentAdenocarcinoma of the Pancreas1
1CompletedTreatmentAdvanced Solid Tumors1
1CompletedTreatmentBone Neoplasms / Neoplasms, Breast1
1CompletedTreatmentCancer, Breast / Head and Neck Carcinoma / Malignancies / Malignant Lymphomas / Melanoma / Triple-Negative Breast Cancer (TNBC)1
1CompletedTreatmentLocally Advanced or Metastatic Solid Tumors1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1CompletedTreatmentMalignant Melanoma / Melanoma / Recurrent Melanoma1
1CompletedTreatmentMelanoma1
1Not Yet RecruitingNot AvailableSquamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1Not Yet RecruitingOtherCTCL / PTCL1
1Not Yet RecruitingTreatmentBladder Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Oncology / Renal Cell Adenocarcinoma / Tumors, Solid1
1Not Yet RecruitingTreatmentBladder Small Cell Neuroendocrine Carcinoma / Castration-Resistant Prostate Carcinoma / Metastatic Bladder Urothelial Carcinoma / Metastatic Urethral Urothelial Carcinoma / Prostate Carcinoma Metastatic in the Bone / Prostate Neuroendocrine Neoplasm / Prostate Small Cell Carcinoma / Stage III Bladder Cancer AJCC v8 / Stage III Prostate Cancer AJCC v8 / Stage III Urethral Cancer AJCC v8 / Stage IV Bladder Cancer AJCC v8 / Stage IV Prostate Cancer AJCC v8 / Stage IV Urethral Cancer AJCC v8 / Stage IVA Bladder Cancer AJCC v8 / Stage IVB Bladder Cancer AJCC v8 / Transitional Cell Carcinoma / Ureter Small Cell Carcinoma1
1Not Yet RecruitingTreatmentBreast Adenocarcinoma / Recurrent Breast Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Mycosis Fungoides / Recurrent Non-Hodgkin Lymphoma / Recurrent Primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Nodal Marginal Zone Lymphoma / Refractory Non-Hodgkin's lymphoma / Refractory, advanced Mycosis fungoides / Refractory, primary Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Breast Cancer AJCC v6 and v71
1Not Yet RecruitingTreatmentCancer of the Ovary1
1Not Yet RecruitingTreatmentCancer, Advanced / Mesothelioma, Malignant / PD-L1 negative / Progressive Disease1
1Not Yet RecruitingTreatmentGastrointestinal Cancer Metastatic1
1Not Yet RecruitingTreatmentGlioblastomas1
1Not Yet RecruitingTreatmentHepatocellular,Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Tumors, Solid1
1Not Yet RecruitingTreatmentKRAS Gene Mutation / Metastatic Non-Squamous Non-Small Cell Lung Carcinoma / Recurrent Non-Squamous Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer AJCC v71
1Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
1Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / NSCLC Stage IV / NSCLC, Stage IIIB1
1Not Yet RecruitingTreatmentMelanoma Stage Iii / Melanoma Stage Iv1
1Not Yet RecruitingTreatmentMetastatic Colorectal Cancers1
1Not Yet RecruitingTreatmentRecurrent Glioblastoma1
1Not Yet RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1Not Yet RecruitingTreatmentTumors, Solid1
1RecruitingNot AvailableThoracic Tumours1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingHealth Services ResearchCastration-Resistant Prostatic Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC)1
1RecruitingOtherHuman Immunodeficiency Virus (HIV) Infections1
1RecruitingTreatmentAIDS Related Non-Hodgkin Lymphoma / Classic Hodgkin Lymphoma / Classical Hodgkin Lymphoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Locally Advanced Malignant Neoplasm / Locally Advanced Malignant Solid Neoplasm / Locally Advanced Solid Neoplasm / Metastatic Malignant Neoplasm / Metastatic Malignant Solid Neoplasm / Recurrent Hepatocellular Carcinoma / Recurrent Hodgkin Lymphoma / Recurrent Kaposi's Sarcoma / Recurrent Malignant Neoplasm / Recurrent Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Hodgkin Lymphoma / Recurrent Non-Small Cell Lung Carcinoma / Refractory Hodgkin Lymphoma / Refractory Malignant Neoplasm / Refractory Malignant Solid Neoplasm / Solid Neoplasms / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Hepatocellular Carcinoma / Stage IIIA Hepatocellular Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma AJCC v7 / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Skin Melanoma / Stage IVA Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma AJCC v7 / Stage IVB Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma AJCC v71
1RecruitingTreatmentALK-positive Advanced NSCLC1
1RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes1
1RecruitingTreatmentAdenocarcinoma of the Pancreas / Bile Duct Carcinoma / Colorectal Adenocarcinoma / Gastric Adenocarcinoma / GI Cancer / Hepatocellular,Carcinoma / Oesophageal Carcinoma / Tumors, Solid1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Advanced Gastric Cancer / Colorectal Adenocarcinoma / Non-Resectable Cholangiocarcinoma / Non-Resectable Hepatocellular Carcinoma / Pancreatic Adenocarcinoma Metastatic / Recurrent Cholangiocarcinoma / Recurrent Colorectal Carcinoma / Recurrent Gastric Carcinoma / Recurrent Hepatocellular Carcinoma / Recurrent Pancreatic Carcinoma / Recurrent Small Intestinal Carcinoma / Small Intestinal Adenocarcinoma / Stage III Colorectal Cancer / Stage III Gastric Cancer / Stage III Hepatocellular Carcinoma / Stage III Pancreatic Cancer / Stage III Small Intestinal Cancer / Stage IIIA Colorectal Cancer / Stage IIIA Gastric Cancer / Stage IIIA Hepatocellular Carcinoma / Stage IIIA Small Intestinal Cancer / Stage IIIB Colorectal Cancer / Stage IIIB Gastric Cancer / Stage IIIB Hepatocellular Carcinoma / Stage IIIB Small Intestinal Cancer / Stage IIIC Gastric Cancer / Stage IV Colorectal Cancer / Stage IV Hepatocellular Carcinoma / Stage IV Pancreatic Cancer / Stage IV Small Intestinal Cancer / Stage IVA Colorectal Cancer / Stage IVA Hepatocellular Carcinoma / Stage IVA Pancreatic Cancer / Stage IVB Colorectal Cancer / Stage IVB Hepatocellular Carcinoma / Stage IVB Pancreatic Cancer / Unresectable Pancreatic Carcinoma / Unresectable Small Intestinal Carcinoma1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Bladder Cancers / Cancer, Breast / Carcinoma, Squamous Cell of Head and Neck / Colorectal Cancers / Gastric Adenocarcinoma / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Breast / Neoplasms, Colorectal / Renal Cell Adenocarcinoma / Urinary Bladder Neoplasms1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma / Gastrooesophageal Cancer / Neoplasms, Esophageal / Squamous Cell Carcinoma (SCC)1
1RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Hepatocellular,Carcinoma / Malignant Neoplasm of Stomach / Tumors, Solid1
1RecruitingTreatmentAdvanced CEACAM6-expressing Solid Tumors1
1RecruitingTreatmentAdvanced Cancers1
1RecruitingTreatmentAdvanced Melanoma1
1RecruitingTreatmentAdvanced Solid Cancers1
1RecruitingTreatmentAdvanced Solid Tumors3
1RecruitingTreatmentAdvanced Solid Tumors / Cancer, Breast / Colorectal Cancer (CRC) / CRC (Colorectal Cancer) / Endometrial Cancers / Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers / Malignant Neoplasm of Pancreas / Melanoma / Microsatellite Unstable (MSI) Colorectal Cancer / MMR-deficient Tumors / Pancreatic Ductal Adenocarcinoma / RCC (Renal Cell Carinoma) / Renal Cell Adenocarcinoma / SCCHN (Head and Neck Squamous Cell Carcinoma) / Transitional Cell Carcinoma of the Genitourinary Tract / Triple Negative Breast Cancer (TNBC) / Tumors, Solid / UC (Urothelial Cancer)1
1RecruitingTreatmentAdvanced Solid Tumors / Malignant Neoplasm of Pancreas / Tumors, Solid1
1RecruitingTreatmentAdvanced or Metastatic Breast Cancer / Malignant Solid Tumours / Triple Negative Breast Cancer (TNBC) / Triple-Negative Breast Cancer (TNBC)1
1RecruitingTreatmentAdvanced or Unresectable Melanoma Progressing After PD1 Blockade1
1RecruitingTreatmentB-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Classical Hodgkin Lymphoma / Grade 1 Follicular Lymphoma / Grade 2 Follicular Lymphoma / Grade 3a Follicular Lymphoma / Mediastinal Lymphoma / Recurrent B-Cell Non-Hodgkin Lymphoma / Recurrent Burkitt Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Refractory B-Cell Non-Hodgkin Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Mantle Cell Lymphoma1
1RecruitingTreatmentB-cell Non Hodgkin's Lymphoma / Chronic Lymphocytic Leukaemia (CLL)1
1RecruitingTreatmentBladder Cancers1
1RecruitingTreatmentBladder Cancers / Cancer of the Ovary / Cervical Cancers / Colorectal Cancers / Endometrial Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Metastatic Castration Resistant Prostate Cancer / Renal Cell Adenocarcinoma / Sarcomas / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentBladder transitional cell carcinoma / Classical Hodgkin Lymphoma / DNA Repair-Deficiency Disorders / Head and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma1
1RecruitingTreatmentBlasts 21-30 Percent of Bone Marrow Nucleated Cells / Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes1
1RecruitingTreatmentBreast Carcinoma Metastatic in the Bone / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
1RecruitingTreatmentCancer of the Esophagus / Esophageal Cancers / Neoplasms, Esophageal1
1RecruitingTreatmentCancer of the Ovary / Clear Cell Renal Cell Carcinoma / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Colon / Malignant Neoplasm of Pancreas / Melanoma / Mesothelioma / Prostate Cancer / Soft Tissue Sarcoma (STS) / Thyroid Cancers / Triple Negative Breast Cancer (TNBC) / Urethelial Carcinoma1
