| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-06-23 18:07:17 |
| Primary Accession Number |
DB00822 |
| Secondary Accession Number |
|
| Name |
Disulfiram |
| Drug Type |
|
| Description |
A carbamate derivative used as an alcohol deterrent. It is a relatively nontoxic substance when administered alone, but markedly alters the intermediary metabolism of alcohol. When alcohol is ingested after administration of disulfiram, blood acetaldehyde concentrations are increased, followed by flushing, systemic vasodilation, respiratory difficulties, nausea, hypotension, and other symptoms (acetaldehyde syndrome). It acts by inhibiting aldehyde dehydrogenase. [PubChem] |
| Synonyms |
- Disulfuram
- Disulphuram
- Dupon 4472
- Dupont Fungicide 4472
- TATD
- TETD
- TTD
- Tetraethylthioperoxydicarbonic Diamide
- Tetraethylthiram Disulfide
- Tetraethylthiram Disulphide
- Tetraethylthiuram
- Tetraethylthiuram Disulfide
- Tetraethylthiuram Disulphide
- Tetraethylthiuram Sulfide
- Tetraethylthiuran Disulfide
- Usaf B-33
|
| Brand Names |
- Abstensil
- Abstinil
- Abstinyl
- Accel Tet
- Accel Tet-R
- Akrochem Tetd
- Alcophobin
- Alk-Aubs
- Ancazide Et
- Antabus
- Antabuse
- Antadix
- Antaenyl
- Antaethan
- Antaethyl
- Antaetil
- Antalcol
- Antetan
- Antethyl
- Antetil
- Anteyl
- Anthethyl
- Anti-Ethyl
- Antiaethan
- Anticol
- Antietanol
- Antietil
- Antikol
- Antivitium
- Aversan
- Averzan
- Bonibal
- Contralin
- Contrapot
- Cronetal
- Dicupral
- Disetil
- Disulfan
- Disulfram
- Ekagom Dtet
- Ekagom Teds
- Ekagom Tetds
- Ekaland Tetd
- Ephorran
- Espenal
- Esperal
- Etabus
- Ethyl Thiram
- Ethyl Thiudad
- Ethyl Thiurad
- Ethyl Tuads
- Ethyl Tuads Rodform
- Ethyl Tuex
- Ethyldithiourame
- Ethyldithiurame
- Etyl Tuex
- Exhoran
- Exhorran
- Gababentin
- Hoca
- Krotenal
- Nocbin
- Nocceler Tet
- Nocceler Tet-G
- Noxal
- Perkacit Tetd
- Perkait Tetd
- Refusal
- Ro-Sulfiram
- Sanceler Tet
- Sanceler Tet-G
- Soxinol Tet
- Stopaethyl
- Stopethyl
- Stopety
- Stopetyl
- Super Rodiatox
- TTS
- TTS X
- Tenurid
- Tenutex
- Tetidis
- Tetradin
- Tetradine
- Tetraetil
- Teturam
- Teturamin
- Thiocid
- Thiophos
- Thioscabin
- Thireranide
- Tillram
- Tiuram
|
| Brand Mixtures |
Not Available |
| Chemical IUPAC Name |
diethylcarbamothioylsulfanyl diethylaminomethanedithioate |
| Chemical Formula |
C10H20N2S4 |
| Chemical Structure |
 |
| CAS Registry Number |
97-77-8 |
| InChI Identifier |
InChI=1/C10H20N2S4/c1-5-11(6-2)9(13)15-16-10(14)12(7-3)8-4/h5-8H2,1-4H3 |
| InChI Key |
AUZONCFQVSMFAP-UHFFFAOYAF |
| KEGG Drug |
D00131  |
| KEGG Compound |
C01692  |
| PubChem Compound |
3117  |
| PubChem Substance |
4833  |
| ChEBI ID |
4659  |
| PharmGKB ID |
PA449376  |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
00002534  |
| RxList Link |
http://www.rxlist.com/cgi/generic/disulfiram.htm  |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Disulfiram  |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
296.5390 |
| Monoisotopic Molecular Weight |
296.0509 |
| State |
Solid |
| Melting Point |
71.5 oC |
| Experimental Water Solubility |
4.09 mg/L
Source: PhysProp
|
| Predicted Water Solubility |
1.26e-02 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
1.9
Source: PhysProp
|
| Predicted LogP |
3.88
Calculated using ALOGPS
|
| Experimental LogS |
-4.86 [ADME Research, USCD] |
| Predicted LogS |
-4.37
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
CCN(CC)C(=S)SSC(=S)N(CC)CC |
| Canonical SMILES |
