| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-06-23 18:06:47 |
| Primary Accession Number |
DB00916 |
| Secondary Accession Number |
|
| Name |
Metronidazole |
| Drug Type |
|
| Description |
A nitroimidazole used to treat amebiasis; vaginitis; trichomonas infections; giardiasis; anaerobic bacteria; and treponemal infections. It has also been proposed as a radiation sensitizer for hypoxic cells. According to the Fourth Annual Report on Carcinogens (NTP 85-002, 1985, p133), this substance may reasonably be anticipated to be a carcinogen (Merck, 11th ed). |
| Synonyms |
- Methronidazole
- Metronidazol
- Metronidazole Benzoate
- Metronidazole Hcl
- Metronidazole in Plastic Container
- Metronidazolo
|
| Brand Names |
- Acromona
- Anagiardil
- Apo-Metronidazole
- Arilin
- Atrivyl
- Bayer 5360
- Bexon
- Clont
- Cont
- Danizol
- Deflamon
- Deflamon-Wirkstoff
- Efloran
- Elyzol
- Entizol
- Eumin
- Flagemona
- Flagesol
- Flagil
- Flagyl
- Flagyl ER
- Flagyl I.V.
- Flegyl
- Fossyol
- Giatricol
- Gineflavir
- Klion
- Klont
- Meronidal
- Metric 21
- Metro Cream
- Metro I.V.
- Metro I.V. In Plastic Container
- Metrocream
- Metrogel
- Metrogel-Vaginal
- Metrolag
- Metrolotion
- Metrolyl
- Metromidol
- Metronidaz
- Metrotop
- Mexibol
- Monagyl
- Monasin
- Nalox
- Neo-Tric
- Nida
- Nidagel
- Noritate
- Novonidazol
- Orvagil
- Protostat
- Rathimed
- Sanatrichom
- Satric
- Takimetol
- Trichazol
- Trichex
- Tricho Cordes
- Tricho-Gynaedron
- Trichocide
- Trichomol
- Trichopal
- Trichopol
- Tricocet
- Tricom
- Tricowas B
- Trikacide
- Trikamon
- Trikojol
- Trikozol
- Trimeks
- Trivazol
- Vagilen
- Vagimid
- Vertisal
- Wagitran
- Zadstat
|
| Brand Mixtures |
- Helidac (Metronidazole + Bismuth subsalicylate + tetracycline hydrochloride)
|
| Chemical IUPAC Name |
2-(2-methyl-5-nitroimidazol-1-yl)ethanol |
| Chemical Formula |
C6H9N3O3 |
| Chemical Structure |
 |
| CAS Registry Number |
443-48-1 |
| InChI Identifier |
InChI=1/C6H9N3O3/c1-5-7-4-6(9(11)12)8(5)2-3-10/h4,10H,2-3H2,1H3 |
| InChI Key |
VAOCPAMSLUNLGC-UHFFFAOYAG |
| KEGG Drug |
D00409  |
| KEGG Compound |
Not Available |
| PubChem Compound |
4173  |
| PubChem Substance |
7847475  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
Not Available |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
00649074  |
| RxList Link |
http://www.rxlist.com/cgi/generic/metron.htm  |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Metronidazole  |
| FDA Label |
|
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Jacob et al., U.S. Pat. 2,944,061 (1960) |
| Average Molecular Weight |
171.1540 |
| Monoisotopic Molecular Weight |
171.0644 |
| State |
Solid |
| Melting Point |
160 oC |
| Experimental Water Solubility |
<0.1g/100mL
Source: PhysProp
|
| Predicted Water Solubility |
5.92e+00 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
-0.1
Source: PhysProp
|
| Predicted LogP |
-0.15
Calculated using ALOGPS
|
| Experimental LogS |
-1.26 [ADME Research, USCD] |
| Predicted LogS |
-1.46
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
CC1=NC=C(N1CCO)[N+]([O-])=O |
| Canonical SMILES |
CC1=NC=C(N1CCO)[N+]([O-])=O |
| Drug Category |
- Anti-Infective Agents
- Anti-Infectives
- Antiprotozoal Agents
- Antiprotozoals
- Radiation-Sensitizing Agents
|
| ATC Codes |
|
| AHFS Codes |
- 08:30.92
- 84:04.04
- 84:04.92
|
| Indication |