1RecruitingTreatmentCancer, Advanced2
1RecruitingTreatmentCancer, Advanced / Metastatic Cancers / NonHodgkin Lymphoma / Tumors, Solid1
1RecruitingTreatmentCancer, Breast3
1RecruitingTreatmentCancer, Breast / Lung Cancer Non-Small Cell Cancer (NSCLC)1
1RecruitingTreatmentCancer, Breast / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentCarcinoma NOS / Carcinoma, Non-Small Cell / Follicular Lymphoma (FL) / Hodgkins Disease (HD) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lymphoma, B-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignancies / Malignancies, Hematologic / Malignant Lymphomas / Melanoma / Metastatic Non-Small Cell Lung Cancer / Neoplasms / Neoplasms Metastasis / Neoplasms, Head and Neck / Neoplasms, Squamous Cell / Non-Hodgkin's Lymphoma (NHL) / Squamous Cell Cancer / Squamous Cell Carcinoma (SCC) / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Neoplasm1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
1RecruitingTreatmentColorectal Adenocarcinoma / Colorectal Adeonocarcinoma / Colorectal Cancers / Metastatic Carcinoma in the Liver / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1RecruitingTreatmentColorectal Cancers1
1RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1RecruitingTreatmentColorectal Cancers / Neoplasms1
1RecruitingTreatmentComposite Lymphoma / Grade 3b Follicular Lymphoma / Stage I Diffuse Large B-Cell Lymphoma / Stage I Follicular Lymphoma / Stage II Diffuse Large B-Cell Lymphoma / Stage II Follicular Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage III Follicular Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma / Stage IV Follicular Lymphoma1
1RecruitingTreatmentConstitutional Mismatch Repair Deficiency Syndrome / Diffuse Intrinsic Pontine Glioma (DIPG) / Lynch Syndrome / Malignant Gliomas / Mismatch Repair Gene Inactivation / Progressive Ependymoma / Progressive Medulloblastoma / Recurrent Brain Neoplasm / Recurrent Childhood Brain Neoplasm / Recurrent Childhood Ependymoma / Recurrent Diffuse Intrinsic Pontine Glioma / Recurrent Medulloblastoma / Refractory Brain Neoplasm / Refractory Diffuse Intrinsic Pontine Glioma / Refractory Ependymoma / Refractory Medulloblastoma1
1RecruitingTreatmentEndometrial Cancers / Fallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
1RecruitingTreatmentFollicular Lymphoma (FL) / Leukemia, Lymphocytic, Chronic, B-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL) / RrCLL / RrDLBCL / RrMM1
1RecruitingTreatmentGBM / Glioblastomas / Neoplasms, Brain1
1RecruitingTreatmentGrade 3a Follicular Lymphoma / Grade 3b Follicular Lymphoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Classical Hodgkin Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma1
1RecruitingTreatmentHead and Neck Carcinoma1
1RecruitingTreatmentHead and Neck Carcinoma / Hypopharynx Cancer / Laryngeal Cancer / Oral Cavity Cancer / Oropharynx Cancers / Squamous Cell Carcinoma (SCC)1
1RecruitingTreatmentHepatic Metastases / Hepatocellular,Carcinoma1
1RecruitingTreatmentHepatocellular,Carcinoma2
1RecruitingTreatmentHuman Immunodeficiency Virus (HIV)1
1RecruitingTreatmentISS Stage I Plasma Cell Myeloma / ISS Stage II Plasma Cell Myeloma / ISS Stage III Plasma Cell Myeloma / Recurrent Plasma Cell Myeloma / Refractory Plasma Cell Myeloma1
1RecruitingTreatmentLeukemia, B-Cell / Lymphoma, B-Cell1
1RecruitingTreatmentLocally Advanced Melanoma / Locally Advanced Solid Neoplasm / Metastatic Head and Neck Squamous Cell Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Non-Small Cell Lung Carcinoma (NSCLC) / Stage IB Lung Cancer AJCC v7 / Stage III Cutaneous Melanoma / Stage III Cutaneous Squamous Cell Carcinoma of the Head and Neck AJCC v8 / Stage III Lung Cancer AJCC v8 / Stage III Ureter Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Stage IV Cutaneous Melanoma / Stage IV Cutaneous Squamous Cell Carcinoma of the Head and Neck AJCC v8 / Stage IV Lung Cancer AJCC v8 / Stage IV Ureter Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v8 / Urothelial carcinoma ureter metastatic1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Nonsquamous Nonsmall Cell Neoplasm of Lung1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms Metastasis / Urinary Bladder Neoplasms1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Tumors, Solid1
1RecruitingTreatmentLung Cancers2
1RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
1RecruitingTreatmentMetastatic Colorectal Cancers / MSS1
1RecruitingTreatmentMalignancies2
1RecruitingTreatmentMalignant Lymphomas / Solid Neoplasms / Tumors, Solid1
1RecruitingTreatmentMalignant Lymphomas / Tumors, Solid1
1RecruitingTreatmentMalignant Neoplasm of Breast / Malignant Neoplasms of Digestive Organs / Malignant Neoplasms of Eye Brain and Other Parts of Central Nervous System / Malignant Neoplasms of Female Genital Organs / Malignant Neoplasms of Ill-defined Secondary and Unspecified Sites / Malignant Neoplasms of Independent (Primary) Multiple Sites / Malignant Neoplasms of Lip Oral Cavity and Pharynx / Malignant Neoplasms of Male Genital Organs / Malignant Neoplasms of Mesothelial and Soft Tissue / Malignant Neoplasms of Respiratory and Intrathoracic Organs / Malignant Neoplasms of Thyroid and Other Endocrine Glands / Malignant Neoplasms of Urinary Tract1
1RecruitingTreatmentMalignant Neoplasm of Pancreas2
1RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
1RecruitingTreatmentMelanoma5
1RecruitingTreatmentMelanoma / Stage IV Skin Melanoma1
1RecruitingTreatmentMetastatic Breast Cancer (MBC) / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentMetastatic Cancers1
1RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer / Prostatic Neoplasms1
1RecruitingTreatmentMetastatic Colorectal Cancers1
1RecruitingTreatmentMetastatic Malignant Neoplasm in the Brain / Metastatic Melanoma / Mucosal Melanoma / Ocular Melanoma / Stage IV Non-Small Cell Lung Cancer / Stage IV Skin Melanoma1
1RecruitingTreatmentMetastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Unresectable Solid Neoplasm1
1RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
1RecruitingTreatmentMetastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Recurrent Bladder Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Stage III Bladder Urothelial Carcinoma / Stage III Urethral Cancer / Stage IV Bladder Urothelial Carcinoma / Stage IV Urethral Cancer / Urethral Urothelial Carcinoma1
1RecruitingTreatmentMicrosatellite Stable Colorectal Cancer1
1RecruitingTreatmentNeoplasms2
1RecruitingTreatmentNeoplasms / Neoplasms, Head and Neck / Non-Small Cell Lung Carcinoma (NSCLC) / Stomach Neoplasms / Urinary Bladder Neoplasms1
1RecruitingTreatmentNon Small Cell Lung Carcinoma (NSCLC) / Stage I / Stage II1
1RecruitingTreatmentPharmacokinetics / Tumors, Solid1
1RecruitingTreatmentPleural Mesotheliomas1
1RecruitingTreatmentRectal Carcinoma1
1RecruitingTreatmentRecurrent Bladder Carcinoma / Stage 0a Bladder Urothelial Carcinoma / Stage 0is Bladder Urothelial Carcinoma / Stage I Bladder Cancer1
1RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
1RecruitingTreatmentRelapsed or Refractory Diffuse Large B Cell Lymphoma (DLBCL)1
1RecruitingTreatmentRenal Cell Adenocarcinoma / Urinary Bladder Neoplasms1
1RecruitingTreatmentRenal Pelvis Neoplasms / Transitional Cell Carcinoma / Ureteral Neoplasms / Urethral Neoplasms / Urinary Bladder Neoplasms / Urologic Neoplasms / Urothelial Cancer1
1RecruitingTreatmentSelected Advanced Solid Tumors1
1RecruitingTreatmentSoft Tissue Sarcoma (STS)1
1RecruitingTreatmentSolid Neoplasms1
1RecruitingTreatmentStage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer1
1RecruitingTreatmentStage IIIA Non-Small Cell Lung Cancer1
1RecruitingTreatmentStage IV Melanoma1
1RecruitingTreatmentAdvanced thymic carcinoma / Thymic Cancer1
1RecruitingTreatmentTumors, Solid2
1SuspendedOtherInvasive Bladder Cancer1
1SuspendedTreatmentAdult Solid Neoplasm / Malignant Solid Neoplasm / Metastatic Melanoma / Metastatic Renal Cell Cancer / Microsatellite Stable / Recurrent Colorectal Carcinoma / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Refractory Melanoma / Renal Cell Carcinoma Recurrent / Sarcomas / Stage IV Ovarian Cancer / Stage IV Ovarian Cancer AJCC v6 and v7 / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
1SuspendedTreatmentCervix Cancer1
1SuspendedTreatmentPatients With Any Advanced Solid Tumors1
1TerminatedTreatmentBladder Cancers1
1TerminatedTreatmentBladder Cancers / Cancer of the Ovary / Colorectal Cancers / Malignant Neoplasm of Stomach / Melanoma / Non-Small Cell Lung Carcinoma (NSCLC)1
1TerminatedTreatmentNeoplasms1
1WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1WithdrawnTreatmentMetastatic Kidney Cancer / Renal Cell Adenocarcinoma1
