Pol polyprotein

Details

Name
Pol polyprotein
Synonyms
Not Available
Gene Name
pol
Organism
Human immunodeficiency virus 1
Amino acid sequence
>lcl|BSEQ0020806|Pol polyprotein
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Number of residues
99
Molecular Weight
10778.7
Theoretical pI
Not Available
GO Classification
Functions
aspartic-type endopeptidase activity
General Function
Aspartic-type endopeptidase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ72874
UniProtKB Entry NameQ72874_9HIV1
General References
  1. Yamaguchi K, Byrn RA: Clinical isolates of HIV-1 contain few pre-existing proteinase inhibitor resistance-conferring mutations. Biochim Biophys Acta. 1995 Dec 6;1253(2):136-40. [PubMed:8519793]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00224IndinavirapprovedyesinhibitorDetails
DB00503Ritonavirapproved, investigationalyesinhibitorDetails
DB00701Amprenavirapproved, investigationalyesinhibitorDetails
DB00932Tipranavirapproved, investigationalyesinhibitorDetails
DB01072Atazanavirapproved, investigationalyesinhibitorDetails
DB01232Saquinavirapproved, investigationalyesinhibitorDetails
DB01264DarunavirapprovedyesinhibitorDetails
DB01601LopinavirapprovedyesinhibitorDetails
DB01319FosamprenavirapprovedyesinhibitorDetails
DB04887BrecanavirinvestigationalunknownDetails