Voltage-dependent calcium channel subunit alpha-2/delta-1

Details

Name
Voltage-dependent calcium channel subunit alpha-2/delta-1
Synonyms
  • CACNL2A
  • CCHL2A
  • MHS3
  • Voltage-gated calcium channel subunit alpha-2/delta-1
Gene Name
CACNA2D1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037060|Voltage-dependent calcium channel subunit alpha-2/delta-1
MAAGCLLALTLTLFQSLLIGPSSEEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDI
YEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASN
EVVYYNAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVL
NELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRR
RPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD
VSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIML
FTDGGEERAQEIFNKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIR
INTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLK
NQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTIN
LRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
DKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTF
IAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQNYW
SKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYF
NKSGPGAYESGIMVSKAVEIYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCD
CKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDY
QSVCEPGAAPKQGAGHRSAYVPSVADILQIGWWATAAAWSILQQFLLSLTFPRLLEAVEM
EDDDFTASLSKQSCITEQTQYFFDNDSKSFSGVLDCGNCSRIFHGEKLMNTNLIFIMVES
KGTCPCDTRLLIQAEQTSDGPNPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPS
LWYIIGIQFLLLWLVSGSTHRLL
Number of residues
1103
Molecular Weight
124566.93
Theoretical pI
4.86
GO Classification
Functions
calcium channel regulator activity / metal ion binding / voltage-gated calcium channel activity
Processes
calcium ion transmembrane transport / calcium ion transport / regulation of calcium ion transport
Components
extracellular exosome / L-type voltage-gated calcium channel complex / sarcoplasmic reticulum / voltage-gated calcium channel complex
General Function
Voltage-gated calcium channel activity
Specific Function
The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling (By similarity).
Pfam Domain Function
Transmembrane Regions
1074-1094
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0016179|Voltage-dependent calcium channel subunit alpha-2/delta-1 (CACNA2D1)
ATGGCTGCTGGCTGCCTGCTGGCCTTGACTCTGACACTTTTCCAATCTTTGCTCATCGGC
CCCTCGTCGGAGGAGCCGTTCCCTTCGGCCGTCACTATCAAATCATGGGTGGATAAGATG
CAAGAAGACCTTGTCACACTGGCAAAAACAGCAAGTGGAGTCAATCAGCTTGTTGATATT
TATGAGAAATATCAAGATTTGTATACTGTGGAACCAAATAATGCACGCCAGCTGGTAGAA
ATTGCAGCCAGGGATATTGAGAAACTTCTGAGCAACAGATCTAAAGCCCTGGTGCGCCTG