1, 2Active Not RecruitingTreatmentAdenocarcinoma of the Endometrium / Cancer of the Ovary / Cancer, Breast / Carcinoma, Squamous Cell of Head and Neck / Colorectal Cancer (CRC) / CRC (Colorectal Cancer) / Endometrial Cancers / HCC (Hepatocellular Carcinoma) / Head and Neck Carcinoma / Hepatocellular Carcinoma (HCC) / Hepatocellular,Carcinoma / HNSCC (Head and Neck Squamous Cell Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignant Lymphomas / Malignant Neoplasm of Stomach / Malignant Solid Tumours / Melanoma / Microsatellite-instability (MSI) High Colorectal Cancer / Neoplasms, Ovarian / NSCLC (Non-small Cell Lung Carcinoma) / RCC (Renal Cell Carcinoma) / Renal Cell Adenocarcinoma / Solid Tumors and Hematologic Malignancy / Transitional Cell Carcinoma of Genitourinary Tract / Transitional Cell Carcinoma of Urinary Tract / Triple Negative Breast Cancer (TNBC) / Tumors, Solid / UC (Urothelial Cancer)1
1, 2Active Not RecruitingTreatmentAdult Glioblastoma1
1, 2Active Not RecruitingTreatmentAdvanced Breast Cancer / Cancer of the Ovary / Cancer, Breast / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm / Metastatic Breast Cancer (MBC) / Stage IV Breast Cancer / Triple Negative Breast Cancer (TNBC)1
1, 2Active Not RecruitingTreatmentAdvanced Liver Cancer / Malignant Neoplasms of Digestive Organs1
1, 2Active Not RecruitingTreatmentAdvanced Malignancies / Advanced Solid Tumors / Cancer, Advanced / Metastatic Cancers / Tumors, Solid1
1, 2Active Not RecruitingTreatmentAdvanced Malignancies / Metastatic Cancers / Metastatic Malignancy1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors / Tumors, Solid1
1, 2Active Not RecruitingTreatmentBladder Cancers / Cancer of the Ovary / Gastrointestinal Stromal Tumors (GISTs) / GIST / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Melanoma / Pancreatic Ductal Adenocarcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Triple-Negative Breast Cancer (TNBC)1
1, 2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1, 2Active Not RecruitingTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas1
1, 2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Recurrent Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Recurrent Nasopharynx Carcinoma / Recurrent Salivary Gland Carcinoma / Squamous Cell Carcinoma Metastatic in the Neck With Occult Primary / Stage III Major Salivary Gland Carcinoma / Stage III Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage III Nasopharyngeal Carcinoma / Stage IV Nasopharyngeal Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVC Major Salivary Gland Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma1
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Active Not RecruitingTreatmentLung Cancers1
1, 2Active Not RecruitingTreatmentMalignancies2
1, 2Active Not RecruitingTreatmentMalignancies / Prostate Cancer1
1, 2Active Not RecruitingTreatmentMetastatic Colorectal Cancers / Pancreatic Cancer Metastatic1
1, 2Active Not RecruitingTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma, Relapsed / Relapsed Hodgkin Lymphoma1
1, 2Active Not RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
1, 2Active Not RecruitingTreatmentPlatinum-resistant Fallopian Cancer / Platinum-resistant Ovarian Cancer / Platinum-resistant Peritoneal Cancer1
1, 2Active Not RecruitingTreatmentRelapsed Acute Myeloid Leukemia1
1, 2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2CompletedTreatmentMetastatic Breast Cancer (MBC)1
1, 2Enrolling by InvitationTreatmentGlioblastomas1
1, 2Not Yet RecruitingTreatmentAcute Lymphoblastic Leukaemia Recurrent / CD19 Positive / Philadelphia Chromosome Positive / Refractory Acute Lymphoblastic Leukemia1
1, 2Not Yet RecruitingTreatmentAdvanced or Metastatic Cutaneous Squamous Cell Carcinoma / Advanced or Metastatic Head and Neck Squamous Cell Carcinoma / Advanced or Metastatic Melanoma / Advanced or Metastatic Merkel Cell Carcinoma / Advanced or Metastatic Solid Tumors1
1, 2Not Yet RecruitingTreatmentGlioblastoma Multiforme (GBM) / Glioblastoma Multiforme of Brain / Glioblastoma, Adult / Glioma of Brain1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Melanoma / Metastatic Renal Cell Carcinoma1
1, 2Not Yet RecruitingTreatmentMetastatic Brain Tumors / Metastatic Breast Cancer (MBC)1
1, 2Not Yet RecruitingTreatmentMetastatic Breast Cancer (MBC)1
1, 2Not Yet RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer1
1, 2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers / Metastatic Solid Tumor Cancer / Recurrent Head and Neck Cancer1
1, 2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Superficial, Palpable, Unresectable/Metastatic Solid Tumour1
1, 2Not Yet RecruitingTreatmentNSCLC, Stage I1
1, 2Not Yet RecruitingTreatmentNon-small Cell Lung Cancer Adenocarcinoma1
1, 2Not Yet RecruitingTreatmentPremenopausal Breast Cancer1
1, 2Not Yet RecruitingTreatmentRectal Carcinoma1
1, 2Not Yet RecruitingTreatmentRecurrent Mature T- and NK-Cell Non-Hodgkin Lymphoma / Recurrent Mycosis Fungoides / Refractory Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Refractory, advanced Mycosis fungoides1
1, 2Not Yet RecruitingTreatmentStage III Colorectal Cancer AJCC v8 / Stage IIIA Colorectal Cancer AJCC v8 / Stage IIIB Colorectal Cancer AJCC v8 / Stage IIIC Colorectal Cancer AJCC v8 / Stage IV Colorectal Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v81
1, 2Not Yet RecruitingTreatmentStage IV Melanoma1
1, 2Not Yet RecruitingTreatmentStage IV Non-Small Cell Lung Cancer1
1, 2Not Yet RecruitingTreatmentUnresectable or Metastatic Melanoma or Advanced Solid Tumors1
1, 2RecruitingOtherSarcomas1
1, 2RecruitingTreatmentAdenocarcinoma (PDAC) / Advanced or Metastatic Colorectal Cancer (CRC) / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Ligand 1 (PD-L1) Inhibitor / Advanced or Metastatic Solid Tumor That Progressed on Previous Therapy With a Programmed Cell Death Protein 1 (PD-1) Inhibitor / Advanced or Metastatic Solid Tumors / Advanced or Metastatic Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Advanced or Metastatic Urothelial Carcinoma (UC) / Colorectal Cancer (CRC) / Head and Neck Carcinoma / Lung Cancers / Non-Small Cell Lung Cancer (NSCLC; Squamous or Nonsquamous) / Pancreatic Ductal Adenocarcinoma (PDAC) / Tumors, Solid / UC (Urothelial Cancer)1
1, 2RecruitingTreatmentAdenocarcinoma, Prostate / Hormone-Resistant Prostate Cancer / Metastatic Hormone Refractory Prostate Cancer / Metastatic Malignant Neoplasm in the Bone / Metastatic Malignant Neoplasm in the Soft Tissues / Recurrent Prostate Carcinoma / Stage IV Prostate Cancer1
1, 2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Cardia Adenocarcinoma / Malignant Neoplasm of Stomach Stage II / Stage IB Gastric Cancer / Stage IB Gastric Cancer AJCC v7 / Stage II Gastric Cancer AJCC v7 / Stage IIA Gastric Cancer / Stage IIA Gastric Cancer AJCC v7 / Stage IIB Gastric Cancer / Stage IIB Gastric Cancer AJCC v7 / Stage IIIA Gastric Cancer / Stage IIIA Gastric Cancer AJCC v7 / Stage IIIB Gastric Cancer / Stage IIIB Gastric Cancer AJCC v71
1, 2RecruitingTreatmentAdvanced Adult Hepatocellular Carcinoma / Child-Pugh Class A / Stage III Hepatocellular Carcinoma / Stage IIIA Hepatocellular Carcinoma / Stage IIIB Hepatocellular Carcinoma / Stage IIIC Hepatocellular Carcinoma / Stage IV Hepatocellular Carcinoma / Stage IVA Hepatocellular Carcinoma / Stage IVB Hepatocellular Carcinoma1
1, 2RecruitingTreatmentAdvanced Malignancies / Gastric or Gastroesophageal Junction (GEJ) Adenocarcinoma / MSI-H or dMMR Solid Tumors / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentAdvanced Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2RecruitingTreatmentAdvanced Ovarian Cancer / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm1
1, 2RecruitingTreatmentAdvanced Solid Tumors1
1, 2RecruitingTreatmentAgnogenic Myeloid Metaplasia / Chronic Lymphocytic Leukaemia (CLL) / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL) / Richter's Syndrome / Waldenström's Macroglobulinemia (WM)1
1, 2RecruitingTreatmentB-Cell Acute Lymphoblastic Leukemia, Adult1
1, 2RecruitingTreatmentBladder Cancers / Colo-rectal Cancer / Colorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Mesothelioma / Metastatic Cancers / Renal Cell Adenocarcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous-cell Carcinomas of the Head and Neck / Transitional Cell Carcinoma / Tumors, Solid1
1, 2RecruitingTreatmentBladder Cancers / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentBreast Adenocarcinoma / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
1, 2RecruitingTreatmentBreast Neoplasm Female / Malignant Neoplasm of Female Breast1
1, 2RecruitingTreatmentCD19+ Diffuse Large B-cell Lymphomas / Follicular Lymphoma (FL) / Mantle Cell Lymphomas1
1, 2RecruitingTreatmentCancer, Advanced1
1, 2RecruitingTreatmentCancer, Breast1
1, 2RecruitingTreatmentCancer, Breast / Cholangiocarcinomas / Endometrial Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Malignant Neoplasm of Stomach / Malignant Solid Tumours / MPN / MPN (Myeloproliferative Neoplasms) / Multiple Myeloma (MM) / Neoplasms, Endometrial / NSCLC (Non-small Cell Lung Carcinoma) / Solid Tumors and Hematologic Malignancy / Stomach Neoplasms / Transitional Cell Carcinoma / Tumors, Solid / UC (Urothelial Cancer)1
1, 2RecruitingTreatmentCarcinoma, Colorectal / Colon Diseases / Colorectal Cancers / Malignant Neoplasm of Colon1
1, 2RecruitingTreatmentCervical Cancers1
1, 2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
1, 2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Mantle Cell Lymphoma (MCL)1
1, 2RecruitingTreatmentClassical Hodgkin Lymphoma1
1, 2RecruitingTreatmentClassical Hodgkin Lymphoma / Malignant Lymphomas / Melanoma / Microsatellite-instability-high Solid Tumor / Tumors, Solid1