CCN(CC)C(=S)SSC(=S)N(CC)CC |
| Drug Category |
- Alcohol Deterrents
- Enzyme Inhibitors
|
| ATC Codes |
|
| AHFS Codes |
Not Available |
| Indication |
For the treatment and management of chronic alcoholism |
| Pharmacology |
Disulfiram produces a sensitivity to alcohol which results in a highly unpleasant reaction when the patient under treatment ingests even small amounts of alcohol. Disulfiram blocks the oxidation of alcohol at the acetaldehyde stage during alcohol metabolism following disulfiram intake, the concentration of acetaldehyde occurring in the blood may be 5 to 10 times higher than that found during metabolism of the same amount of alcohol alone. Accumulation of acetaldehyde in the blood produces a complex of highly unpleasant symptoms referred to hereinafter as the disulfiram-alcohol reaction. This reaction, which is proportional to the dosage of both disulfiram and alcohol, will persist as long as alcohol is being metabolized. Disulfiram does not appear to influence the rate of alcohol elimination from the body. Prolonged administration of disulfiram does not produce tolerance; the longer a patient remains on therapy, the more exquisitely sensitive he becomes to alcohol. |
| Mechanism of Action |
Disulfiram blocks the oxidation of alcohol at the acetaldehyde stage during alcohol metabolism following disulfiram intake causing an accumulation of acetaldehyde in the blood producing highly unpleasant symptoms. Disulfiram blocks the oxidation of alcohol through its irreversible inactivation of aldehyde dehydrogenase, which acts in the second step of ethanol utilization. In addition, disulfiram competitively binds and inhibits the peripheral benzodiazepine receptor, which may indicate some value in the treatment of the symptoms of alcohol withdrawal, however this activity has not been extensively studied. |
| Absorption |
Disulfiram is absorbed slowly from the gastrointestinal tract (80 to 90% of oral dose). |
| Toxicity |
LD50=8.6g/kg (orally in rats). Symptoms of overdose include irritation, slight drowsiness, unpleasant taste, mild GI disturbances, and orthostatic hypotension. |
| Protein Binding |
Not Available |
| Biotransformation |
Hepatic. |
| Half Life |
Not Available |
| Dosage Forms |
|
| Patient Information |
Not Available |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
| Drug |
Interaction |
| Acenocoumarol |
Disulfiram increases the anticoagulant effect |
| Aminophylline |
Increases the effect and toxicity of theophylline |
| Amprenavir |
Increased risk of side effects (oral solution) |
| Anisindione |
Increases the anticoagulant effect |
| Chlorzoxazone |
Increases chlorzoxazone levels |
| Cocaine |
Increases the cardiac toxicity of cocaine |
| Dicumarol |
Increases the anticoagulant effect |
| Dyphylline |
Increases the effect and toxicity of theophylline |
| Ethotoin |
Increases the effect of phenytoin |
| Fosphenytoin |
Increases the effect of phenytoin |
| Isoniazid |
Increased risk of CNS adverse efects |
| Mephenytoin |
Increases the effect of phenytoin |
| Metronidazole |
Possible acute psychosis and confusion |
| Oxtriphylline |
Increases the effect and toxicity of theophylline |
| Phenytoin |
Increases the effect of phenytoin |
| Theophylline |
Increases the effect and toxicity of theophylline |
| Warfarin |
Increases the anticoagulant effect |
|
| Food Interactions |
- Avoid alcohol for up to 14 days after treatment has been stopped.
- Take without regard to meals.
