You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameTrastuzumab
Accession NumberDB00072  (BTD00098, BIOD00098)
TypeBiotech
GroupsApproved, Investigational
DescriptionA recombinant IgG1 kappa, humanized monoclonal antibody that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein. Produced in CHO cell culture.
Protein structureDb00072
Related Articles
Protein chemical formulaC6470H10012N1726O2013S42
Protein average weight145531.5 Da
Sequences
>Anti-HER2 Light chain (1 and 2)
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Anti-HER2 Heavy chain (1 and 2)
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
Anti HER2
Ig gamma-1 chain C region
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Herceptinpowder for solution440 mgintravenousHoffmann La Roche Limited1999-08-23Not applicableCanada
HerceptinSolution for injection600 mg systemSubcutaneous useRoche Registration Limited2000-08-28Not applicableEu
HerceptinkitGenentech, Inc.1998-09-25Not applicableUs
HerceptinPowder for concentrate for solution for infusion150 mgIntravenous useRoche Registration Limited2000-08-28Not applicableEu
HerceptinSolution for injection600 mgSubcutaneous useRoche Registration Limited2000-08-28Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
HerclonRoche
Brand mixtures
NameLabellerIngredients
Perjeta-herceptinHoffmann La Roche Limited
SaltsNot Available
Categories
UNIIP188ANX8CK
CAS number180288-69-1
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor treatment of early stage HER2-positive breast cancer, or metastatic breast cancer that substantially overexpress HER2.
PharmacodynamicsUsed in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 25%-30% of primary breast cancers.Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumorcells that overexpress HER2. It is a mediator of antibody dependent cellular cytotoxicity, in that the binding of the antibody to HER2 overexpressing cells leads to preferential cell death.
Mechanism of actionTrastuzumab binds to the HER2 (or c-erbB2) proto-oncogene, an EGF receptor-like protein found on 20-30% of breast cancer cells. The binding leads to antibody mediated (complement mediated) killing of the HER2 positive cells.
Related Articles
AbsorptionPeak and trough plasma concentrations at steady state (between weeks 16 and 32) approximately 123 and 79 mcg/mL, respectively.
Volume of distribution
  • 44 mL/kg
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system.

Route of eliminationNot Available
Half lifeaverage 28.5 days. Pharmacokinetics are nonlinear; increased doses are associated with increased mean half-life and decreased clearance.
Clearance

Elimination may involve clearance of IgG through the reticuloendothelial system.

ToxicityAdministration of trastuzumab can result in ventricular dysfunction and congestive heart failure. Risk of cardiotocity is especially elevated in patients recieving concurrent anthracycline or cyclophosphamide therapy.
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Trastuzumab Action PathwayDrug actionSMP00476
SNP Mediated Effects
Interacting Gene/EnzymeSNP RS IDAllele nameDefining changeEffectReference(s)
Fibroblast growth factor receptor 4
Gene symbol: FGFR4
UniProt: P22455
rs351855 Not AvailableC AlleleReduced response to herceptin16822847
SNP Mediated Adverse Drug Reactions
Interacting Gene/EnzymeSNP RS IDAllele nameDefining changeAdverse ReactionReference(s)
Receptor tyrosine-protein kinase erbB-2
Gene symbol: ERBB2
UniProt: P04626
rs1801200 Not AvailableG Allele, heterozygoteCardiotoxicity17693647
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Kit
Powder for concentrate for solution for infusionIntravenous use150 mg
Powder for solutionintravenous440 mg
Solution for injectionSubcutaneous use600 mg system
Solution for injectionSubcutaneous use600 mg
Solution; kit; powder for solutionintravenous
Prices
Unit descriptionCostUnit
Herceptin 440 mg Solution Vial3581.2USD vial
Herceptin 440 mg vial3443.46USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2103059 No2005-03-222012-06-15Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.415Not Available
isoelectric point8.45Not Available
References
Synthesis ReferenceNot Available
General References
  1. Bange J, Zwick E, Ullrich A: Molecular targets for breast cancer therapy and prevention. Nat Med. 2001 May;7(5):548-52. [PubMed:11329054 ]
  2. Menard S, Pupa SM, Campiglio M, Tagliabue E: Biologic and therapeutic role of HER2 in cancer. Oncogene. 2003 Sep 29;22(42):6570-8. [PubMed:14528282 ]
  3. Kute T, Lack CM, Willingham M, Bishwokama B, Williams H, Barrett K, Mitchell T, Vaughn JP: Development of Herceptin resistance in breast cancer cells. Cytometry A. 2004 Feb;57(2):86-93. [PubMed:14750129 ]
  4. Albanell J, Codony J, Rovira A, Mellado B, Gascon P: Mechanism of action of anti-HER2 monoclonal antibodies: scientific update on trastuzumab and 2C4. Adv Exp Med Biol. 2003;532:253-68. [PubMed:12908564 ]
  5. Tan AR, Swain SM: Ongoing adjuvant trials with trastuzumab in breast cancer. Semin Oncol. 2003 Oct;30(5 Suppl 16):54-64. [PubMed:14613027 ]
  6. Nebija D, Kopelent-Frank H, Urban E, Noe CR, Lachmann B: Comparison of two-dimensional gel electrophoresis patterns and MALDI-TOF MS analysis of therapeutic recombinant monoclonal antibodies trastuzumab and rituximab. J Pharm Biomed Anal. 2011 Dec 5;56(4):684-91. doi: 10.1016/j.jpba.2011.07.006. Epub 2011 Jul 18. [PubMed:21813259 ]
External Links
ATC CodesL01XC03
AHFS CodesNot Available
PDB Entries
FDA labelDownload (41 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
2-(4-Chlorophenyl)-5-QuinoxalinecarboxamideTrastuzumab may increase the cardiotoxic activities of 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide.