1, 2RecruitingTreatmentCutaneous T-Cell Lymphoma (CTCL) / Lymphoid Haematopoietic / Neoplasms, Malignant / Refractory peripheral cutaneous T-cell lymphoma1
1, 2RecruitingTreatmentFollicular Low Grade Non-Hodgkin's Lymphoma / Follicular Lymphoma (Marginal Zone Allowed During Dose Escalation Only) / Follicular Lymphoma (Marginal Zone B Cell Lymphoma)1
1, 2RecruitingTreatmentGastroenteropancreatic Neuroendocrine Tumors1
1, 2RecruitingTreatmentGlioblastoma, Adult1
1, 2RecruitingTreatmentHead Neck Cancer / Metastatic Melanoma1
1, 2RecruitingTreatmentHead and Neck Carcinoma2
1, 2RecruitingTreatmentHodgkins Disease (HD) / Lymphoma, B-Cell / Non-Hodgkin's Lymphoma (NHL)1
1, 2RecruitingTreatmentLocally Advanced or Metastatic Urothelial Cell Carcinoma / Urinary Bladder Diseases / Urological Diseases1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers2
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Diseases Due to External Agents1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung neoplasm malignant1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Mismatch Repair-Proficient Colorectal Cancer1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Mesothelioma / Neoplasms, Pancreatic1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastasis / Recurrences1
1, 2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentLung Cancers1
1, 2RecruitingTreatmentLung Cancers / Melanoma1
1, 2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Non-Hodgkin's lymphoma1
1, 2RecruitingTreatmentMalignancies1
1, 2RecruitingTreatmentMalignant Gliomas1
1, 2RecruitingTreatmentMalignant Lymphomas1
1, 2RecruitingTreatmentMalignant Melanoma3
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentMalignant Neoplasm of Stomach1
1, 2RecruitingTreatmentMelanoma4
1, 2RecruitingTreatmentMelanoma and Other Malignant Neoplasms of Skin / Metastatic Melanoma1
1, 2RecruitingTreatmentMelanoma / Renal Cell Adenocarcinoma2
1, 2RecruitingTreatmentMelanoma / Tumors, Solid1
1, 2RecruitingTreatmentMesothelin Positive / Pleural Malignant Mesothelioma1
1, 2RecruitingTreatmentMetastatic Colon Cancer / Tumors, Solid1
1, 2RecruitingTreatmentMetastatic Colorectal Cancers1
1, 2RecruitingTreatmentMetastatic Melanoma1
1, 2RecruitingTreatmentMetastatic Renal Cell Carcinoma1
1, 2RecruitingTreatmentNeoplasms, Breast1
1, 2RecruitingTreatmentNon-muscle Invasive Bladder Cancer (NMIBC)1
1, 2RecruitingTreatmentPrimary Liver Carcinoma1
1, 2RecruitingTreatmentRecurrent Colorectal Carcinoma / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1, 2RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
1, 2RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2RecruitingTreatmentSarcomas1
1, 2RecruitingTreatmentSoft Tissue Sarcoma (STS)1
1, 2RecruitingTreatmentStage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
1, 2RecruitingTreatmentStage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2RecruitingTreatmentStage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
1, 2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentTumors1
1, 2RecruitingTreatmentTumors, Solid1
1, 2SuspendedTreatmentAggressive Non-Hodgkin Lymphoma / Indolent Non-Hodgkin's Lymphomas / Recurrent Adult Non-Hodgkin Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Recurrent T-Cell Non-Hodgkin Lymphoma / Small Lymphocytic Lymphoma (SLL)1
1, 2TerminatedTreatmentCancer, Advanced / Cancer, Breast / Colorectal Cancers / Esophageal Cancers / Malignant Neoplasm of Stomach1
1, 2TerminatedTreatmentCancer, Advanced / Cancer, Breast / Lung Cancer Small Cell Lung Cancer (SCLC) / Malignant Neoplasm of Pancreas / Ovarian / Sarcomas1
1, 2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Relapsed or Refractory Solid Tumors1
1, 2TerminatedTreatmentMetastatic Cancers1
1, 2TerminatedTreatmentMultiple Myeloma (MM)1
1, 2WithdrawnTreatmentAdvanced Triple Negative Breast Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Malignant Melanoma / Mesothelioma / Urothelial Cancer1
1, 2WithdrawnTreatmentLymphoma, Hodgkins / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
1, 2WithdrawnTreatmentMelanoma1
1, 2WithdrawnTreatmentMetastatic Colorectal Cancers1
1, 2WithdrawnTreatmentMyeloma Multiple1
2Active Not RecruitingDiagnosticLung Cancer Non-Small Cell Cancer (NSCLC)1
2Active Not RecruitingTreatmentAdenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
2Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
2Active Not RecruitingTreatmentAdvanced Cholangiocarcinoma1
2Active Not RecruitingTreatmentAdvanced Solid Tumors / Malignant Melanoma / Ovarian Epithelial Cancer / Squamous Cell Cancer of Head and Neck / Triple Negative Breast Cancer (TNBC)1
2Active Not RecruitingTreatmentBiphasic Mesothelioma / Epithelioid Mesothelioma / Peritoneal Malignant Mesothelioma / Pleural Biphasic Mesothelioma / Pleural Epithelioid Mesothelioma / Pleural Malignant Mesothelioma / Pleural Sarcomatoid Mesothelioma / Recurrent Peritoneal Malignant Mesothelioma / Recurrent Pleural Malignant Mesothelioma / Sarcomatoid Mesothelioma1
2Active Not RecruitingTreatmentCancer of the Ovary1
2Active Not RecruitingTreatmentCancer of the Ovary / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm1
2Active Not RecruitingTreatmentCancer, Breast1
2Active Not RecruitingTreatmentCancer, Breast / Metastatic Triple Negative1
2Active Not RecruitingTreatmentCarcinoma, Adenoid Cystic1
2Active Not RecruitingTreatmentCarcinoma, Colorectal1
2Active Not RecruitingTreatmentCastration-Resistant Prostate Carcinoma / Hormone-Resistant Prostate Cancer / PSA Progression / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma / Stage IV Prostate Adenocarcinoma AJCC v7 / Stage IV Prostate Cancer1
2Active Not RecruitingTreatmentColorectal Cancers1
2Active Not RecruitingTreatmentEsophagogastric Junction Carcinoma / Oesophageal Carcinoma1
2Active Not RecruitingTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2Active Not RecruitingTreatmentExtensive Stage Small Cell Lung Carcinoma1
2Active Not RecruitingTreatmentGlioblastomas1
2Active Not RecruitingTreatmentGlioblastomas / Malignancies / Neoplasms, Brain1
2Active Not RecruitingTreatmentHead and Neck Carcinoma1
2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Active Not RecruitingTreatmentHepatocellular,Carcinoma1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Metastatic Brain Tumors1
2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2Active Not RecruitingTreatmentLung Cancers / Metastatic Non-Small Cell Lung Cancer2
2Active Not RecruitingTreatmentLymphoma, Hodgkins1
2Active Not RecruitingTreatmentMalignant Lymphomas1
2Active Not RecruitingTreatmentMalignant Melanoma1
2Active Not RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2Active Not RecruitingTreatmentMediastinal Large B-cell Lymphoma / Richter's Syndrome1
2Active Not RecruitingTreatmentMelanoma3
2Active Not RecruitingTreatmentMetastatic Castration Resistant Prostate Cancer / Metastatic Castration-Resistant Prostate Cancer (mCRPC)1
2Active Not RecruitingTreatmentMetastatic Colorectal Cancers3
2Active Not RecruitingTreatmentMetastatic Small Intestinal Adenocarcinoma / Recurrent Small Intestinal Carcinoma / Unresectable Small Intestinal Carcinoma1
2Active Not RecruitingTreatmentMultiple Myeloma (MM)2
2Active Not RecruitingTreatmentNeoplasms, Ovarian1
2Active Not RecruitingTreatmentPlasma Cell Myeloma1
2Active Not RecruitingTreatmentRecurrent Merkel Cell Carcinoma / Stage III Merkel Cell Carcinoma AJCC v7 / Stage IIIA Merkel Cell Carcinoma / Stage IIIA Merkel Cell Carcinoma AJCC v7 / Stage IIIB Merkel Cell Carcinoma / Stage IIIB Merkel Cell Carcinoma AJCC v7 / Stage IV Merkel Cell Carcinoma / Stage IV Merkel Cell Carcinoma AJCC v71
2Active Not RecruitingTreatmentRenal Cancers1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
2Active Not RecruitingTreatmentSarcoma, Bone / Soft Tissue Sarcoma (STS)1
2Active Not RecruitingTreatmentSkin Basal Cell Carcinoma1
2Active Not RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
2Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
2Active Not RecruitingTreatmentStage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2Active Not RecruitingTreatmentStage IIIA Uveal Melanoma / Stage IIIB Uveal Melanoma / Stage IIIC Uveal Melanoma / Stage IV Uveal Melanoma1
2Active Not RecruitingTreatmentThyroid Gland Undifferentiated (Anaplastic) Carcinoma1
2Active Not RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
2Active Not RecruitingTreatmentUrothelial Cancer1
2Active Not RecruitingTreatmentUrothelial carcinoma ureter metastatic1
2CompletedTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2CompletedTreatmentMultiple Myeloma (MM)1
2CompletedTreatmentRecurrent Mycosis Fungoides and Sezary Syndrome / Refractory Mycosis Fungoides and Sezary Syndrome / Stage IB Mycosis Fungoides and Sezary Syndrome / Stage IB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIA Mycosis Fungoides and Sezary Syndrome / Stage IIA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIB Mycosis Fungoides and Sezary Syndrome / Stage IIB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIIA Mycosis Fungoides and Sezary Syndrome / Stage IIIA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIIB Mycosis Fungoides and Sezary Syndrome / Stage IIIB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IVA Mycosis Fungoides and Sezary Syndrome / Stage IVA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IVB Mycosis Fungoides and Sezary Syndrome / Stage IVB Mycosis Fungoides and Sezary Syndrome AJCC v71