|
| Pathways |
Not Available
|
| General References |
- Bouma MJ, Snowdon D, Fairlamb AH, Ackers JP: Activity of disulfiram (bis(diethylthiocarbamoyl)disulphide) and ditiocarb (diethyldithiocarbamate) against metronidazole-sensitive and -resistant Trichomonas vaginalis and Tritrichomonas foetus. J Antimicrob Chemother. 1998 Dec;42(6):817-20. [PubMed
]
- Nash T, Rice WG: Efficacies of zinc-finger-active drugs against Giardia lamblia. Antimicrob Agents Chemother. 1998 Jun;42(6):1488-92. [PubMed
]
- Drugs.com

- Wikipedia

- RxList

|
| Organisms Affected |
|
| Targets |
- Aldehyde dehydrogenase, mitochondrial
- Translocator protein
|
|
Drug Target 1
[top]
|
| Target 1 ID |
147 |
| Target 1 Name |
Aldehyde dehydrogenase, mitochondrial |
| Target 1 Synonyms |
- ALDH class 2
- ALDH-E2
- ALDHI
- Aldehyde dehydrogenase, mitochondrial precursor
- EC 1.2.1.3
|
| Target 1 Gene Name |
ALDH2 |
| Target 1 Protein Sequence |
>Aldehyde dehydrogenase, mitochondrial precursor
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
|
| Target 1 Number of Residues |
525 |
| Target 1 Molecular Weight |
56382 |
| Target 1 Theoretical pI |
7.05 |
| Target 1 GO Classification |
|
Function
|
catalytic activity
oxidoreductase activity |
|
Process
|
physiological process
metabolism |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Energy production and conversion |
| Target 1 Specific Function |
Not Available |
| Target 1 Pathways |
|
| Target 1 Reactions |
- an aldehyde + NAD+ + H2O = an acid + NADH + H+
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
28606  |
| Target 1 UniProtKB/Swiss-Prot ID |
P05091  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
ALDH2_HUMAN  |
| Target 1 PDB ID |
1OF7  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
- Mitochondrion
- mitochondrial matrix
|
| Target 1 Gene Sequence |
>1551 bp
ATGTTGCGCGCTGCCGCCGCTCGGGCCCCGCCTGGCCGCCGCCTCTTGTCAGCCGCCGCC
ACCCAGGCCGTGCCTGCCCCCAACCAGCAGCCCGAGGTCTTCTGCAACCAGATTTTCATA
AACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCCACT
GGAGAGGTCATCTGTCAGGTAGCTGAAGGGGACAAGGAAGATGTGGACAAGGCACGTGAA
GGCCGCCCGGGCGCCTTCCAGCTGGGCTCACCTTGGCGCCGCATGGACGCATCACACAGC
GGCCGGCTGCTGAACCGCCTGGCCGATCTGATCGAGCGGGACCGGACCTACCTGGCGGCC
TTGGAGACCCTGGACAATGGCAAGCCCTATGTCATCTCCTACCTGGTGGATTTGGACATG
GTCCTCAAATGTCTCCGGTATTATGCCGGCTGGGCTGATAAGTACCACGGGAAAACCATC
CCCATTGACGGAGACTTCTTCAGCTACACACGCCATGAACCTGTGGGGGTGTGCGGGCAG
ATCATTCCGTGGAATTTCCCGCTCCTGATGCAAGCATGGAAGCTGGGCCCAGCCTTGGCA
ACTGGAAACGTGGTTGTGATGAAGGTAGCTGAGCAGACACCCCTCACCGCCCTCTATGTG
GCCAACCTGATCAAGGAGGCTGGCTTTCCCCCTGGTGTGGTCAACATTGTGCCTGGATTT
GGCCCCACGGCTGGGGCCGCCATTGCCTCCCATGAGGATGTGGACAAAGTGGCATTCACA
GGCTCCACTGAGATTGGCCGCGTAATCCAGGTTGCTGCTGGGAGCAGCAACCTCAAGAGA
GTGACCTTGGAGCTGGGGGGGAAGAGCCCCAACATCATCATGTCAGATGCCGATATGGAT
TGGGCCGTGGAACAGGCCCACTTCGCCCTGTTCTTCAACCAGGGCCAGTGCTGCTGTGCC
GGCTCCCGGACCTTCGTGCAGGAGGACATCTATGATGAGTTTGTGGTGCGGAGCGTTGCC
CGGGCCAAGTCTCGGGTGGTCGGGAACCCCTTTGATAGCAAGACCGAGCAGGGGCCGCAG