2-MethoxyestradiolTrastuzumab may increase the cardiotoxic activities of 2-Methoxyestradiol.
2-MethoxyethanolTrastuzumab may increase the neutropenic activities of 2-Methoxyethanol.
3-MethoxybenzamideTrastuzumab may increase the cardiotoxic activities of 3-Methoxybenzamide.
3,4-Dihydroxybenzoic AcidTrastuzumab may increase the cardiotoxic activities of 3,4-Dihydroxybenzoic Acid.
5,10-Dideazatetrahydrofolic AcidTrastuzumab may increase the cardiotoxic activities of 5,10-Dideazatetrahydrofolic Acid.
7-HydroxystaurosporineTrastuzumab may increase the cardiotoxic activities of 7-Hydroxystaurosporine.
8-azaguanineTrastuzumab may increase the cardiotoxic activities of 8-azaguanine.
9-(2-phosphonylmethoxyethyl)-2,6-diaminopurineTrastuzumab may increase the neutropenic activities of 9-(2-phosphonylmethoxyethyl)-2,6-diaminopurine.
AbataceptTrastuzumab may increase the neutropenic activities of Abatacept.
abetimusTrastuzumab may increase the neutropenic activities of abetimus.
AbirateroneTrastuzumab may increase the cardiotoxic activities of Abiraterone.
ABR-215757Trastuzumab may increase the neutropenic activities of ABR-215757.
ABT-263Trastuzumab may increase the cardiotoxic activities of ABT-263.
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Trastuzumab.
AdalimumabTrastuzumab may increase the neutropenic activities of Adalimumab.
AfatinibTrastuzumab may increase the cardiotoxic activities of Afatinib.
AfelimomabTrastuzumab may increase the neutropenic activities of Afelimomab.
AfimoxifeneTrastuzumab may increase the cardiotoxic activities of Afimoxifene.
AfliberceptTrastuzumab may increase the cardiotoxic activities of Aflibercept.
AlatrofloxacinTrastuzumab may increase the cardiotoxic activities of Alatrofloxacin.
AlbendazoleTrastuzumab may increase the cardiotoxic activities of Albendazole.
AldesleukinTrastuzumab may increase the cardiotoxic activities of Aldesleukin.
AlefaceptTrastuzumab may increase the neutropenic activities of Alefacept.
AlemtuzumabTrastuzumab may increase the neutropenic activities of Alemtuzumab.
alicaforsenTrastuzumab may increase the neutropenic activities of alicaforsen.
AlitretinoinTrastuzumab may increase the cardiotoxic activities of Alitretinoin.
Alpha-DifluoromethylornithineTrastuzumab may increase the cardiotoxic activities of Alpha-Difluoromethylornithine.
AltretamineTrastuzumab may increase the neutropenic activities of Altretamine.
AminoglutethimideTrastuzumab may increase the cardiotoxic activities of Aminoglutethimide.
Aminolevulinic acidTrastuzumab may increase the cardiotoxic activities of Aminolevulinic acid.
AmonafideTrastuzumab may increase the cardiotoxic activities of Amonafide.
AmrubicinTrastuzumab may increase the cardiotoxic activities of Amrubicin.
AmsacrineTrastuzumab may increase the neutropenic activities of Amsacrine.
AnagrelideTrastuzumab may increase the cardiotoxic activities of Anagrelide.
AnakinraTrastuzumab may increase the neutropenic activities of Anakinra.
AnastrozoleTrastuzumab may increase the cardiotoxic activities of Anastrozole.
annamycinTrastuzumab may increase the cardiotoxic activities of annamycin.
Anti-thymocyte Globulin (Rabbit)Trastuzumab may increase the neutropenic activities of Anti-thymocyte Globulin (Rabbit).
AP 12009Trastuzumab may increase the cardiotoxic activities of AP 12009.
AP24534Trastuzumab may increase the cardiotoxic activities of AP24534.
ApremilastTrastuzumab may increase the neutropenic activities of Apremilast.
Arsenic trioxideTrastuzumab may increase the cardiotoxic activities of Arsenic trioxide.
ASA404Trastuzumab may increase the cardiotoxic activities of ASA404.
AsparaginaseTrastuzumab may increase the cardiotoxic activities of Asparaginase.
AT-101Trastuzumab may increase the cardiotoxic activities of AT-101.
AxitinibTrastuzumab may increase the cardiotoxic activities of Axitinib.
AzacitidineTrastuzumab may increase the neutropenic activities of Azacitidine.
AzathioprineTrastuzumab may increase the neutropenic activities of Azathioprine.
AZD2171Trastuzumab may increase the cardiotoxic activities of AZD2171.
Azelaic AcidTrastuzumab may increase the cardiotoxic activities of Azelaic Acid.
BasiliximabTrastuzumab may increase the neutropenic activities of Basiliximab.
BatimastatTrastuzumab may increase the cardiotoxic activities of Batimastat.
BelataceptTrastuzumab may increase the neutropenic activities of Belatacept.
BelimumabThe risk or severity of adverse effects can be increased when Trastuzumab is combined with Belimumab.
BelinostatTrastuzumab may increase the cardiotoxic activities of Belinostat.