2Not Yet RecruitingPreventionHepatocellular,Carcinoma1
2Not Yet RecruitingTreatmentAcral lentiginous melanoma / Clinical Stage III Cutaneous Melanoma AJCC v8 / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Mucosal Melanoma / Pathologic Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIA Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v8 / Pathologic Stage IV Cutaneous Melanoma AJCC v81
2Not Yet RecruitingTreatmentAdenocarcinoma of the Pancreas / Stage III Pancreatic Cancer AJCC v8 / Stage IV Pancreatic Cancer AJCC v81
2Not Yet RecruitingTreatmentAdvanced Ovarian Cancer1
2Not Yet RecruitingTreatmentAnaplastic Meningioma / Atypical Meningioma / Hemangiopericytoma1
2Not Yet RecruitingTreatmentAnatomic Stage IV Breast Cancer AJCC / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Triple -Negative Breast Cancer1
2Not Yet RecruitingTreatmentBiliary Tract Cancer1
2Not Yet RecruitingTreatmentBiliary Tract Cancer / Cancer, Advanced / Gallbladder Cancer / Metastatic Cancers1
2Not Yet RecruitingTreatmentCancer of the Ovary1
2Not Yet RecruitingTreatmentCancer of the Ovary / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm1
2Not Yet RecruitingTreatmentCancer, Advanced / Clear Cell Tumor / Gynecologic Cancers1
2Not Yet RecruitingTreatmentCancer, Breast / HER2 + Breast Cancer1
2Not Yet RecruitingTreatmentCastration-Resistant Prostate Cancer (CRPC)1
2Not Yet RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
2Not Yet RecruitingTreatmentChronic Phase Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Minimal Residual Disease1
2Not Yet RecruitingTreatmentClassical Hodgkin Lymphoma1
2Not Yet RecruitingTreatmentColorectal Cancers / Metastatic Cancers1
2Not Yet RecruitingTreatmentCutaneous T Cell Lymphomas (CTCL) / Mycosis Fungoides/Sezary Syndrome1
2Not Yet RecruitingTreatmentEndoscopic Surgical Procedure / High Risk Superficial Upper Urinary Tract Transitional Cell Carcinoma / Transitional Epithelial Cells1
2Not Yet RecruitingTreatmentErythroleukoplakia / Leukoplakia / Verrucous Oral Leukoplakia1
2Not Yet RecruitingTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Metastatic Breast Cancer (MBC) / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Triple Negative Breast Cancer (TNBC)1
2Not Yet RecruitingTreatmentGlioblastomas1
2Not Yet RecruitingTreatmentHNSCC / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)2
2Not Yet RecruitingTreatmentImmunotherapy With Pembrolizumab for Nasopharyngeal Carcinoma Patients1
2Not Yet RecruitingTreatmentInfiltrating Bladder Urothelial Carcinoma / Stage II Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma AJCC v6 and v71
2Not Yet RecruitingTreatmentInflammatory carcinoma of the breast1
2Not Yet RecruitingTreatmentLocally Advanced Head and Neck Carcinoma / Recurrent Head and Neck Carcinoma1
2Not Yet RecruitingTreatmentLung Adenocarcinoma, Stage I1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2Not Yet RecruitingTreatmentLymphoma, Hodgkins1
2Not Yet RecruitingTreatmentMalignant Melanoma1
2Not Yet RecruitingTreatmentMalignant Neoplasm of Pancreas / Neoplasms, Pancreatic / Pancreatic Ductal Adenocarcinoma1
2Not Yet RecruitingTreatmentMelanoma / Melanoma (Skin)1
2Not Yet RecruitingTreatmentMesothelioma1
2Not Yet RecruitingTreatmentMesothelioma, Malignant1
2Not Yet RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2Not Yet RecruitingTreatmentMicrosatellite Instability / Neoplasms, Colorectal1
2Not Yet RecruitingTreatmentMultiple Myeloma (MM)1
2Not Yet RecruitingTreatmentMycosis Fungoides (MF) / Sezary Syndrome / Stage IB Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage II Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage IIA Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage IIB Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage III Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage IIIA Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage IIIB Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage IV Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage IVA1 Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage IVA2 Mycosis Fungoides and Sezary Syndrome AJCC v8 / Stage IVB Mycosis Fungoides and Sezary Syndrome AJCC v81
2Not Yet RecruitingTreatmentNK/T-Cell Lymphoma of Nasal Cavity (Diagnosis) / NK/T-Cell Lymphoma of Nasopharynx (Diagnosis)1
2Not Yet RecruitingTreatmentNeoplasms2
2Not Yet RecruitingTreatmentNeoplasms, Endometrial1
2Not Yet RecruitingTreatmentNeoplasms, Head and Neck1
2Not Yet RecruitingTreatmentNeoplasms, Pancreatic1
2Not Yet RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC) / Pulmonary Nodules / Stage I Lung Cancer AJCC v8 / Stage IA1 Lung Cancer AJCC v8 / Stage IA2 Lung Cancer AJCC v8 / Stage IA3 Lung Cancer AJCC v8 / Stage IB Lung Cancer AJCC v8 / Stage II Lung Cancer AJCC v8 / Stage IIA Lung Cancer AJCC v8 / Stage IIB Lung Cancer AJCC v81
2Not Yet RecruitingTreatmentPD-L1 positive / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / TP53 Gene Mutation1
2Not Yet RecruitingTreatmentPancreatic Ductal Adenocarcinoma / Resectable Pancreatic Ductal Adenocarcinoma (PDAC)1
2Not Yet RecruitingTreatmentProstate Cancer1
2Not Yet RecruitingTreatmentResectable Head and Neck Mucosal Melanomas1
2Not Yet RecruitingTreatmentSkin Neoplasms1
2Not Yet RecruitingTreatmentSquamous Cell Carcinoma of Esophagus1
2Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Not Yet RecruitingTreatmentStage IIIA Non-Small Cell Lung Cancer1
2Not Yet RecruitingTreatmentThymic Epithelial Tumors1
2Not Yet RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
2Not Yet RecruitingTreatmentUrothelial carcinoma ureter metastatic1
2Not Yet RecruitingTreatmentWaldenström's Macroglobulinemia (WM)1
2RecruitingBasic ScienceRecurrent Non-Small Cell Lung Carcinoma / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingDiagnosticLung Cancer Non-Small Cell Cancer (NSCLC)1
2RecruitingTreatmentALK Gene Mutation / BRAF Gene Mutation / EGFR Gene Mutations / Head and Neck Squamous Cell Carcinoma (HNSCC) / Metastatic Head and Neck Carcinoma / Recurrent Head and Neck Carcinoma / Recurrent Non-Small Cell Lung Carcinoma / ROS1 Gene Mutation / Stage III Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentAcral lentiginous melanoma1
2RecruitingTreatmentAcute Myeloid Leukemia, in Relapse1
2RecruitingTreatmentAdenocarcinoma Esophagus / Esophageal Cancers / Squamous Cell Esophagus Cancer1
2RecruitingTreatmentAdenocarcinoma Of Esophagus1
2RecruitingTreatmentAdenocarcinoma of the Lung / Lung Cancer Metastatic / NSCLC Stage IV1
2RecruitingTreatmentAdenocarcinoma of the Pancreas / Advanced Pancreatic Cancer / Malignant Neoplasm of Pancreas / Pancreatic Adenocarcinoma Metastatic / Pancreatic Cancer Metastatic1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma / Gastric Squamous Cell Carcinoma / Metastatic Malignant Neoplasm in the Stomach / Stage IV Esophageal Adenocarcinoma / Stage IV Esophageal Squamous Cell Carcinoma1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma / Recurrent Esophageal Carcinoma / Recurrent Gastric Carcinoma / Stage IV Esophageal Cancer AJCC v7 / Stage IV Gastric Cancer AJCC v7 / Unresectable Esophageal Carcinoma1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma / Recurrent Gastric Carcinoma / Stage IV Gastric Cancer AJCC v71
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2RecruitingTreatmentAdrenocortical Carcinoma1
2RecruitingTreatmentAdult B Acute Lymphoblastic Leukemia / Adult T Acute Lymphoblastic Leukemia / Minimal Residual Disease / Recurrent Adult Acute Lymphoblastic Leukemia1
2RecruitingTreatmentAdult Diffuse Large Cell Lymphoma / Adult Refractory Diffuse Large B-Cell Lymphoma / Recurrent1
2RecruitingTreatmentAdvanced Breast Cancer1
2RecruitingTreatmentAdvanced Cancers1
2RecruitingTreatmentAdvanced Gastric Cancer1
2RecruitingTreatmentAdvanced HER2-negative Breast Cancer1
2RecruitingTreatmentAdvanced Melanoma1
2RecruitingTreatmentAdvanced Melanoma / Triple-Negative Breast Cancer (TNBC)1
2RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentAlveolar Soft Part Sarcoma (ASPS) / Soft Tissue Sarcoma (STS)1
2RecruitingTreatmentAnal Carcinoma1
2RecruitingTreatmentAnaplastic Thyroid Cancers1
2RecruitingTreatmentAndrogen Receptor Positive / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentB-cell Non-Hodgkin's Lymphomas / Chronic Lymphocytic Leukemia/Small Lymphocytic Lymphoma / Follicular Lymphoma (FL) / Indolent Non-Hodgkin's Lymphomas / Lymphoplasmacytic Lymphoma / Marginal Zone Lymphoma / Waldenström's Macroglobulinemia (WM)1
2RecruitingTreatmentBRCA1 Gene Mutation / Brca2 Gene Mutation / Locally Advanced Solid Neoplasm / Metastatic Malignant Solid Neoplasm / POLD1 Gene Mutation / POLE Gene Mutation / Recurrent Malignant Solid Neoplasm / Recurrent Ovarian Carcinoma / Stage III Breast Cancer AJCC V7 / Stage III Ovarian Cancer AJCC v8 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIA Ovarian Cancer AJCC v8 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIB Ovarian Cancer AJCC v8 / Stage IIIC Breast Cancer AJCC v7 / Stage IIIC Ovarian Cancer AJCC v8 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Ovarian Cancer AJCC v8 / Stage IVA Ovarian Cancer AJCC v8 / Stage IVB Ovarian Cancer AJCC v81
