Reverse transcriptase/RNaseH

Details

Name
Reverse transcriptase/RNaseH
Synonyms
Not Available
Gene Name
pol
Organism
Human immunodeficiency virus 1
Amino acid sequence
>lcl|BSEQ0012880|Reverse transcriptase/RNaseH
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Number of residues
566
Molecular Weight
65223.615
Theoretical pI
8.45
GO Classification
Functions
identical protein binding / metal ion binding / nucleic acid binding / RNA-directed DNA polymerase activity / RNA-DNA hybrid ribonuclease activity
General Function
Rna-dna hybrid ribonuclease activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ72547
UniProtKB Entry NameQ72547_9HIV1
GenBank Protein ID896047
GenBank Gene IDU28646
General References
  1. Jones LH, Allan G, Barba O, Burt C, Corbau R, Dupont T, Knochel T, Irving S, Middleton DS, Mowbray CE, Perros M, Ringrose H, Swain NA, Webster R, Westby M, Phillips C: Novel indazole non-nucleoside reverse transcriptase inhibitors using molecular hybridization based on crystallographic overlays. J Med Chem. 2009 Feb 26;52(4):1219-23. doi: 10.1021/jm801322h. [PubMed:19175319]
  2. Kirschberg TA, Balakrishnan M, Squires NH, Barnes T, Brendza KM, Chen X, Eisenberg EJ, Jin W, Kutty N, Leavitt S, Liclican A, Liu Q, Liu X, Mak J, Perry JK, Wang M, Watkins WJ, Lansdon EB: RNase H active site inhibitors of human immunodeficiency virus type 1 reverse transcriptase: design, biochemical activity, and structural information. J Med Chem. 2009 Oct 8;52(19):5781-4. doi: 10.1021/jm900597q. [PubMed:19791799]
  3. Lansdon EB, Liu Q, Leavitt SA, Balakrishnan M, Perry JK, Lancaster-Moyer C, Kutty N, Liu X, Squires NH, Watkins WJ, Kirschberg TA: Structural and binding analysis of pyrimidinol carboxylic acid and N-hydroxy quinazolinedione HIV-1 RNase H inhibitors. Antimicrob Agents Chemother. 2011 Jun;55(6):2905-15. doi: 10.1128/AAC.01594-10. Epub 2011 Apr 4. [PubMed:21464257]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00300Tenofovir disoproxilapproved, investigationalyesinhibitorDetails
DB079355-[(5-fluoro-3-methyl-1H-indazol-4-yl)oxy]benzene-1,3-dicarbonitrileexperimentalunknownDetails
DB01048Abacavirapproved, investigationalyesinhibitorDetails
DB00705DelavirdineapprovedyesinhibitorDetails
DB00900DidanosineapprovedyesinhibitorDetails
DB00625Efavirenzapproved, investigationalyesinhibitorDetails
DB00879Emtricitabineapproved, investigationalyesinhibitorDetails
DB00709Lamivudineapproved, investigationalyesinhibitorDetails
DB00238NevirapineapprovedyesinhibitorDetails
DB00649Stavudineapproved, investigationalyesinhibitorDetails
DB00943Zalcitabineapproved, investigationalyesinhibitorDetails
DB00495ZidovudineapprovedyesinhibitorDetails
DB08864RilpivirineapprovedyesinhibitorDetails
DB09299Tenofovir alafenamideapprovedyesinhibitorDetails
DB11365SennosidesapprovedunknowninhibitorDetails
DB11799Bictegravirapproved, investigationalyesantagonistDetails
DB12855ApricitabineinvestigationalunknowninhibitorDetails
DB12301Doravirineapproved, investigationalunknowninhibitorDetails