GCATTGGAAGCGGAGAAAGTTCAAGCAGCTCACCAGTGGAGAGAAGATTTTGCAAGCAAT
GAAGTTGTCTACTACAATGCAAAGGATGATCTCGATCCTGAGAAAAATGACAGTGAGCCA
GGCAGCCAGAGGATAAAACCTGTTTTCATTGAAGATGCTAATTTTGGACGACAAATATCT
TATCAGCACGCAGCAGTCCATATTCCTACTGACATCTATGAGGGCTCAACAATTGTGTTA
AATGAACTCAACTGGACAAGTGCCTTAGATGAAGTTTTCAAAAAGAATCGCGAGGAAGAC
CCTTCATTATTGTGGCAGGTTTTTGGCAGTGCCACTGGCCTAGCTCGATATTATCCAGCT
TCACCATGGGTTGATAATAGTAGAACTCCAAATAAGATTGACCTTTATGATGTACGCAGA
AGACCATGGTACATCCAAGGAGCTGCATCTCCTAAAGACATGCTTATTCTGGTGGATGTG
AGTGGAAGTGTTAGTGGATTGACACTTAAACTGATCCGAACATCTGTCTCCGAAATGTTA
GAAACCCTCTCAGATGATGATTTCGTGAATGTAGCTTCATTTAACAGCAATGCTCAGGAT
GTAAGCTGTTTTCAGCACCTTGTCCAAGCAAATGTAAGAAATAAAAAAGTGTTGAAAGAC
GCGGTGAATAATATCACAGCCAAAGGAATTACAGATTATAAGAAGGGCTTTAGTTTTGCT
TTTGAACAGCTGCTTAATTATAATGTTTCCAGAGCAAACTGCAATAAGATTATTATGCTA
TTCACGGATGGAGGAGAAGAGAGAGCCCAGGAGATATTTAACAAATACAATAAAGATAAA
AAAGTACGTGTATTCACGTTTTCAGTTGGTCAACACAATTATGACAGAGGACCTATTCAG
TGGATGGCCTGTGAAAACAAAGGTTATTATTATGAAATTCCTTCCATTGGTGCAATAAGA
ATCAATACTCAGGAATATTTGGATGTTTTGGGAAGACCAATGGTTTTAGCAGGAGACAAA
GCTAAGCAAGTCCAATGGACAAATGTGTACCTGGATGCATTGGAACTGGGACTTGTCATT
ACTGGAACTCTTCCGGTCTTCAACATAACCGGCCAATTTGAAAATAAGACAAACTTAAAG
AACCAGCTGATTCTTGGTGTGATGGGAGTAGATGTGTCTTTGGAAGATATTAAAAGACTG
ACACCACGTTTTACACTGTGCCCCAATGGGTATTACTTTGCAATCGATCCTAATGGTTAT
GTTTTATTACATCCAAATCTTCAGCCAAAGAACCCCAAATCTCAGGAGCCAGTAACATTG
GATTTCCTTGATGCAGAGTTAGAGAATGATATTAAAGTGGAGATTCGAAATAAGATGATT
GATGGGGAAAGTGGAGAAAAAACATTCAGAACTCTGGTTAAATCTCAAGATGAGAGATAT
ATTGACAAAGGAAACAGGACATACACATGGACACCTGTCAATGGCACAGATTACAGTTTG
GCCTTGGTATTACCAACCTACAGTTTTTACTATATAAAAGCCAAACTAGAAGAGACAATA
ACTCAGGCCAGATCAAAAAAGGGCAAAATGAAGGATTCGGAAACCCTGAAGCCAGATAAT
TTTGAAGAATCTGGCTATACATTCATAGCACCAAGAGATTACTGCAATGACCTGAAAATA
TCGGATAATAACACTGAATTTCTTTTAAATTTCAACGAGTTTATTGATAGAAAAACTCCA
AACAACCCATCATGTAACGCGGATTTGATTAATAGAGTCTTGCTTGATGCAGGCTTTACA
AATGAACTTGTCCAAAATTACTGGAGTAAGCAGAAAAATATCAAGGGAGTGAAAGCACGA
TTTGTTGTGACTGATGGTGGGATTACCAGAGTTTATCCCAAAGAGGCTGGAGAAAATTGG
CAAGAAAACCCAGAGACATATGAGGACAGCTTCTATAAAAGGAGCCTAGATAATGATAAC
TATGTTTTCACTGCTCCCTACTTTAACAAAAGTGGACCTGGTGCCTATGAATCGGGCATT
ATGGTAAGCAAAGCTGTAGAAATATATATTCAAGGGAAACTTCTTAAACCTGCAGTTGTT
GGAATTAAAATTGATGTAAATTCCTGGATAGAGAATTTCACCAAAACCTCAATCAGAGAT
CCGTGTGCTGGTCCAGTTTGTGACTGCAAAAGAAACAGTGACGTAATGGATTGTGTGATT
CTGGATGATGGTGGGTTTCTTCTGATGGCAAATCATGATGATTATACTAATCAGATTGGA
AGATTTTTTGGAGAGATTGATCCCAGCTTGATGAGACACCTGGTTAATATATCAGTTTAT
GCTTTTAACAAATCTTATGATTATCAGTCAGTATGTGAGCCCGGTGCTGCACCAAAACAA
GGAGCAGGACATCGCTCAGCATATGTGCCATCAGTAGCAGACATATTACAAATTGGCTGG
TGGGCCACTGCTGCTGCCTGGTCTATTCTACAGCAGTTTCTCTTGAGTTTGACCTTTCCA
CGACTCCTTGAGGCAGTTGAGATGGAGGATGATGACTTCACGGCCTCCCTGTCCAAGCAG
AGCTGCATTACTGAACAAACCCAGTATTTCTTCGATAACGACAGTAAATCATTCAGTGGT