BendamustineTrastuzumab may increase the cardiotoxic activities of Bendamustine.
BesifloxacinTrastuzumab may increase the cardiotoxic activities of Besifloxacin.
BetamethasoneTrastuzumab may increase the neutropenic activities of Betamethasone.
BevacizumabBevacizumab may increase the cardiotoxic activities of Trastuzumab.
BexaroteneTrastuzumab may increase the cardiotoxic activities of Bexarotene.
BicalutamideTrastuzumab may increase the cardiotoxic activities of Bicalutamide.
BleomycinTrastuzumab may increase the neutropenic activities of Bleomycin.
BlinatumomabTrastuzumab may increase the neutropenic activities of Blinatumomab.
BortezomibTrastuzumab may increase the cardiotoxic activities of Bortezomib.
BosutinibTrastuzumab may increase the cardiotoxic activities of Bosutinib.
Brentuximab vedotinTrastuzumab may increase the neutropenic activities of Brentuximab vedotin.
BriakinumabTrastuzumab may increase the neutropenic activities of Briakinumab.
BSI-201Trastuzumab may increase the cardiotoxic activities of BSI-201.
BudesonideTrastuzumab may increase the neutropenic activities of Budesonide.
BusulfanTrastuzumab may increase the neutropenic activities of Busulfan.
CabazitaxelTrastuzumab may increase the neutropenic activities of Cabazitaxel.
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Trastuzumab.
CabergolineTrastuzumab may increase the cardiotoxic activities of Cabergoline.
CabozantinibTrastuzumab may increase the cardiotoxic activities of Cabozantinib.
CalcipotriolTrastuzumab may increase the cardiotoxic activities of Calcipotriol.
CamptothecinTrastuzumab may increase the cardiotoxic activities of Camptothecin.
CanakinumabTrastuzumab may increase the neutropenic activities of Canakinumab.
CapecitabineTrastuzumab may increase the neutropenic activities of Capecitabine.
CarboplatinTrastuzumab may increase the neutropenic activities of Carboplatin.
CarfilzomibTrastuzumab may increase the cardiotoxic activities of Carfilzomib.
CarmofurTrastuzumab may increase the cardiotoxic activities of Carmofur.
CarmustineTrastuzumab may increase the neutropenic activities of Carmustine.
CastanospermineTrastuzumab may increase the neutropenic activities of Castanospermine.
CatumaxomabTrastuzumab may increase the cardiotoxic activities of Catumaxomab.
CB1954Trastuzumab may increase the cardiotoxic activities of CB1954.
CelecoxibTrastuzumab may increase the cardiotoxic activities of Celecoxib.
CeritinibTrastuzumab may increase the cardiotoxic activities of Ceritinib.
Certolizumab pegolTrastuzumab may increase the neutropenic activities of Certolizumab pegol.
CetuximabTrastuzumab may increase the cardiotoxic activities of Cetuximab.
ChlorambucilTrastuzumab may increase the neutropenic activities of Chlorambucil.
ChlorotrianiseneTrastuzumab may increase the cardiotoxic activities of Chlorotrianisene.
CinoxacinTrastuzumab may increase the cardiotoxic activities of Cinoxacin.
CiprofloxacinTrastuzumab may increase the cardiotoxic activities of Ciprofloxacin.
CisplatinTrastuzumab may increase the neutropenic activities of Cisplatin.
CladribineTrastuzumab may increase the neutropenic activities of Cladribine.
ClofarabineTrastuzumab may increase the neutropenic activities of Clofarabine.
ColchicineTrastuzumab may increase the cardiotoxic activities of Colchicine.
CorticotropinTrastuzumab may increase the neutropenic activities of Corticotropin.
Cortisone acetateTrastuzumab may increase the neutropenic activities of Cortisone acetate.
CrizotinibTrastuzumab may increase the cardiotoxic activities of Crizotinib.
CyclophosphamideTrastuzumab may increase the neutropenic activities of Cyclophosphamide.
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Trastuzumab.
CyclosporineTrastuzumab may increase the neutropenic activities of Cyclosporine.
Cyproterone acetateTrastuzumab may increase the cardiotoxic activities of Cyproterone acetate.
CytarabineTrastuzumab may increase the neutropenic activities of Cytarabine.
DabrafenibTrastuzumab may increase the cardiotoxic activities of Dabrafenib.
DacarbazineTrastuzumab may increase the neutropenic activities of Dacarbazine.
DaclizumabTrastuzumab may increase the neutropenic activities of Daclizumab.
DactinomycinTrastuzumab may increase the neutropenic activities of Dactinomycin.
DaratumumabTrastuzumab may increase the cardiotoxic activities of Daratumumab.
DasatinibTrastuzumab may increase the neutropenic activities of Dasatinib.
DaunorubicinTrastuzumab may increase the neutropenic activities of Daunorubicin.
DecitabineTrastuzumab may increase the cardiotoxic activities of Decitabine.
Denileukin diftitoxTrastuzumab may increase the cardiotoxic activities of Denileukin diftitox.
DeslanosideDeslanoside may decrease the cardiotoxic activities of Trastuzumab.
DexamethasoneTrastuzumab may increase the neutropenic activities of Dexamethasone.
DexrazoxaneTrastuzumab may increase the cardiotoxic activities of Dexrazoxane.
DienogestTrastuzumab may increase the cardiotoxic activities of Dienogest.
DiethylstilbestrolTrastuzumab may increase the cardiotoxic activities of Diethylstilbestrol.