Treatment of acute acne rosacea |
| Pharmacology |
Metronidazole, a synthetic antibacterial and antiprotozoal agent of the nitroimidazole class, is used against protozoa such as Trichomonas vaginalis, amebiasis, and giardiasis. Metronidazole is extremely effective against anaerobic bacterial infections and is also used to treat Crohn's disease, antibiotic-associated diarrhea, and rosacea. |
| Mechanism of Action |
Unionized metronidazole is selective for anaerobic bacteria due to their ability to intracellularly reduce metronidazole to its active form. This reduced metronidazole then disrupts DNA's helical structure, inhibiting bacterial nucleic acid synthesis and resulting in bacterial cell death. |
| Absorption |
Well absorbed |
| Toxicity |
Convulsive seizures and peripheral neuropathy, the latter characterized mainly by numbness or paresthesia of an extremity, LD50=500 mg/kg/day (orally in rat) |
| Protein Binding |
Less than 20% |
| Biotransformation |
Hepatic |
| Half Life |
8 hours |
| Dosage Forms |
| Form |
Route |
| Capsule |
Oral |
| Cream |
Intravaginal |
| Cream |
Topical |
| Gel |
Intravaginal |
| Gel |
Topical |
| Liquid |
Intravenous |
| Lotion |
Topical |
| Solution |
Intravenous |
| Tablet |
Oral |
| Tablet, extended release |
Oral |
|
| Patient Information |
Show  |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
| Drug |
Interaction |
| Acenocoumarol |
Metronidazole increases the anticoagulant effect |
| Amobarbital |
The barbiturate decreases the effect of metronidazole |
| Amprenavir |
Increased risk of side effects (oral solution) |
| Anisindione |
Metronidazole increases the anticoagulant effect |
| Aprobarbital |
The barbiturate decreases the effect of metronidazole |
| Busulfan |
Metronidazole increases the effect/toxicity of busulfan |
| Butabarbital |
The barbiturate decreases the effect of metronidazole |
| Butalbital |
The barbiturate decreases the effect of metronidazole |
| Butethal |
The barbiturate decreases the effect of metronidazole |
| Carbamazepine |
Metronidazole increases the effect of carbamazepine |
| Dicumarol |
Metronidazole increases the anticoagulant effect |
| Dihydroquinidine barbiturate |
The barbiturate decreases the effect of metronidazole |
| Disulfiram |
Possible acute psychosis and confusion |
| Fluorouracil |
Risk of 5-FU toxicity when associated with metronidazole |
| Heptabarbital |
The barbiturate decreases the effect of metronidazole |
| Hexobarbital |
The barbiturate decreases the effect of metronidazole |
| Lithium |
Metronidazole increases the effect and toxicity of lithium |
| Methohexital |
The barbiturate decreases the effect of metronidazole |
| Methylphenobarbital |
The barbiturate decreases the effect of metronidazole |
| Pentobarbital |
The barbiturate decreases the effect of metronidazole |
| Phenobarbital |
The barbiturate decreases the effect of metronidazole |
| Primidone |
The barbiturate decreases the effect of metronidazole |
| Quinidine barbiturate |
The barbiturate decreases the effect of metronidazole |
| Secobarbital |
The barbiturate decreases the effect of metronidazole |
| Tacrolimus |
Metronidazole increases the levels/toxicity of tacrolimus |
| Talbutal |
The barbiturate decreases the effect of metronidazole |
| Warfarin |
Metronidazole increases the anticoagulant effect |
|
| Food Interactions |
- Avoid alcohol.