GTGGATGAAACTCAGTTTAAGAAGATCCTCGGCTACATCAACACGGGGAAGCAAGAGGGG
GCGAAGCTGCTGTGTGGTGGGGGCATTGCTGCTGACCGTGGTTACTTCATCCAGCCCACT
GTGTTTGGAGATGTGCAGGATGGCATGACCATCGCCAAGGAGGAGATCTTCGGGCCAGTG
ATGCAGATCCTGAAGTTCAAGACCATAGAGGAGGTTGTTGGGAGAGCCAACAATTCCACG
TACGGGCTGGCCGCAGCTGTCTTCACAAAGGATTTGGACAAGGCCAATTACCTGTCCCAG
GCCCTCCAGGCGGGCACTGTGTGGGTCAACTGCTATGATGTGTTTGGAGCCCAGTCACCC
TTTGGTGGCTACAAGATGTCGGGGAGTGGCCGGGAGTTGGGCGAGTACGGGCTGCAGGCA
TACACTGAAGTGAAAACTGTCACAGTCAAAGTGCCTCAGAAGAACTCATAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
ALDH2  |
| Target 1 GenAtlas ID |
ALDH2  |
| Target 1 HGNC ID |
HGNC:404  |
| Target 1 Chromosome Location |
12 |
| Target 1 Locus |
12q24.2 |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Ni L, Zhou J, Hurley TD, Weiner H: Human liver mitochondrial aldehyde dehydrogenase: three-dimensional structure and the restoration of solubility and activity of chimeric forms. Protein Sci. 1999 Dec;8(12):2784-90. [PubMed
]
- Hsu LC, Bendel RE, Yoshida A: Genomic structure of the human mitochondrial aldehyde dehydrogenase gene. Genomics. 1988 Jan;2(1):57-65. [PubMed
]
- Hsu LC, Tani K, Fujiyoshi T, Kurachi K, Yoshida A: Cloning of cDNAs for human aldehyde dehydrogenases 1 and 2. Proc Natl Acad Sci U S A. 1985 Jun;82(11):3771-5. [PubMed
]
- Braun T, Bober E, Singh S, Agarwal DP, Goedde HW: Isolation and sequence analysis of a full length cDNA clone coding for human mitochondrial aldehyde dehydrogenase. Nucleic Acids Res. 1987 Apr 10;15(7):3179. [PubMed
]
- Braun T, Bober E, Singh S, Agarwal DP, Goedde HW: Evidence for a signal peptide at the amino-terminal end of human mitochondrial aldehyde dehydrogenase. FEBS Lett. 1987 May 11;215(2):233-6. [PubMed
]
- Agarwal DP, Goedde HW: Human aldehyde dehydrogenase isozymes and alcohol sensitivity. Isozymes Curr Top Biol Med Res. 1987;16:21-48. [PubMed
]
- Hempel J, Hoog JO, Jornvall H: Mitochondrial aldehyde dehydrogenase. Homology of putative targeting sequence to that of carbamyl phosphate synthetase I revealed by correlation of cDNA and protein data. FEBS Lett. 1987 Sep 28;222(1):95-8. [PubMed
]
- Yoshida A, Ikawa M, Hsu LC, Tani K: Molecular abnormality and cDNA cloning of human aldehyde dehydrogenases. Alcohol. 1985 Jan-Feb;2(1):103-6. [PubMed
]
- Hempel J, Kaiser R, Jornvall H: Mitochondrial aldehyde dehydrogenase from human liver. Primary structure, differences in relation to the cytosolic enzyme, and functional correlations. Eur J Biochem. 1985 Nov 15;153(1):13-28. [PubMed
]
- Yoshida A, Huang IY, Ikawa M: Molecular abnormality of an inactive aldehyde dehydrogenase variant commonly found in Orientals. Proc Natl Acad Sci U S A. 1984 Jan;81(1):258-61. [PubMed
]
- 8561277 Novoradovsky A, Tsai SJ, Goldfarb L, Peterson R, Long JC, Goldman D: Mitochondrial aldehyde dehydrogenase polymorphism in Asian and American Indian populations: detection of new ALDH2 alleles. Alcohol Clin Exp Res. 1995 Oct;19(5):1105-10.