DigitoxinDigitoxin may decrease the cardiotoxic activities of Trastuzumab.
DigoxinDigoxin may decrease the cardiotoxic activities of Trastuzumab.
Dimethyl fumarateTrastuzumab may increase the neutropenic activities of Dimethyl fumarate.
DinutuximabTrastuzumab may increase the neutropenic activities of Dinutuximab.
DocetaxelTrastuzumab may increase the neutropenic activities of Docetaxel.
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Trastuzumab.
DoxorubicinTrastuzumab may increase the neutropenic activities of Doxorubicin.
EcabetTrastuzumab may increase the cardiotoxic activities of Ecabet.
EculizumabTrastuzumab may increase the neutropenic activities of Eculizumab.
EfalizumabTrastuzumab may increase the neutropenic activities of Efalizumab.
efaproxiralTrastuzumab may increase the cardiotoxic activities of efaproxiral.
EflornithineTrastuzumab may increase the cardiotoxic activities of Eflornithine.
EG009Trastuzumab may increase the cardiotoxic activities of EG009.
ElsamitrucinTrastuzumab may increase the cardiotoxic activities of Elsamitrucin.
EndostatinTrastuzumab may increase the cardiotoxic activities of Endostatin.
EnoxacinTrastuzumab may increase the cardiotoxic activities of Enoxacin.
EnrofloxacinTrastuzumab may increase the cardiotoxic activities of Enrofloxacin.
EpirubicinTrastuzumab may increase the neutropenic activities of Epirubicin.
Epothilone BTrastuzumab may increase the cardiotoxic activities of Epothilone B.
EribulinTrastuzumab may increase the cardiotoxic activities of Eribulin.
ErlotinibTrastuzumab may increase the cardiotoxic activities of Erlotinib.
EstramustineTrastuzumab may increase the neutropenic activities of Estramustine.
EtanerceptTrastuzumab may increase the neutropenic activities of Etanercept.
Ethiodized oilTrastuzumab may increase the cardiotoxic activities of Ethiodized oil.
Ethyl carbamateTrastuzumab may increase the cardiotoxic activities of Ethyl carbamate.
EtoposideTrastuzumab may increase the neutropenic activities of Etoposide.
EverolimusTrastuzumab may increase the neutropenic activities of Everolimus.
ExemestaneTrastuzumab may increase the cardiotoxic activities of Exemestane.
exisulindTrastuzumab may increase the cardiotoxic activities of exisulind.
FenretinideTrastuzumab may increase the cardiotoxic activities of Fenretinide.
FingolimodTrastuzumab may increase the neutropenic activities of Fingolimod.
FlavopiridolTrastuzumab may increase the cardiotoxic activities of Flavopiridol.
FleroxacinTrastuzumab may increase the cardiotoxic activities of Fleroxacin.
FloxuridineTrastuzumab may increase the neutropenic activities of Floxuridine.
FludarabineTrastuzumab may increase the neutropenic activities of Fludarabine.
FludrocortisoneTrastuzumab may increase the neutropenic activities of Fludrocortisone.
FlumequineTrastuzumab may increase the cardiotoxic activities of Flumequine.
FluorouracilTrastuzumab may increase the neutropenic activities of Fluorouracil.
FlutamideTrastuzumab may increase the cardiotoxic activities of Flutamide.
FormestaneTrastuzumab may increase the cardiotoxic activities of Formestane.
FormycinTrastuzumab may increase the cardiotoxic activities of Formycin.
FotemustineTrastuzumab may increase the cardiotoxic activities of Fotemustine.
FulvestrantTrastuzumab may increase the cardiotoxic activities of Fulvestrant.
FumagillinTrastuzumab may increase the cardiotoxic activities of Fumagillin.
Gallium nitrateTrastuzumab may increase the neutropenic activities of Gallium nitrate.
GarenoxacinTrastuzumab may increase the cardiotoxic activities of Garenoxacin.
GatifloxacinTrastuzumab may increase the cardiotoxic activities of Gatifloxacin.
GefitinibTrastuzumab may increase the cardiotoxic activities of Gefitinib.
GeldanamycinTrastuzumab may increase the cardiotoxic activities of Geldanamycin.
GemcitabineTrastuzumab may increase the neutropenic activities of Gemcitabine.
GemifloxacinTrastuzumab may increase the cardiotoxic activities of Gemifloxacin.
Gemtuzumab ozogamicinTrastuzumab may increase the neutropenic activities of Gemtuzumab ozogamicin.
GenisteinTrastuzumab may increase the cardiotoxic activities of Genistein.
Ginsenoside CTrastuzumab may increase the cardiotoxic activities of Ginsenoside C.
Glatiramer AcetateTrastuzumab may increase the neutropenic activities of Glatiramer Acetate.
GlimepirideTrastuzumab may increase the neutropenic activities of Glimepiride.
GolimumabTrastuzumab may increase the neutropenic activities of Golimumab.
GoserelinTrastuzumab may increase the cardiotoxic activities of Goserelin.
GrepafloxacinTrastuzumab may increase the cardiotoxic activities of Grepafloxacin.
HadacidinTrastuzumab may increase the cardiotoxic activities of Hadacidin.
HalofuginoneTrastuzumab may increase the cardiotoxic activities of Halofuginone.
HexestrolTrastuzumab may increase the cardiotoxic activities of Hexestrol.
HydrocortisoneTrastuzumab may increase the neutropenic activities of Hydrocortisone.