- Take with food to reduce irritation.
|
| Pathways |
Not Available
|
| General References |
- Williams CS, Woodcock KR: Do ethanol and metronidazole interact to produce a disulfiram-like reaction? Ann Pharmacother. 2000 Feb;34(2):255-7. [PubMed
]
- Visapaa JP, Tillonen JS, Kaihovaara PS, Salaspuro MP: Lack of disulfiram-like reaction with metronidazole and ethanol. Ann Pharmacother. 2002 Jun;36(6):971-4. [PubMed
]
- Lamont RF: Can antibiotics prevent preterm birth--the pro and con debate. BJOG. 2005 Mar;112 Suppl 1:67-73. [PubMed
]
- Shennan A, Crawshaw S, Briley A, Hawken J, Seed P, Jones G, Poston L: A randomised controlled trial of metronidazole for the prevention of preterm birth in women positive for cervicovaginal fetal fibronectin: the PREMET Study. BJOG. 2006 Jan;113(1):65-74. [PubMed
]
- Drugs.com

- Wikipedia

- RxList

|
| Organisms Affected |
|
| Phase 1 Metabolizing Enzymes |
- Cytochrome P450 2C9 (CYP2C9)
|
| Targets |
- Periplasmic [Fe] hydrogenase 1
- NADPH-linked flavin nitroreductase
- DNA
|
|
Drug Target 1
[top]
|
| Target 1 ID |
621 |
| Target 1 Name |
Periplasmic [Fe] hydrogenase 1 |
| Target 1 Synonyms |
- CpI
- EC 1.12.7.2
- Fe-only hydrogenase
|
| Target 1 Gene Name |
Not Available |
| Target 1 Protein Sequence |
>Periplasmic [Fe] hydrogenase 1
MKTIIINGVQFNTDEDTTILKFARDNNIDISALCFLNNCNNDINKCEICTVEVEGTGLVT
ACDTLIEDGMIINTNSDAVNEKIKSRISQLLDIHEFKCGPCNRRENCEFLKLVIKYKARA
SKPFLPKDKTEYVDERSKSLTVDRTKCLLCGRCVNACGKNTETYAMKFLNKNGKTIIGAE
DEKCFDDTNCLLCGQCIIACPVAALSEKSHMDRVKNALNAPEKHVIVAMAPSVRASIGEL
FNMGFGVDVTGKIYTALRQLGFDKIFDINFGADMTIMEEATELVQRIENNGPFPMFTSCC
PGWVRQAENYYPELLNNLSSAKSPQQIFGTASKTYYPSISGLDPKNVFTVTVMPCTSKKF
EADRPQMEKDGLRDIDAVITTRELAKMIKDAKIPFAKLEDSEADPAMGEYSGAGAIFGAT
GGVMEAALRSAKDFAENAELEDIEYKQVRGLNGIKEAEVEINNNKYNVAVINGASNLFKF
MKSGMINEKQYHFIEVMACHGGCVNGGGQPHVNPKDLEKVDIKKVRASVLYNQDEHLSKR
KSHENTALVKMYQNYFGKPGEGRAHEILHFKYKK
|
| Target 1 Number of Residues |
583 |
| Target 1 Molecular Weight |
63829 |
| Target 1 Theoretical pI |
6.65 |
| Target 1 GO Classification |
|
Function
|
catalytic activity
oxidoreductase activity
oxidoreductase activity, acting on hydrogen as donor
oxidoreductase activity, acting on hydrogen as donor, iron-sulfur protein as acceptor
ferredoxin hydrogenase activity
binding
ion binding
cation binding
transition metal ion binding
iron ion binding
transporter activity
electron transporter activity |
|
Process
|
physiological process
metabolism
cellular metabolism
generation of precursor metabolites and energy
electron transport |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Involved in electron carrier activity |
| Target 1 Specific Function |
Not Available |
| Target 1 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Glyoxylate and dicarboxylate metabolism |
|
map00630  |
| Methane metabolism |
|
map00680  |
|
| Target 1 Reactions |
- H2 + 2 oxidized ferredoxin = 2 reduced ferredoxin + 2 H+