GTATTAGACTGTGGAAACTGTTCCAGAATCTTTCATGGAGAAAAGCTTATGAACACCAAC
TTAATATTCATAATGGTTGAGAGCAAAGGGACATGTCCATGTGACACACGACTGCTCATA
CAAGCGGAGCAGACTTCTGACGGTCCAAATCCTTGTGACATGGTTAAGCAACCCAGATAC
CGAAAAGGGCCTGATGTCTGCTTTGATAACAATGTCTTGGAGGATTATACTGACTGTGGT
GGTGTTTCTGGATTAAATCCCTCCCTGTGGTATATCATTGGAATCCAGTTTCTACTACTT
TGGCTGGTATCTGGCAGCACACACCGCCTGTTATGA
Chromosome Location
7
Locus
7q21-q22
External Identifiers
ResourceLink
UniProtKB IDP54289
UniProtKB Entry NameCA2D1_HUMAN
GenBank Protein ID179762
GenBank Gene IDM76559
GenAtlas IDCACNA2D1
HGNC IDHGNC:1399
General References
  1. Williams ME, Feldman DH, McCue AF, Brenner R, Velicelebi G, Ellis SB, Harpold MM: Structure and functional expression of alpha 1, alpha 2, and beta subunits of a novel human neuronal calcium channel subtype. Neuron. 1992 Jan;8(1):71-84. [PubMed:1309651]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Brust PF, Simerson S, McCue AF, Deal CR, Schoonmaker S, Williams ME, Velicelebi G, Johnson EC, Harpold MM, Ellis SB: Human neuronal voltage-dependent calcium channels: studies on subunit structure and role in channel assembly. Neuropharmacology. 1993 Nov;32(11):1089-102. [PubMed:8107964]
  4. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  5. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  6. Calderon-Rivera A, Andrade A, Hernandez-Hernandez O, Gonzalez-Ramirez R, Sandoval A, Rivera M, Gomora JC, Felix R: Identification of a disulfide bridge essential for structure and function of the voltage-gated Ca(2+) channel alpha(2)delta-1 auxiliary subunit. Cell Calcium. 2012 Jan;51(1):22-30. doi: 10.1016/j.ceca.2011.10.002. Epub 2011 Nov 3. [PubMed:22054663]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00270Isradipineapproved, investigationalyesinhibitorDetails
DB01023Felodipineapproved, investigationalyesinhibitorDetails
DB01115NifedipineapprovedyesinhibitorDetails
DB00308IbutilideapprovedunknownactivatorDetails
DB00653Magnesium sulfateapproved, investigational, vet_approvedunknownDetails
DB00996Gabapentinapproved, investigationalyesinhibitorDetails
DB08872Gabapentin enacarbilapproved, investigationalunknownDetails
DB00401NisoldipineapprovedyesinhibitorDetails
DB01054Nitrendipineapproved, investigationalyesinhibitorDetails
DB00622Nicardipineapproved, investigationalyesinhibitorDetails
DB06712Nilvadipineapproved, investigationalyesinhibitorDetails
DB04838CyclandelateapprovedunknowninhibitorDetails
DB00230Pregabalinapproved, illicit, investigationalyesDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB00381AmlodipineapprovedyesblockerDetails
DB00153Ergocalciferolapproved, nutraceuticalnoinducerDetails