Hydroxyprogesterone caproateTrastuzumab may increase the cardiotoxic activities of Hydroxyprogesterone caproate.
HydroxyureaTrastuzumab may increase the neutropenic activities of Hydroxyurea.
Ibritumomab tiuxetanTrastuzumab may increase the neutropenic activities of Ibritumomab tiuxetan.
IbrutinibTrastuzumab may increase the neutropenic activities of Ibrutinib.
IcatibantTrastuzumab may increase the neutropenic activities of Icatibant.
IdarubicinTrastuzumab may increase the neutropenic activities of Idarubicin.
IdelalisibTrastuzumab may increase the neutropenic activities of Idelalisib.
IfosfamideTrastuzumab may increase the neutropenic activities of Ifosfamide.
ImatinibTrastuzumab may increase the neutropenic activities of Imatinib.
ImiquimodTrastuzumab may increase the neutropenic activities of Imiquimod.
InfliximabTrastuzumab may increase the neutropenic activities of Infliximab.
Interferon beta-1aTrastuzumab may increase the cardiotoxic activities of Interferon beta-1a.
IobenguaneTrastuzumab may increase the cardiotoxic activities of Iobenguane.
IpilimumabTrastuzumab may increase the cardiotoxic activities of Ipilimumab.
IrinotecanTrastuzumab may increase the neutropenic activities of Irinotecan.
IxabepiloneTrastuzumab may increase the cardiotoxic activities of Ixabepilone.
IxazomibTrastuzumab may increase the cardiotoxic activities of Ixazomib.
KOS-1584Trastuzumab may increase the cardiotoxic activities of KOS-1584.
L-alanosineTrastuzumab may increase the cardiotoxic activities of L-alanosine.
L-PhenylalanineTrastuzumab may increase the neutropenic activities of L-Phenylalanine.
LanreotideTrastuzumab may increase the cardiotoxic activities of Lanreotide.
LapatinibTrastuzumab may increase the cardiotoxic activities of Lapatinib.
LeflunomideTrastuzumab may increase the neutropenic activities of Leflunomide.
LenalidomideTrastuzumab may increase the neutropenic activities of Lenalidomide.
LenvatinibTrastuzumab may increase the cardiotoxic activities of Lenvatinib.
LetrozoleTrastuzumab may increase the cardiotoxic activities of Letrozole.
LeuprolideTrastuzumab may increase the cardiotoxic activities of Leuprolide.
LevofloxacinTrastuzumab may increase the cardiotoxic activities of Levofloxacin.
LomefloxacinTrastuzumab may increase the cardiotoxic activities of Lomefloxacin.
LomustineTrastuzumab may increase the neutropenic activities of Lomustine.
LonidamineTrastuzumab may increase the cardiotoxic activities of Lonidamine.
LycopeneTrastuzumab may increase the cardiotoxic activities of Lycopene.
MasitinibTrastuzumab may increase the cardiotoxic activities of Masitinib.
MasoprocolTrastuzumab may increase the cardiotoxic activities of Masoprocol.
MaxacalcitolTrastuzumab may increase the cardiotoxic activities of Maxacalcitol.
MDX-1106Trastuzumab may increase the cardiotoxic activities of MDX-1106.
MebendazoleTrastuzumab may increase the cardiotoxic activities of Mebendazole.
MechlorethamineTrastuzumab may increase the neutropenic activities of Mechlorethamine.
MedrogestoneTrastuzumab may increase the cardiotoxic activities of Medrogestone.
Medroxyprogesterone acetateTrastuzumab may increase the cardiotoxic activities of Medroxyprogesterone acetate.
Megestrol acetateTrastuzumab may increase the cardiotoxic activities of Megestrol acetate.
MelphalanTrastuzumab may increase the neutropenic activities of Melphalan.
MepolizumabTrastuzumab may increase the neutropenic activities of Mepolizumab.
MequinolTrastuzumab may increase the cardiotoxic activities of Mequinol.
MercaptopurineTrastuzumab may increase the neutropenic activities of Mercaptopurine.
MethotrexateTrastuzumab may increase the neutropenic activities of Methotrexate.
Methyl aminolevulinateTrastuzumab may increase the cardiotoxic activities of Methyl aminolevulinate.
MethylprednisoloneTrastuzumab may increase the neutropenic activities of Methylprednisolone.
MethyltestosteroneTrastuzumab may increase the cardiotoxic activities of Methyltestosterone.
MGI-114Trastuzumab may increase the cardiotoxic activities of MGI-114.
MidostaurinTrastuzumab may increase the cardiotoxic activities of Midostaurin.
MiltefosineTrastuzumab may increase the cardiotoxic activities of Miltefosine.
MitomycinTrastuzumab may increase the neutropenic activities of Mitomycin.
MitotaneTrastuzumab may increase the cardiotoxic activities of Mitotane.
MitoxantroneTrastuzumab may increase the neutropenic activities of Mitoxantrone.
motexafin gadoliniumTrastuzumab may increase the cardiotoxic activities of motexafin gadolinium.
MoxifloxacinTrastuzumab may increase the cardiotoxic activities of Moxifloxacin.
MuromonabTrastuzumab may increase the neutropenic activities of Muromonab.
Mycophenolate mofetilTrastuzumab may increase the neutropenic activities of Mycophenolate mofetil.
Mycophenolic acidTrastuzumab may increase the neutropenic activities of Mycophenolic acid.
Nalidixic AcidTrastuzumab may increase the cardiotoxic activities of Nalidixic Acid.