|
| Target 1 Drug References |
- Mackenzie IS, Maki-Petaja KM, McEniery CM, Bao YP, Wallace SM, Cheriyan J, Monteith S, Brown MJ, Wilkinson IB: Aldehyde dehydrogenase 2 plays a role in the bioactivation of nitroglycerin in humans. Arterioscler Thromb Vasc Biol. 2005 Sep;25(9):1891-5. Epub 2005 Jul 28. [PubMed
]
- Ho MP, Yo CH, Liu CM, Chen CL, Lee CC: Refractive hypotension in a patient with disulfiram-ethanol reaction. Am J Med Sci. 2007 Jan;333(1):53-5. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
811 |
| Target 2 Name |
Translocator protein |
| Target 2 Synonyms |
- Mitochondrial benzodiazepine receptor
- PBR
- PKBS
- Peripheral-type benzodiazepine receptor
|
| Target 2 Gene Name |
BZRP |
| Target 2 Protein Sequence |
>Peripheral-type benzodiazepine receptor
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
|
| Target 2 Number of Residues |
171 |
| Target 2 Molecular Weight |
18779 |
| Target 2 Theoretical pI |
9.33 |
| Target 2 GO Classification |
|
Function
|
| Not Available |
|
Process
|
| Not Available |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 2 General Function |
Signal transduction mechanisms |
| Target 2 Specific Function |
Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme |
| Target 2 Pathways |
Not Available
|
| Target 2 Reactions |
Not Available |
| Target 2 Pfam Domain Function |
|
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
- 6-26
- 47-67
- 80-100
- 106-126
- 135-155
|
| Target 2 Essentiality |
Non-Essential |
| Target 2 GenBank ID Protein |
306883  |
| Target 2 UniProtKB/Swiss-Prot ID |
P30536  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
BZRP_HUMAN  |
| Target 2 PDB ID |
Not Available |
| Target 2 Cellular Location |
- Mitochondrion
- mitochondrial membrane
- multi-pass membrane protein
|
| Target 2 Gene Sequence |
>510 bp
ATGGCCCCGCCCTGGGTGCCCGCCATGGGCTTCACGCTGGCGCCCAGCCTGGGGTGCTTC
GTGGGCTCCCGCTTTGTCCACGGCGAGGGTCTCCGCTGGTACGCCGGCCTGCAGAAGCCC
TCGTGGCACCCGCCCCACTGGGTGCTGGGCCCTGTCTGGGGCACGCTCTACTCAGCCATG
GGGTACGGCTCCTACCTGGTCTGGAAAGAGCTGGGAGGCTTCACAGAGAAGGCTGTGGTT
CCCCTGGGCCTCTACACTGGGCAGCTGGCCCTGAACTGGGCATGGCCCCCCATCTTCTTT
GGTGCCCGACAAATGGGCTGGGCCTTGGTGGATCTCCTGCTGGTCAGTGGGGCGGCGGCN
GCCACTACCGTGGCCTGGTACCAGGTGAGCCCGCTGGCCGCCCGCCTGCTCTACCCCTAC
CTGGCCTGGCTGGCCTTCGCGACCACACTCAACTACTGCGTATGGCGGGACAACCATGGC
TGGCATGGGGGACGGCGGCTGCCAGAGTGA
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
TSPO  |
| Target 2 GenAtlas ID |
TSPO  |
| Target 2 HGNC ID |
HGNC:1158  |
| Target 2 Chromosome Location |
22 |
| Target 2 Locus |
22q13.31 |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed
]
- Kurumaji A, Nomoto H, Yoshikawa T, Okubo Y, Toru M: An association study between two missense variations of the benzodiazepine receptor (peripheral) gene and schizophrenia in a Japanese sample. J Neural Transm. 2000;107(4):491-500. [PubMed
]
- Kurumaji A, Nomoto H, Yamada K, Yoshikawa T, Toru M: No association of two missense variations of the benzodiazepine receptor (peripheral) gene and mood disorders in a Japanese sample. Am J Med Genet. 2001 Mar 8;105(2):172-5. [PubMed
]
- Riond J, Mattei MG, Kaghad M, Dumont X, Guillemot JC, Le Fur G, Caput D, Ferrara P: Molecular cloning and chromosomal localization of a human peripheral-type benzodiazepine receptor. Eur J Biochem. 1991 Jan 30;195(2):305-11. [PubMed
]
- Yakovlev AG, Ruffo M, Jurka J, Krueger KE: Comparison of repetitive elements in the third intron of human and rodent mitochondrial benzodiazepine receptor-encoding genes. Gene. 1995 Apr 3;155(2):201-5. [PubMed
]
- Galiegue S, Jbilo O, Combes T, Bribes E, Carayon P, Le Fur G, Casellas P: Cloning and characterization of PRAX-1. A new protein that specifically interacts with the peripheral benzodiazepine receptor. J Biol Chem. 1999 Jan 29;274(5):2938-52. [PubMed
]
|
| Target 2 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|