Solute carrier organic anion transporter family member 3A1

Details

Name
Solute carrier organic anion transporter family member 3A1
Synonyms
  • OATP-D
  • OATP-RP3
  • OATP3A1
  • OATPD
  • OATPRP3
  • Organic anion transporter polypeptide-related protein 3
  • Organic anion-transporting polypeptide D
  • PGE1 transporter
  • SLC21A11
  • Sodium-independent organic anion transporter D
  • Solute carrier family 21 member 11
Gene Name
SLCO3A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037253|Solute carrier organic anion transporter family member 3A1
MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLVSECALMLAQGTVGAYL
VSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLIGCGGIVMALGA
LLSALPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNMMYLLL
IGAQVLLGIGATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACGFILGSFCTKIY
VDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSLPPHSEPAMESE
QAMLSEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNPVFTCIILAACM
EIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLLVKKLSLSALGA
IRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVPYGNSTAPGSALDPYSPCNNNCECQTD
SFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPSPGCQEAFLTFL
CVMCICSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPPPLIFGAGIDST
CLFWSTFCGEQGACVLYDNVVYRYLYVSIAIALKSFAFILYTTTWQCLRKNYKRYIKNHE
GGLSTSEFFASTLTLDNLGRDPVPANQTHRTKFIYNLEDHEWCENMESVL
Number of residues
710
Molecular Weight
76552.135
Theoretical pI
6.71
GO Classification
Functions
sodium-independent organic anion transmembrane transporter activity
Processes
anion transmembrane transport / prostaglandin transport / sodium-independent organic anion transport / transmembrane transport
Components
integral component of plasma membrane / plasma membrane
General Function
Sodium-independent organic anion transmembrane transporter activity
Specific Function
Mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate (PubMed:10873595). Mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS (PubMed:16971491).
Pfam Domain Function
Transmembrane Regions
41-60 80-100 107-131 175-203 223-243 262-286 345-366 387-410 415-438 540-562 572-597 631-648
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017177|Solute carrier organic anion transporter family member 3A1 (SLCO3A1)
ATGCAGGGGAAGAAGCCGGGCGGTTCGTCGGGCGGCGGCCGGAGCGGCGAGCTGCAGGGG
GACGAGGCGCAGAGGAACAAGAAAAAGAAAAAGAAGGTGTCCTGCTTTTCCAACATCAAG
ATCTTCCTGGTGTCCGAGTGCGCCCTGATGCTGGCGCAGGGCACGGTGGGCGCCTACCTG
GTGAGCGTCCTGACCACCCTGGAGCGTAGGTTCAACCTGCAGAGCGCTGACGTGGGTGTG
ATCGCTAGCAGCTTCGAGATCGGGAACCTGGCGCTCATCCTCTTCGTGAGCTACTTCGGG
GCACGCGGGCACCGGCCGCGCCTGATCGGCTGCGGCGGCATCGTCATGGCGCTGGGCGCG
CTGCTGTCGGCGCTGCCCGAGTTCCTGACCCACCAGTACAAGTACGAGGCGGGCGAGATC
CGCTGGGGCGCCGAGGGCCGCGACGTCTGCGCAGCCAACGGCTCGGGCGGCGACGAGGGG
CCCGACCCCGACCTCATCTGCCGCAACCGGACGGCTACCAACATGATGTACTTGCTGCTC
ATTGGGGCCCAGGTGCTCCTGGGCATCGGTGCTACCCCTGTGCAGCCCCTGGGCGTCTCC
TACATCGACGACCACGTGCGGAGGAAGGACTCCTCGCTCTATATAGGAATCCTGTTCACG
ATGCTGGTATTTGGACCAGCCTGCGGGTTTATCCTGGGCTCTTTCTGTACCAAAATCTAC