NatalizumabTrastuzumab may increase the neutropenic activities of Natalizumab.
NecitumumabTrastuzumab may increase the cardiotoxic activities of Necitumumab.
NelarabineTrastuzumab may increase the neutropenic activities of Nelarabine.
NiguldipineTrastuzumab may increase the cardiotoxic activities of Niguldipine.
NilotinibTrastuzumab may increase the neutropenic activities of Nilotinib.
NilutamideTrastuzumab may increase the cardiotoxic activities of Nilutamide.
NintedanibTrastuzumab may increase the cardiotoxic activities of Nintedanib.
NivolumabTrastuzumab may increase the cardiotoxic activities of Nivolumab.
nocodazoleTrastuzumab may increase the cardiotoxic activities of nocodazole.
NorfloxacinTrastuzumab may increase the cardiotoxic activities of Norfloxacin.
ObinutuzumabTrastuzumab may increase the neutropenic activities of Obinutuzumab.
OctreotideTrastuzumab may increase the cardiotoxic activities of Octreotide.
OfatumumabTrastuzumab may increase the cardiotoxic activities of Ofatumumab.
OfloxacinTrastuzumab may increase the cardiotoxic activities of Ofloxacin.
OlaparibTrastuzumab may increase the cardiotoxic activities of Olaparib.
Omacetaxine mepesuccinateTrastuzumab may increase the cardiotoxic activities of Omacetaxine mepesuccinate.
OprelvekinTrastuzumab may increase the cardiotoxic activities of Oprelvekin.
OsimertinibTrastuzumab may increase the cardiotoxic activities of Osimertinib.
OuabainOuabain may decrease the cardiotoxic activities of Trastuzumab.
OxaliplatinTrastuzumab may increase the neutropenic activities of Oxaliplatin.
PaclitaxelThe serum concentration of Paclitaxel can be decreased when it is combined with Trastuzumab.
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Trastuzumab.
PalbociclibTrastuzumab may increase the neutropenic activities of Palbociclib.
PalifosfamideTrastuzumab may increase the cardiotoxic activities of Palifosfamide.
PamidronateTrastuzumab may increase the cardiotoxic activities of Pamidronate.
PanitumumabTrastuzumab may increase the cardiotoxic activities of Panitumumab.
PanobinostatTrastuzumab may increase the neutropenic activities of Panobinostat.
PazopanibTrastuzumab may increase the neutropenic activities of Pazopanib.
PefloxacinTrastuzumab may increase the cardiotoxic activities of Pefloxacin.
PegaspargaseTrastuzumab may increase the neutropenic activities of Pegaspargase.
PembrolizumabTrastuzumab may increase the cardiotoxic activities of Pembrolizumab.
PemetrexedTrastuzumab may increase the neutropenic activities of Pemetrexed.
PentostatinTrastuzumab may increase the neutropenic activities of Pentostatin.
PertuzumabTrastuzumab may increase the cardiotoxic activities of Pertuzumab.
Phenylacetic acidTrastuzumab may increase the cardiotoxic activities of Phenylacetic acid.
PimecrolimusTrastuzumab may increase the neutropenic activities of Pimecrolimus.
PipobromanTrastuzumab may increase the cardiotoxic activities of Pipobroman.
PirfenidoneTrastuzumab may increase the neutropenic activities of Pirfenidone.
PirlindoleTrastuzumab may increase the cardiotoxic activities of Pirlindole.
PixantroneTrastuzumab may increase the cardiotoxic activities of Pixantrone.
PlicamycinTrastuzumab may increase the cardiotoxic activities of Plicamycin.
PodofiloxTrastuzumab may increase the cardiotoxic activities of Podofilox.
PodophyllinTrastuzumab may increase the cardiotoxic activities of Podophyllin.
polyacrylic acidTrastuzumab may increase the cardiotoxic activities of polyacrylic acid.
PomalidomideTrastuzumab may increase the neutropenic activities of Pomalidomide.
PonatinibTrastuzumab may increase the cardiotoxic activities of Ponatinib.
PorfimerTrastuzumab may increase the cardiotoxic activities of Porfimer.
porfiromycinTrastuzumab may increase the cardiotoxic activities of porfiromycin.
PralatrexateTrastuzumab may increase the neutropenic activities of Pralatrexate.
PrednisoloneTrastuzumab may increase the neutropenic activities of Prednisolone.
PrednisoneTrastuzumab may increase the neutropenic activities of Prednisone.
ProcarbazineTrastuzumab may increase the neutropenic activities of Procarbazine.
Purine RibosideTrastuzumab may increase the cardiotoxic activities of Purine Riboside.
PuromycinTrastuzumab may increase the cardiotoxic activities of Puromycin.
QuinacrineTrastuzumab may increase the cardiotoxic activities of Quinacrine.
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Trastuzumab.
Radium Ra 223 DichlorideTrastuzumab may increase the cardiotoxic activities of Radium Ra 223 Dichloride.
RaltitrexedTrastuzumab may increase the cardiotoxic activities of Raltitrexed.
RamucirumabTrastuzumab may increase the cardiotoxic activities of Ramucirumab.
RanibizumabTrastuzumab may increase the cardiotoxic activities of Ranibizumab.
RanpirnaseTrastuzumab may increase the cardiotoxic activities of Ranpirnase.
RegorafenibTrastuzumab may increase the cardiotoxic activities of Regorafenib.
ResveratrolTrastuzumab may increase the cardiotoxic activities of Resveratrol.