2RecruitingTreatmentBile Duct Carcinoma / Biliary Tract Cancer / Biliary Tract Neoplasms / Cholangiocarcinomas / Gallbladder Cancer / Liver Cancer1
2RecruitingTreatmentBiliary Cancer1
2RecruitingTreatmentBladder Cancers4
2RecruitingTreatmentBladder Cancers / Transitional Cell Carcinoma / Urothelial Cancer1
2RecruitingTreatmentBladder Cancers / Urothelial carcinoma ureter metastatic1
2RecruitingTreatmentBrain Cancer / Glioblastomas / Gliomas / Gliosarcoma / Malignant Brain Tumors / Neoplasm by Histologic Type / Neoplasm, Nerve Tissue / Neoplasm, Neuroepithelial / Neoplasms, Brain / Nervous System Diseases / Neuroectodermal Tumors1
2RecruitingTreatmentBreast - Female / Male Breast Cancer1
2RecruitingTreatmentBreast Adenocarcinoma / Breast Cancer Metastatic / Breast Cancer Stage II / Breast Cancer Stage III / Estrogen Receptor- Negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / HER2/Neu Negative / Invasive Adenocarcinoma of the Breast / Invasive Breast Carcinoma / Locally Advanced Breast Cancer (LABC) / Progesterone Receptor Negative / Progesterone Receptor Positive Tumor / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentBreast Cancer Metastatic1
2RecruitingTreatmentCancer of Head and Neck1
2RecruitingTreatmentCancer of Head and Neck / Carcinoma, Squamous Cell of Head and Neck / Head and Neck Carcinoma / Neoplasms, Head and Neck / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Carcinoma, Head And Neck1
2RecruitingTreatmentCancer of the Ovary2
2RecruitingTreatmentCancer of the Ovary / Cancer, Advanced / Fallopian Tube Cancer / Primary Peritoneal Carcinoma1
2RecruitingTreatmentCancer of the Ovary / Ovarian Cancer Metastatic / Stage III Fallopian Tube Cancer AJCC v7 / Stage III Ovarian Cancer AJCC v6 and v7 / Stage III Primary Peritoneal Cancer AJCC v7 / Stage IIIA Fallopian Tube Cancer AJCC v7 / Stage IIIA Ovarian Cancer AJCC v6 and v7 / Stage IIIA Primary Peritoneal Cancer AJCC v7 / Stage IIIB Fallopian Tube Cancer AJCC v7 / Stage IIIB Ovarian Cancer AJCC v6 and v7 / Stage IIIB Primary Peritoneal Cancer AJCC v7 / Stage IIIC Fallopian Tube Cancer AJCC v7 / Stage IIIC Ovarian Cancer AJCC v6 and v7 / Stage IIIC Primary Peritoneal Cancer AJCC v7 / Stage IV Fallopian Tube Cancer AJCC v6 and v7 / Stage IV Ovarian Cancer AJCC v6 and v7 / Stage IV Primary Peritoneal Cancer AJCC v71
2RecruitingTreatmentCancer, Advanced1
2RecruitingTreatmentCancer, Breast5
2RecruitingTreatmentCancer, Breast / Chest Wall Disease1
2RecruitingTreatmentCancer, Breast / Neoplasms, Breast / Tumors, Breast1
2RecruitingTreatmentCancers of the Head and Neck / Lung Cancer Non-Small Cell Cancer (NSCLC) / Squamous Cell Carcinoma of Esophagus / Transitional Cell Carcinoma / Urinary Bladder Neoplasms1
2RecruitingTreatmentCarcinoma of Unknown Primary1
2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Recurrent Head and Neck Cancer1
2RecruitingTreatmentCarcinoma, Unspecified Site1
2RecruitingTreatmentCastration Levels of Testosterone / Castration-Resistant Prostate Carcinoma / Prostate Carcinoma Metastatic in the Bone / PSA Progression / Stage IV Prostate Adenocarcinoma AJCC v71
2RecruitingTreatmentCastration Resistant Prostate Cancer (CRPC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Microsatellite Stable Colorectal Cancer / Tumors, Solid1
2RecruitingTreatmentCastration Resistant Prostatic Cancer / Metastatic Hormone Refractory Prostate Cancer1
2RecruitingTreatmentCentral Nervous System Neoplasms / Neoplasms, Germ Cell and Embryonal / Neoplasms, Ovarian / Neoplasms, Thyroid / Neuroendocrine Carcinomas / NK/T-cell Lymphoma / Sarcomas1
2RecruitingTreatmentCervical Cancers2
2RecruitingTreatmentCervical Cancers / Endometrial Cancers / Uterine Malignancies1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / SLL1
2RecruitingTreatmentChronic Lymphocytic Leukemia (CLL) - Refractory / Chronic, recurrent Lymphocytic Leukemia / Recurrent Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Lymphoplasmacytic Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Nodal Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Recurrent Splenic Marginal Zone Lymphoma / Refractory Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Refractory Follicular Lymphoma / Refractory Lymphoplasmacytic Lymphoma / Refractory Nodal Marginal Zone Lymphoma / Refractory Small Lymphocytic Lymphoma / Refractory Splenic Marginal Zone Lymphoma / Richter's Syndrome / Waldenström's Macroglobulinemia (WM)1
2RecruitingTreatmentChronic Phase Myelofibrosis / Polycythemia Vera (PV) / Post Essential Thrombocythemia Myelofibrosis / Primary Myelofibrosis1
2RecruitingTreatmentClassical Hodgkin Lymphoma / Lymphocyte-Depleted Classical Hodgkin Lymphoma / Lymphocyte-Rich Classical Hodgkin Lymphoma / Mixed Cellularity Classical Hodgkin Lymphoma / Nodular Sclerosis Classical Hodgkin Lymphoma1
2RecruitingTreatmentColumnar Cell Variant Thyroid Gland Papillary Carcinoma / Follicular Variant Thyroid Gland Papillary Carcinoma / Poorly Differentiated Thyroid Gland Carcinoma / Recurrent Thyroid Gland Carcinoma / Stage III Differentiated Thyroid Gland Carcinoma / Stage III Differentiated Thyroid Gland Carcinoma AJCC v7 / Stage III Thyroid Gland Follicular Carcinoma / Stage III Thyroid Gland Follicular Carcinoma AJCC v7 / Stage III Thyroid Gland Papillary Carcinoma / Stage III Thyroid Gland Papillary Carcinoma AJCC v7 / Stage IV Thyroid Gland Follicular Carcinoma / Stage IV Thyroid Gland Follicular Carcinoma AJCC v7 / Stage IV Thyroid Gland Papillary Carcinoma / Stage IV Thyroid Gland Papillary Carcinoma AJCC v7 / Stage IVA Differentiated Thyroid Gland Carcinoma / Stage IVA Differentiated Thyroid Gland Carcinoma AJCC v7 / Stage IVA Thyroid Gland Follicular Carcinoma / Stage IVA Thyroid Gland Follicular Carcinoma AJCC v7 / Stage IVA Thyroid Gland Papillary Carcinoma / Stage IVA Thyroid Gland Papillary Carcinoma AJCC v7 / Stage IVB Differentiated Thyroid Gland Carcinoma / Stage IVB Differentiated Thyroid Gland Carcinoma AJCC v7 / Stage IVB Thyroid Gland Follicular Carcinoma / Stage IVB Thyroid Gland Follicular Carcinoma AJCC v7 / Stage IVB Thyroid Gland Papillary Carcinoma / Stage IVB Thyroid Gland Papillary Carcinoma AJCC v7 / Stage IVC Differentiated Thyroid Gland Carcinoma / Stage IVC Differentiated Thyroid Gland Carcinoma AJCC v7 / Stage IVC Thyroid Gland Follicular Carcinoma / Stage IVC Thyroid Gland Follicular Carcinoma AJCC v7 / Stage IVC Thyroid Gland Papillary Carcinoma / Stage IVC Thyroid Gland Papillary Carcinoma AJCC v7 / Tall Cell Variant Thyroid Gland Papillary Carcinoma / Thyroid Gland Oncocytic Follicular Carcinoma1
2RecruitingTreatmentCutaneous Melanoma / Melanoma / Melanoma (Skin) / Melanoma Stage Iii / Melanoma Stage Iv1
2RecruitingTreatmentCutaneous Squamous Cell Carcinoma / Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / HNSCC / Hypopharynx Cancer / Laryngeal Cancer / Lip SCC / Nasopharynx Cancer / Neoplasms, Head and Neck / Oral Cavity Cancer / Oropharynx Cancers / Sinonasal Carcinoma1
2RecruitingTreatmentDesmoplastic melanoma1
2RecruitingTreatmentEGFR Activating Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentEndometrial Adenocarcinomas / Endometrial Cancers1
2RecruitingTreatmentEpstein-Barr Virus Positive / Gastric Adenocarcinoma / Mismatch Repair Protein Deficiency / Stage IB Gastric Cancer AJCC v7 / Stage II Gastric Cancer AJCC v7 / Stage IIA Gastric Cancer AJCC v7 / Stage IIB Gastric Cancer AJCC v7 / Stage III Gastric Cancer AJCC v7 / Stage IIIA Gastric Cancer AJCC v7 / Stage IIIB Gastric Cancer AJCC v7 / Stage IIIC Gastric Cancer AJCC v71
2RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEsophagus Cancer / Malignant Neoplasm of Stomach1
2RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Negative / Progesterone Receptor Negative / Progesterone Receptor Positive / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentEstrogen Receptor Positive / HER2/Neu Negative / One to five years postmenopausal / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
2RecruitingTreatmentFallopian Tube Carcinoma / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
2RecruitingTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
2RecruitingTreatmentFollicular Lymphoma (FL)1
2RecruitingTreatmentFollicular dendritic cell sarcoma / Histiocytic Sarcoma (HS) / Interdigitating Dendritic Cell Sarcoma / Malignant Lymphomas1
2RecruitingTreatmentGastrointestinal Stromal Tumors1
2RecruitingTreatmentGastrooesophageal Cancer1
2RecruitingTreatmentGlioblastoma, WHO Grade IV / Glioblastomas1
2RecruitingTreatmentGlioblastomas1
2RecruitingTreatmentGlioblastomas / Malignant Primary Brain Neoplasm / Melanoma / Metastatic Malignant Neoplasm in the Brain1
2RecruitingTreatmentGray Zone Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL) / Primary Central Nervious System Lymphoma1
2RecruitingTreatmentHCC1
2RecruitingTreatmentHNSCC1
2RecruitingTreatmentHead and Neck Carcinoma2
2RecruitingTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)3