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Essential |
| Target 1 GenBank ID Protein |
144836  |
| Target 1 UniProtKB/Swiss-Prot ID |
P29166  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
PHF1_CLOPA  |
| Target 1 PDB ID |
1C4C  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
|
| Target 1 Gene Sequence |
>1725 bp
ATGAAAACAATAATTATAAATGGTGTACAGTTTAATACTGATGAAGACACTACTATATTA
AAATTTGCACGAGACAACAATATTGATATATCTGCACTGTGTTTTTTAAATAATTGTAAT
AATGACATAAATAAGTGTGAAATATGTACTGTAGAGGTAGAGGGTACTGGATTAGTAACA
GCCTGTGATACATTAATTGAGGATGGTATGATTATAAACACAAATTCCGATGCTGTCAAC
GAAAAAATTAAATCTAGAATATCTCAATTATTAGACATACATGAATTCAAATGTGGTCCT
TGCAATAGAAGAGAAAACTGTGAATTCTTAAAACTTGTTATAAAATATAAAGCAAGAGCT
TCTAAACCATTTTTACCTAAAGATAAGACTGAATATGTAGATGAAAGAAGTAAATCATTA
ACTGTAGATAGGACAAAATGCTTATTATGTGGAAGATGTGTTAATGCCTGTGGAAAAAAT
ACTGAAACCTATGCAATGAAATTTTTAAACAAAAATGGTAAAACTATAATTGGAGCAGAG
GATGAAAAATGCTTTGATGATACTAATTGTCTATTATGTGGTCAATGTATAATCGCCTGT
CCAGTAGCAGCATTATCGGAAAAATCACACATGGATAGAGTAAAAAATGCCTTAAATGCC
CCTGAAAAACATGTAATAGTAGCTATGGCTCCATCTGTCAGAGCTTCTATAGGTGAACTT
TTTAATATGGGATTTGGCGTTGACGTAACAGGAAAAATTTATACTGCTTTAAGACAGCTT
GGATTTGATAAAATATTCGATATAAACTTCGGAGCAGATATGACAATTATGGAAGAGGCT
ACAGAATTAGTTCAAAGAATAGAGAATAATGGACCTTTCCCAATGTTTACATCTTGCTGC
CCAGGTTGGGTAAGACAAGCTGAAAATTATTATCCTGAATTACTAAATAATCTTTCATCA
GCTAAATCACCTCAACAAATTTTTGGTACTGCTAGTAAAACTTATTATCCTTCTATATCT
GGTCTTGACCCAAAGAATGTATTTACTGTAACAGTTATGCCCTGTACTTCAAAAAAATTT
GAAGCAGATAGACCACAAATGGAAAAAGACGGCCTAAGAGATATAGATGCTGTTATAACT
ACTCGAGAATTAGCAAAAATGATTAAAGATGCTAAAATACCATTTGCTAAACTTGAAGAT
AGCGAAGCAGACCCTGCTATGGGAGAATACAGCGGTGCTGGTGCCATATTTGGTGCAACT
GGCGGAGTTATGGAAGCAGCTTTAAGAAGTGCAAAAGACTTTGCTGAAAACGCTGAACTT
GAAGATATAGAATATAAGCAAGTTAGAGGATTAAATGGTATAAAAGAAGCTGAAGTAGAA
ATAAATAACAACAAATATAATGTAGCTGTTATAAATGGTGCTTCAAATTTATTTAAGTTT
ATGAAATCTGGTATGATTAACGAAAAACAATATCATTTCATAGAAGTAATGGCTTGTCAT
GGAGGATGTGTAAATGGTGGTGGACAGCCTCATGTAAACCCAAAAGATTTAGAAAAAGTA
GACATAAAAAAAGTAAGAGCTTCTGTATTGTATAATCAGGATGAACATCTTTCCAAGAGA
AAATCTCATGAAAATACTGCATTAGTTAAAATGTATCAAAATTATTTTGGCAAACCAGGT
GAAGGTCGTGCCCATGAAATATTACACTTTAAATATAAAAAATAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
Not Available |
| Target 1 GenAtlas ID |
Not Available |
| Target 1 HGNC ID |
Not Available |
| Target 1 Chromosome Location |
Not Available |
| Target 1 Locus |
Not Available |
| Target 1 SNPs |
Not Available |
| Target 1 General References |
- Lemon BJ, Peters JW: Binding of exogenously added carbon monoxide at the active site of the iron-only hydrogenase (CpI) from Clostridium pasteurianum. Biochemistry. 1999 Oct 5;38(40):12969-73. [PubMed
]
- Meyer J, Gagnon J: Primary structure of hydrogenase I from Clostridium pasteurianum. Biochemistry. 1991 Oct 8;30(40):9697-704. [PubMed
]
- Peters JW, Lanzilotta WN, Lemon BJ, Seefeldt LC: X-ray crystal structure of the Fe-only hydrogenase (CpI) from Clostridium pasteurianum to 1.8 angstrom resolution. Science. 1998 Dec 4;282(5395):1853-8. [PubMed