Rhodamine 6GTrastuzumab may increase the cardiotoxic activities of Rhodamine 6G.
RilonaceptTrastuzumab may increase the neutropenic activities of Rilonacept.
RituximabTrastuzumab may increase the neutropenic activities of Rituximab.
RomidepsinTrastuzumab may increase the cardiotoxic activities of Romidepsin.
RomiplostimTrastuzumab may increase the cardiotoxic activities of Romiplostim.
RoquinimexTrastuzumab may increase the cardiotoxic activities of Roquinimex.
RubitecanTrastuzumab may increase the cardiotoxic activities of Rubitecan.
RuxolitinibTrastuzumab may increase the neutropenic activities of Ruxolitinib.
SatraplatinTrastuzumab may increase the cardiotoxic activities of Satraplatin.
SecukinumabTrastuzumab may increase the neutropenic activities of Secukinumab.
SeliciclibTrastuzumab may increase the cardiotoxic activities of Seliciclib.
SemaxanibTrastuzumab may increase the cardiotoxic activities of Semaxanib.
SeocalcitolTrastuzumab may increase the neutropenic activities of Seocalcitol.
SiltuximabTrastuzumab may increase the neutropenic activities of Siltuximab.
SirolimusTrastuzumab may increase the neutropenic activities of Sirolimus.
SonidegibTrastuzumab may increase the cardiotoxic activities of Sonidegib.
SorafenibTrastuzumab may increase the neutropenic activities of Sorafenib.
SparfloxacinTrastuzumab may increase the cardiotoxic activities of Sparfloxacin.
Sparfosic acidTrastuzumab may increase the cardiotoxic activities of Sparfosic acid.
SparsomycinTrastuzumab may increase the cardiotoxic activities of Sparsomycin.
squalamineTrastuzumab may increase the cardiotoxic activities of squalamine.
SRT501Trastuzumab may increase the cardiotoxic activities of SRT501.
SteproninTrastuzumab may increase the neutropenic activities of Stepronin.
StreptozocinTrastuzumab may increase the neutropenic activities of Streptozocin.
SulindacTrastuzumab may increase the cardiotoxic activities of Sulindac.
SunitinibTrastuzumab may increase the neutropenic activities of Sunitinib.
SuraminTrastuzumab may increase the cardiotoxic activities of Suramin.
SwainsonineTrastuzumab may increase the cardiotoxic activities of Swainsonine.
TacrolimusTrastuzumab may increase the neutropenic activities of Tacrolimus.
TamoxifenTrastuzumab may increase the cardiotoxic activities of Tamoxifen.
TegafurTrastuzumab may increase the cardiotoxic activities of Tegafur.
TemafloxacinTrastuzumab may increase the cardiotoxic activities of Temafloxacin.
TemozolomideTrastuzumab may increase the neutropenic activities of Temozolomide.
TemsirolimusTrastuzumab may increase the neutropenic activities of Temsirolimus.
TeniposideTrastuzumab may increase the neutropenic activities of Teniposide.
TepoxalinTrastuzumab may increase the neutropenic activities of Tepoxalin.
TeriflunomideTrastuzumab may increase the neutropenic activities of Teriflunomide.
TestolactoneTrastuzumab may increase the cardiotoxic activities of Testolactone.
TetrathiomolybdateTrastuzumab may increase the cardiotoxic activities of Tetrathiomolybdate.
TezacitabineTrastuzumab may increase the cardiotoxic activities of Tezacitabine.
ThalidomideTrastuzumab may increase the neutropenic activities of Thalidomide.
ThiotepaTrastuzumab may increase the neutropenic activities of Thiotepa.
ThymalfasinTrastuzumab may increase the cardiotoxic activities of Thymalfasin.
TiboloneTrastuzumab may increase the cardiotoxic activities of Tibolone.
TioguanineTrastuzumab may increase the neutropenic activities of Tioguanine.
TipifarnibTrastuzumab may increase the cardiotoxic activities of Tipifarnib.
TirapazamineTrastuzumab may increase the cardiotoxic activities of Tirapazamine.
TocilizumabTrastuzumab may increase the neutropenic activities of Tocilizumab.
TofacitinibTrastuzumab may increase the neutropenic activities of Tofacitinib.
TopotecanTrastuzumab may increase the neutropenic activities of Topotecan.
ToremifeneTrastuzumab may increase the cardiotoxic activities of Toremifene.
TositumomabTrastuzumab may increase the neutropenic activities of Tositumomab.
TrabectedinTrastuzumab may increase the neutropenic activities of Trabectedin.
TrametinibTrastuzumab may increase the cardiotoxic activities of Trametinib.
Trastuzumab emtansineTrastuzumab may increase the neutropenic activities of Trastuzumab emtansine.
TretinoinTrastuzumab may increase the neutropenic activities of Tretinoin.
TriamcinoloneTrastuzumab may increase the neutropenic activities of Triamcinolone.
TrifluridineTrastuzumab may increase the cardiotoxic activities of Trifluridine.
TrilostaneTrastuzumab may increase the cardiotoxic activities of Trilostane.
TrimetrexateTrastuzumab may increase the cardiotoxic activities of Trimetrexate.
TriptorelinTrastuzumab may increase the cardiotoxic activities of Triptorelin.
TrovafloxacinTrastuzumab may increase the cardiotoxic activities of Trovafloxacin.
TroxacitabineTrastuzumab may increase the cardiotoxic activities of Troxacitabine.
TTNPBTrastuzumab may increase the cardiotoxic activities of TTNPB.