2RecruitingTreatmentHematopoietic/Lymphoid Cancer / Myelodysplastic Syndrome1
2RecruitingTreatmentHepatocellular,Carcinoma4
2RecruitingTreatmentHigh Grade Malignant Neuroendocrine Carcinoma (Diagnosis)1
2RecruitingTreatmentHigh Grade Meningioma1
2RecruitingTreatmentHistory of Invasive Oral Cancer / Intra-epithelial Neoplasias / Oral Pre-malignant Lesion(s)1
2RecruitingTreatmentInflammatory carcinoma of breast stage IV / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentInflammatory carcinoma of the breast / Malignant Neoplasm of Breast1
2RecruitingTreatmentKaposi s Sarcoma (KS) / Progression, Disease1
2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)3
2RecruitingTreatmentLocally Advanced Esophageal and Gastric Cancers (EGC)1
2RecruitingTreatmentLocally Advanced Head and Neck Cancer1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)17
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Melanoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)2
2RecruitingTreatmentLung Cancers1
2RecruitingTreatmentLung Carcinoma Metastatic in the Brain / PD-L1 positive / Stage IV Non-Small Cell Lung Cancer AJCC v71
2RecruitingTreatmentLymphocyte-Rich Classical Hodgkin Lymphoma / Recurrent Lymphocyte-Depleted Classical Hodgkin Lymphoma / Recurrent Mixed Cellularity Classical Hodgkin Lymphoma / Recurrent Nodular Sclerosis Classical Hodgkin Lymphoma / Refractory Lymphocyte-Depleted Classical Hodgkin Lymphoma / Refractory Mixed Cellularity Classical Hodgkin Lymphoma / Refractory Nodular Sclerosis Classical Hodgkin Lymphoma1
2RecruitingTreatmentLymphoma, Hodgkins2
2RecruitingTreatmentLymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Peripheral T-Cell Lymphoma (PTCL)1
2RecruitingTreatmentLymphoma, Hodgkins / Relapsed or Refractory Hodgkin Lymphoma1
2RecruitingTreatmentMSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer / MSI Positive Non-Colorectal Cancers1
2RecruitingTreatmentMalignant Lymphomas / Metastatic Bladder Cancer / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Metastatic Renal Cell Cancer / Recurrent Bladder Carcinoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent Lymphoma / Recurrent Malignant Solid Neoplasm / Renal Cell Carcinoma Recurrent / Stage III Bladder Cancer / Stage III Lymphoma / Stage III Non-Small Cell Lung Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Lymphoma / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Skin Melanoma / Stage IVA Bladder Cancer / Stage IVB Bladder Cancer / Stages III Skin Melanoma / Unresectable Head and Neck Squamous Cell Carcinoma / Unresectable Solid Neoplasm1
2RecruitingTreatmentMalignant Lymphomas / Refractory / Relapses1
2RecruitingTreatmentMalignant Melanoma1
2RecruitingTreatmentMalignant Neoplasm of Breast1
2RecruitingTreatmentMalignant Neoplasm of Pancreas2
2RecruitingTreatmentMalignant Neoplasm of Stomach1
2RecruitingTreatmentMalignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentMalignant Neoplasms of Digestive Organs / Pancreatic Cancer Metastatic1
2RecruitingTreatmentMalignant Neoplasms of Urinary Tract / Stage I Bladder Cancer / Stage II Bladder Cancer / Stage III Bladder Cancer / Stage IIIA Bladder Cancer / Stage IIIB Bladder Cancer / Urothelial Carcinoma of the Bladder1
2RecruitingTreatmentMalignant Ovarian Clear Cell Tumor / Recurrent Ovarian Carcinoma1
2RecruitingTreatmentMalignant Peripheral Nerve Sheath Tumour (MPNST)1
2RecruitingTreatmentMedullary Thyroid Cancer (MTC)1
2RecruitingTreatmentMelanoma6
2RecruitingTreatmentMelanoma and Other Malignant Neoplasms of Skin / Metastatic Melanoma1
2RecruitingTreatmentMelanoma / Metastatic Melanoma / Stage III Melanoma / Stage IV Melanoma / Unresectable Malignant Neoplasm1
2RecruitingTreatmentMesothelioma1
2RecruitingTreatmentMetastatic Brain Tumors1
2RecruitingTreatmentMetastatic Breast Cancer (MBC)2
2RecruitingTreatmentMetastatic Breast Cancer (MBC) / Metastatic Cholangiocarcinoma / Metastatic Colorectal Cancers / Metastatic Gastric Cancers / Metastatic Hepatocellular Carcinoma / Ovarian Cancer Metastatic / Pancreatic Cancer Metastatic / Progressive Glioblastoma1
2RecruitingTreatmentMetastatic Head and Neck Carcinoma / Paranasal Sinus Squamous Cell Carcinoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent Hypopharyngeal Squamous Cell Carcinoma / Recurrent Laryngeal Squamous Cell Carcinoma / Recurrent Oral Cavity Squamous Cell Carcinoma / Recurrent Oropharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IV Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVC Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Unresectable Head and Neck Squamous Cell Carcinoma1
2RecruitingTreatmentMetastatic Kidney Cancer / Renal Cell Carcinoma, Clear Cell1
2RecruitingTreatmentMetastatic Malignant Melanoma1
2RecruitingTreatmentMetastatic Malignant Neoplasm in the Liver / Neuroendocrine Neoplasms1
2RecruitingTreatmentMetastatic Melanoma4
2RecruitingTreatmentMetastatic Melanoma Naive to Immune Therapy in Metastatic Setting1
2RecruitingTreatmentMetastatic Melanoma / Stage III Mucosal Melanoma of the Head and Neck / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck1
2RecruitingTreatmentMetastatic Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2RecruitingTreatmentMetastatic Myxoid Liposarcoma / Metastatic Round Cell Liposarcoma / Metastatic Synovial Sarcoma / NY-ESO-1 Positive Tumor Cells Present / Recurrent Mycosis Fungoides and Sezary Syndrome / Refractory Mycosis Fungoides and Sezary Syndrome / Refractory, advanced Mycosis fungoides / Stage IB Mycosis Fungoides and Sezary Syndrome / Stage IB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage II Mycosis Fungoides and Sezary Syndrome / Stage II Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIA Mycosis Fungoides and Sezary Syndrome / Stage IIA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIB Mycosis Fungoides and Sezary Syndrome / Stage IIB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage III Mycosis Fungoides and Sezary Syndrome / Stage III Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIIA Mycosis Fungoides and Sezary Syndrome / Stage IIIA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIIB Mycosis Fungoides and Sezary Syndrome / Stage IIIB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IV Mycosis Fungoides and Sezary Syndrome / Stage IV Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IVA Mycosis Fungoides and Sezary Syndrome / Stage IVA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IVB Mycosis Fungoides and Sezary Syndrome / Stage IVB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Unresectable Synovial Sarcoma1
2RecruitingTreatmentMetastatic NSCLC1
2RecruitingTreatmentMetastatic Non Small Cell Lung Cancer1
2RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Metastatic Triple-negative Breast Cancer1
2RecruitingTreatmentMetastatic Non-Squamous Non-Small Cell Lung Carcinoma1
2RecruitingTreatmentMetastatic Renal Cell Cancer / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Skin Melanoma1
2RecruitingTreatmentMetastatic Squamous Non-small Cell Lung Cancer1
2RecruitingTreatmentMetastatic Triple Negative Breast Cancer1
2RecruitingTreatmentMetastatic Uveal Melanoma1
2RecruitingTreatmentMicrosatellite Stable / Mismatch Repair Protein Proficient / Stage III Colorectal Cancer AJCC v7 / Stage IIIB Colorectal Cancer AJCC v7 / Stage IIIC Colorectal Cancer AJCC v7 / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer AJCC v71
2RecruitingTreatmentMuscle-invasive Urothelial Cancer of the Bladder1
2RecruitingTreatmentNK-Cell Lymphoma / T-Cell Lymphomas1
2RecruitingTreatmentNeoplasms, Breast1
2RecruitingTreatmentNeoplasms, Colorectal1
2RecruitingTreatmentNeuroendocrine Tumors2
2RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
2RecruitingTreatmentOvarian Epithelial Cancer1
2RecruitingTreatmentPancreatic Adenocarcinoma Metastatic1
2RecruitingTreatmentPatients With Leptomeningeal Disease1
2RecruitingTreatmentPenile Squamous Cell Carcinoma (PSCC)1
2RecruitingTreatmentPrimary Central Nervous System Lymphoma (PCNSL)1
2RecruitingTreatmentProstate Cancer1
2RecruitingTreatmentProstatic Neoplasms1
2RecruitingTreatmentRectal Adenocarcinoma / Stage II Rectal Cancer / Stage II Rectal Cancer AJCC v7 / Stage III Rectal Cancer / Stage III Rectal Cancer AJCC v71
2RecruitingTreatmentRecurrent Diffuse Large B-Cell Lymphoma / Recurrent Follicular Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Follicular Lymphoma1
2RecruitingTreatmentRecurrent Endometrial Cancer1
2RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2RecruitingTreatmentRecurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2RecruitingTreatmentRecurrent Plasma Cell Myeloma1
2RecruitingTreatmentRecurrent Respiratory Papillomatosis1
2RecruitingTreatmentRecurrent Skin Carcinoma / Skin Squamous Cell Carcinoma1
2RecruitingTreatmentSalivary Gland Cancers / Thyroid Cancers1
2RecruitingTreatmentSarcoma, Osteogenic1
2RecruitingTreatmentSarcomas3
2RecruitingTreatmentSmall Cell Lung Cancer Extensive Stage1
2RecruitingTreatmentSoft Tissue Sarcoma of the Extremity1
2RecruitingTreatmentSoft Tissue Sarcoma, Adult / Soft Tissue Sarcoma, Child1
2RecruitingTreatmentSolid Tumor, Adult1
2RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
2RecruitingTreatmentSquamous Cell Carcinoma of Esophagus1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)3