GTGGATGCGGTCTTCATTGACACAAGTAACCTGGACATCACTCCGGACGACCCCCGCTGG
ATCGGAGCCTGGTGGGGTGGCTTTCTGCTCTGCGGTGCCTTACTCTTCTTCTCTTCCCTC
TTGATGTTTGGGTTTCCACAGTCCCTGCCCCCGCACTCAGAGCCCGCCATGGAAAGCGAG
CAGGCCATGCTCTCCGAAAGAGAATACGAGAGACCCAAGCCCAGCAACGGGGTCCTGAGG
CACCCCCTGGAGCCAGACAGCAGTGCCTCCTGTTTCCAGCAGCTGAGAGTGATCCCGAAG
GTCACCAAGCACCTGCTCTCAAACCCTGTGTTCACCTGCATCATCCTGGCCGCCTGCATG
GAGATTGCAGTGGTGGCTGGCTTCGCTGCCTTTTTGGGGAAGTACCTGGAGCAGCAGTTT
AACCTCACCACCTCTTCTGCCAACCAGCTGCTTGGGATGACTGCGATCCCGTGTGCTTGT
CTGGGTATCTTCCTGGGAGGTCTTTTGGTGAAGAAGCTCAGCCTGTCTGCCCTGGGGGCC
ATTCGGATGGCCATGCTCGTCAACCTGGTGTCCACTGCTTGCTACGTCTCCTTCCTCTTC
CTGGGCTGCGACACTGGCCCTGTGGCTGGGGTTACTGTTCCCTATGGAAACAGCACAGCA
CCTGGCTCAGCCCTGGACCCCTACTCGCCCTGCAATAATAACTGTGAATGCCAAACCGAT
TCCTTCACTCCAGTGTGTGGGGCAGATGGCATCACCTACCTGTCTGCCTGCTTTGCTGGC
TGCAACAGCACGAATCTCACGGGCTGTGCGTGCCTCACCACCGTCCCTGCTGAGAACGCA
ACCGTGGTTCCTGGAAAATGCCCCAGTCCTGGGTGCCAAGAGGCCTTCCTCACTTTCCTC
TGTGTGATGTGTATCTGCAGCCTGATCGGTGCCATGGCACAGACACCCTCAGTCATCATC
CTCATCAGGACAGTCAGCCCTGAACTCAAGTCTTACGCTTTGGGAGTTCTTTTTCTCCTC
CTTCGTTTGTTGGGCTTCATCCCTCCACCCCTCATCTTCGGGGCTGGCATCGACTCCACC
TGCCTGTTCTGGAGCACGTTCTGTGGGGAGCAAGGCGCCTGCGTCCTCTACGACAATGTG
GTCTACCGATACCTGTATGTCAGCATCGCCATCGCGCTCAAATCCTTCGCCTTCATCCTG
TACACCACCACGTGGCAGTGCCTGAGGAAAAACTATAAACGCTACATCAAAAACCACGAG
GGCGGGCTGAGCACCAGCACAGAGTACCAAGACATTGAGACTGAGAAAACCTGCCCCGAA
TCACATTCACCTTCAGAAGACTCCTTTGTGAGAAGCTGA
Chromosome Location
15
Locus
15q26
External Identifiers
ResourceLink
UniProtKB IDQ9UIG8
UniProtKB Entry NameSO3A1_HUMAN
GenBank Protein ID6683741
GenBank Gene IDAB031050
HGNC IDHGNC:10952
General References
  1. Tamai I, Nezu J, Uchino H, Sai Y, Oku A, Shimane M, Tsuji A: Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family. Biochem Biophys Res Commun. 2000 Jun 24;273(1):251-60. [PubMed:10873595]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Huber RD, Gao B, Sidler Pfandler MA, Zhang-Fu W, Leuthold S, Hagenbuch B, Folkers G, Meier PJ, Stieger B: Characterization of two splice variants of human organic anion transporting polypeptide 3A1 isolated from human brain. Am J Physiol Cell Physiol. 2007 Feb;292(2):C795-806. Epub 2006 Sep 13. [PubMed:16971491]
  6. Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012 Jul 31;109(31):12449-54. doi: 10.1073/pnas.1210303109. Epub 2012 Jul 18. [PubMed:22814378]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04348Taurocholic acidapproved, experimentalunknowninhibitorDetails
DB00770Alprostadilapproved, investigationalunknowninhibitorDetails
DB00345Aminohippuric acidapproved, investigationalunknowninhibitorDetails
DB00917DinoprostoneapprovedunknownsubstrateDetails
DB01053Benzylpenicillinapproved, vet_approvedunknownsubstrateDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB00563MethotrexateapprovedunknownsubstrateDetails
DB01088Iloprostapproved, investigationalunknownsubstrateDetails
DB01160Dinoprost tromethamineapproved, vet_approvedunknownDetails
DB06654Safinamideapproved, investigationalunknownsubstrateDetails
DB09198LobeglitazoneexperimentalnoinhibitorDetails