TubercidinTrastuzumab may increase the cardiotoxic activities of Tubercidin.
UbenimexTrastuzumab may increase the cardiotoxic activities of Ubenimex.
Uracil mustardTrastuzumab may increase the cardiotoxic activities of Uracil mustard.
UstekinumabTrastuzumab may increase the neutropenic activities of Ustekinumab.
ValrubicinTrastuzumab may increase the cardiotoxic activities of Valrubicin.
VandetanibTrastuzumab may increase the cardiotoxic activities of Vandetanib.
VapreotideTrastuzumab may increase the cardiotoxic activities of Vapreotide.
VedolizumabTrastuzumab may increase the neutropenic activities of Vedolizumab.
VeliparibTrastuzumab may increase the cardiotoxic activities of Veliparib.
VemurafenibTrastuzumab may increase the cardiotoxic activities of Vemurafenib.
VerteporfinTrastuzumab may increase the cardiotoxic activities of Verteporfin.
VilanterolTrastuzumab may increase the neutropenic activities of Vilanterol.
VinblastineTrastuzumab may increase the neutropenic activities of Vinblastine.
VincristineTrastuzumab may increase the neutropenic activities of Vincristine.
VindesineTrastuzumab may increase the neutropenic activities of Vindesine.
VinorelbineTrastuzumab may increase the neutropenic activities of Vinorelbine.
VismodegibTrastuzumab may increase the cardiotoxic activities of Vismodegib.
Vitamin ATrastuzumab may increase the cardiotoxic activities of Vitamin A.
VorinostatTrastuzumab may increase the cardiotoxic activities of Vorinostat.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Transmembrane signaling receptor activity
Specific Function:
Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-...
Gene Name:
ERBB2
Uniprot ID:
P04626
Molecular Weight:
137909.27 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Leveque D, Gigou L, Bergerat JP: Clinical pharmacology of trastuzumab. Curr Clin Pharmacol. 2008 Jan;3(1):51-5. [PubMed:18690878 ]
  3. Lin A, Rugo HS: The role of trastuzumab in early stage breast cancer: current data and treatment recommendations. Curr Treat Options Oncol. 2007 Feb;8(1):47-60. [PubMed:17660958 ]
  4. Treish I, Schwartz R, Lindley C: Pharmacology and therapeutic use of trastuzumab in breast cancer. Am J Health Syst Pharm. 2000 Nov 15;57(22):2063-76; quiz 2077-9. [PubMed:11098307 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Ubiquitin protein ligase binding
Specific Function:
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on ke...
Gene Name:
EGFR
Uniprot ID:
P00533
Molecular Weight:
134276.185 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Curnow RT: Clinical experience with CD64-directed immunotherapy. An overview. Cancer Immunol Immunother. 1997 Nov-Dec;45(3-4):210-5. [PubMed:9435876 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Bowles JA, Weiner GJ: CD16 polymorphisms and NK activation induced by monoclonal antibody-coated target cells. J Immunol Methods. 2005 Sep;304(1-2):88-99. [PubMed:16109421 ]
  2. Shahied LS, Tang Y, Alpaugh RK, Somer R, Greenspon D, Weiner LM: Bispecific minibodies targeting HER2/neu and CD16 exhibit improved tumor lysis when placed in a divalent tumor antigen binding format. J Biol Chem. 2004 Dec 24;279(52):53907-14. Epub 2004 Oct 7. [PubMed:15471859 ]
  3. Kubo M, Morisaki T, Kuroki H, Tasaki A, Yamanaka N, Matsumoto K, Nakamura K, Onishi H, Baba E, Katano M: Combination of adoptive immunotherapy with Herceptin for patients with HER2-expressing breast cancer. Anticancer Res. 2003 Nov-Dec;23(6a):4443-9. [PubMed:14666732 ]
  4. Yamaguchi Y, Hironaka K, Okawaki M, Okita R, Matsuura K, Ohshita A, Toge T: HER2-specific cytotoxic activity of lymphokine-activated killer cells in the presence of trastuzumab. Anticancer Res. 2005 Mar-Apr;25(2A):827-32. [PubMed:15868915 ]
  5. Xie Z, Guo N, Yu M, Hu M, Shen B: A new format of bispecific antibody: highly efficient heterodimerization, expression and tumor cell lysis. J Immunol Methods. 2005 Jan;296(1-2):95-101. Epub 2004 Nov 19. [PubMed:15680154 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Suzuki E, Niwa R, Saji S, Muta M, Hirose M, Iida S, Shiotsu Y, Satoh M, Shitara K, Kondo M, Toi M: A nonfucosylated anti-HER2 antibody augments antibody-dependent cellular cytotoxicity in breast cancer patients. Clin Cancer Res. 2007 Mar 15;13(6):1875-82. [PubMed:17363544 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inhibitor
General Function:
Oxygen binding
Specific Function:
Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
Gene Name:
CYP19A1
Uniprot ID:
P11511
Molecular Weight:
57882.48 Da
References
  1. Preissner S, Kroll K, Dunkel M, Senger C, Goldsobel G, Kuzman D, Guenther S, Winnenburg R, Schroeder M, Preissner R: SuperCYP: a comprehensive database on Cytochrome P450 enzymes including a tool for analysis of CYP-drug interactions. Nucleic Acids Res. 2010 Jan;38(Database issue):D237-43. doi: 10.1093/nar/gkp970. Epub 2009 Nov 24. [PubMed:19934256 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23