2RecruitingTreatmentStage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
2RecruitingTreatmentStage III Merkel Cell Carcinoma AJCC v7 / Stage IIIA Merkel Cell Carcinoma AJCC v7 / Stage IIIB Merkel Cell Carcinoma AJCC v7 / Stage IV Merkel Cell Carcinoma AJCC v71
2RecruitingTreatmentStage III/IV Melanoma1
2RecruitingTreatmentStage IV Bladder Urothelial Carcinoma1
2RecruitingTreatmentStage IV Non-Small Cell Lung Cancer1
2RecruitingTreatmentStage IV Renal Cell Cancer AJCC V71
2RecruitingTreatmentThymic Carcinoma / Thymus Cancer / Thymus Neoplasms1
2RecruitingTreatmentTransitional Cell Carcinoma2
2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentTriple-Negative Breast Cancer (TNBC)1
2RecruitingTreatmentUrothelial Bladder Carcinoma1
2RecruitingTreatmentUveal Melanoma1
2SuspendedTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Negative / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma1
2SuspendedTreatmentGlioblastomas / Gliosarcoma / Supratentorial Glioblastoma1
2SuspendedTreatmentLymphoma, T-Cell, Peripheral1
2SuspendedTreatmentNeuroendocrine Cancer / Neuroendocrine Carcinomas / Neuroendocrine Tumors1
2SuspendedTreatmentThymic Carcinoma1
2TerminatedTreatmentGenital Neoplasms, Female / Genital Neoplasms, Male / Germ Cell Neoplasms / Mediastinal Neoplasms / Neoplasms, Ovarian / Non Seminomatous Germ Cell Tumors / Testicular Neoplasms1
2WithdrawnTreatmentAdenocarcinoma of the Pancreas1
2WithdrawnTreatmentAdenocarcinomas / Malignant Neoplasm of Stomach1
2WithdrawnTreatmentAdvanced Melanoma1
2WithdrawnTreatmentClinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Esophageal Squamous Cell Carcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Squamous Cell Carcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Squamous Cell Carcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Squamous Cell Carcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Squamous Cell Carcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage III Esophageal Squamous Cell Carcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Squamous Cell Carcinoma AJCC v8 / Pathologic Stage IIIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Esophageal Squamous Cell Carcinoma AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v81
2WithdrawnTreatmentExtensive Stage Small Cell Lung Carcinoma1
2WithdrawnTreatmentHead and Neck Carcinoma1
2WithdrawnTreatmentRectal Carcinoma / Rectal Neoplasms1
2WithdrawnTreatmentRecurrent/ Metastatic Endometrial Carcinoma1
2, 3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2, 3RecruitingTreatmentMelanoma1
3Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Gastric Adenocarcinoma1
3Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Neoplasm, Gastric1
3Active Not RecruitingTreatmentAdvanced/Unresectable (Inoperable) Urothelial Cancer / Metastatic Urothelial Cancer / UC (Urothelial Cancer)1
3Active Not RecruitingTreatmentCarcinoma, Colorectal1
3Active Not RecruitingTreatmentEsophagogastric Junction Carcinoma / Oesophageal Carcinoma1
3Active Not RecruitingTreatmentGastric Adenocarcinoma1
3Active Not RecruitingTreatmentHead and Neck Carcinoma / Metastatic Head and Neck Squamous Cell Carcinoma / Recurrent Head and Neck Squamous Cell Carcinoma1
3Active Not RecruitingTreatmentHead and Neck Squamous Cell Cancer1
3Active Not RecruitingTreatmentHepatocellular,Carcinoma1
3Active Not RecruitingTreatmentLocally Advanced or Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Small Cell Lung Carcinoma (NSCLC)1
3Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
3Active Not RecruitingTreatmentLymphoma, Hodgkins1
3Active Not RecruitingTreatmentMelanoma4
3Active Not RecruitingTreatmentMetastatic Head and Neck Cancer / Recurrent Head and Neck Cancer1
3Active Not RecruitingTreatmentMetastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Mucosal Melanoma of the Head and Neck / Stage III Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVA Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVC Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck AJCC v7 / Stages III Skin Melanoma1
3Active Not RecruitingTreatmentMetastatic Triple Negative Breast Cancer1
3Active Not RecruitingTreatmentMultiple Myeloma (MM)2
3Active Not RecruitingTreatmentNasopharyngeal Neoplasms1
3Active Not RecruitingTreatmentPleural Mesothelioma Malignant Advanced1
3Active Not RecruitingTreatmentRecurrent or Progressive Metastatic Urothelial Carcinoma / UC (Urothelial Cancer)1
3Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
3Active Not RecruitingTreatmentTriple Negative Breast Neoplasms1
3Active Not RecruitingTreatmentUrothelial Cancer1
3Active Not RecruitingTreatmentUrothelial Carcinoma Associated 1 RNA, Human1
3Not Yet RecruitingTreatmentCancer, Breast1
3Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
3Not Yet RecruitingTreatmentHigh-risk Non-muscle Invasive Bladder Cancer1
3Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3Not Yet RecruitingTreatmentStomach Neoplasms1
3RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Neoplasm, Gastric1
3RecruitingTreatmentAdvanced BRAFV600 Wild-type Melanoma1
3RecruitingTreatmentCervical Cancers1
3RecruitingTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Invasive Breast Carcinoma / Progesterone Receptor Negative / Stage 0 Breast Cancer / Stage 0 Breast Cancer AJCC v6 and v7 / Stage I Breast Cancer AJCC v7 / Stage I Breast Carcinoma / Stage IA Breast Cancer / Stage IA Breast Cancer AJCC v7 / Stage IB Breast Cancer / Stage IB Breast Cancer AJCC v7 / Stage II Breast Cancer / Stage II Breast Cancer AJCC v6 and v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Triple-Negative Breast Carcinoma1
3RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
3RecruitingTreatmentHepatocellular,Carcinoma1
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)5
3RecruitingTreatmentMelanoma1
3RecruitingTreatmentNeoplasms, Endometrial1
3RecruitingTreatmentNeoplasms, Esophageal1
3RecruitingTreatmentNeoplasms, Head and Neck1
3RecruitingTreatmentPathologic Stage I Merkel Cell Carcinoma AJCC v8 / Pathologic Stage II Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIA Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIB Merkel Cell Carcinoma AJCC v8 / Pathologic Stage III Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIA Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIB Merkel Cell Carcinoma AJCC v8 / Resected Mass1
3RecruitingTreatmentRenal Cell Adenocarcinoma2
3RecruitingTreatmentStage II Bladder Urothelial Carcinoma / Stage II Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma AJCC v6 and v71
3RecruitingTreatmentTumors, Solid1
3RecruitingTreatmentUrothelial Cancer1
4Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
4Not Yet RecruitingTreatmentMetastatic Non-Small Cell Lung Carcinoma1
Not AvailableActive Not RecruitingNot AvailableAdenocarcinomas1
Not AvailableActive Not RecruitingTreatmentBrain Cancer1
Not AvailableActive Not RecruitingTreatmentNeoplastic Plasma Cells 10 Percent or More of Bone Marrow Nucleated Cells / Smoldering Multiple Myeloma (SMM) / Smoldering Plasma Cell Myeloma1
Not AvailableActive Not RecruitingTreatmentStage IV Prostate Cancer1
Not AvailableEnrolling by InvitationNot AvailableMalignant Melanoma1
Not AvailableNo Longer AvailableNot AvailableGlioblastoma by Gene Expression Profile / Glioblastoma Multiforme (GBM) / Glioma of Brain / Melanoma (Skin) / Recurrent Melanoma1
Not AvailableNo Longer AvailableNot AvailableMelanoma1
Not AvailableRecruitingNot AvailableCancer, Breast1
Not AvailableRecruitingNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableRecruitingNot AvailableMelanoma1
Not AvailableRecruitingNot AvailableMelanoma / Neoplasms1
Not AvailableRecruitingNot AvailableMetastatic Cancers1
Not AvailableRecruitingNot AvailableMetastatic Melanoma1
Not AvailableRecruitingTreatmentGliomas / Recurrent Malignant Gliomas1
Not AvailableRecruitingTreatmentUrothelial Cancer1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntravenous50 mg
Injection, powder, lyophilized, for solutionIntravenous50 mg/2mL
Injection, solutionIntravenous25 mg/1mL
Injection, solution, concentrateIntravenous25 mg/ml
Powder, for solutionIntravenous50 mg
SolutionIntravenous25 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US2012135408No2012-03-292032-03-29Us

Properties

State
Solid
Experimental Properties
PropertyValueSource
water solubility22.5-27.5 mg/ml (with histidine buffer)'Keytruda monograph'
isoelectric point6.8-6.9'Keytruda monograph'

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
Antibody
General Function
Signal transducer activity
Specific Function
Inhibitory cell surface receptor involved in the regulation of T-cell function during immunity and tolerance. Upon ligand binding, inhibits T-cell effector functions in an antigen-specific manner. ...
Gene Name
PDCD1
Uniprot ID
Q15116
Uniprot Name
Programmed cell death protein 1
Molecular Weight
31646.635 Da
References
  1. McDermott J, Jimeno A: Pembrolizumab: PD-1 inhibition as a therapeutic strategy in cancer. Drugs Today (Barc). 2015 Jan;51(1):7-20. doi: 10.1358/dot.2015.51.1.2250387. [PubMed:25685857]

Drug created on March 30, 2015 16:49 / Updated on November 13, 2018 08:04