]
|
| Target 1 Drug References |
- Kutty R, Bennett GN: Studies on inhibition of transformation of 2,4,6-trinitrotoluene catalyzed by Fe-only hydrogenase from Clostridium acetobutylicum. J Ind Microbiol Biotechnol. 2006 May;33(5):368-76. Epub 2006 Jan 28. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
783 |
| Target 2 Name |
NADPH-linked flavin nitroreductase |
| Target 2 Synonyms |
Not Available |
| Target 2 Gene Name |
rdxA |
| Target 2 Protein Sequence |
>NADPH-linked flavin nitroreductase
MKFLDQEKRRQLLNERHSCKMFDSHYEFSSEELEEIAEIARLSPSSYNTQPWHFVMVTNK
DLKKQIAVHSYFNEEMIKSASALMVVCSLRPSELLPHGHYMQNLYPESYKVRVIPSFAQM
LGVRFNHSMQRLESYILEQCYIAVGQICMGVSLMGLDSCIIGGFDPLKVGEVLEERINKP
KIACLIALGKRVAEASQKSRKSKVDAITWL
|
| Target 2 Number of Residues |
213 |
| Target 2 Molecular Weight |
24123 |
| Target 2 Theoretical pI |
8.13 |
| Target 2 GO Classification |
|
Function
|
catalytic activity
oxidoreductase activity |
|
Process
|
physiological process
metabolism
cellular metabolism
generation of precursor metabolites and energy
electron transport |
|
Component
|
| Not Available |
|
| Target 2 General Function |
Energy production and conversion |
| Target 2 Specific Function |
Not Available |
| Target 2 Pathways |
Not Available
|
| Target 2 Reactions |
Not Available |
| Target 2 Pfam Domain Function |
|
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
|
| Target 2 Essentiality |
Essential |
| Target 2 GenBank ID Protein |
2564441  |
| Target 2 UniProtKB/Swiss-Prot ID |
O30585  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
O30585_HELPY  |
| Target 2 PDB ID |
Not Available |
| Target 2 Cellular Location |
Not Available |
| Target 2 Gene Sequence |
>633 bp
ATGAAATTTTTGGATCAGGAAAAAAGAAGACAACTATTAAACGAGCGCCATTCTTGCAAG
ATGTTTGACAGCCATTATGAGTTTTCTAGTGAAGAATTAGAAGAAATCGCTGAAATCGCC
AGGCTATCGCCAAGCTCTTACAACACGCAGCCATGGCATTTTGTGATGGTTACTAATAAG
GATTTAAAAAAACAAATTGCAGTGCACAGCTACTTTAATGAAGAAATGATTAAAAGCGCT
TCAGCGTTAATGGTGGTATGCTCTTTAAGACCTAGCGAGTTGTTACCACACGGCCATTAC
ATGCAAAACCTTTACCCGGAGTCTTATAAGGTTAGAGTGATCCCTTCTTTTGCTCAAATG
CTTGGCGTGAGATTCAACCACAGCATGCAAAGATTAGAAAGCTATATTTTAGAGCAATGC
TATATCGCTGTGGGGCAAATTTGCATGGGCGTGAGCTTAATGGGATTGGATAGTTGCATT
ATTGGAGGCTTTGATCCTTTAAAAGTGGGTGAAGTTTTAGAAGAGCGTATCAATAAGCCT
AAAATCGCATGCTTGATCGCTTTGGGCAAGAGGGTGGCAGAAGCGAGCCAAAAATCAAGA
AAATCAAAAGTTGATGCGATTACTTGGTTGTGA
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
Not Available |
| Target 2 GenAtlas ID |
Not Available |
| Target 2 HGNC ID |
Not Available |
| Target 2 Chromosome Location |
Not Available |
| Target 2 Locus |
Not Available |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Goodwin A, Kersulyte D, Sisson G, Veldhuyzen van Zanten SJ, Berg DE, Hoffman PS: Metronidazole resistance in Helicobacter pylori is due to null mutations in a gene (rdxA) that encodes an oxygen-insensitive NADPH nitroreductase. Mol Microbiol. 1998 Apr;28(2):383-93. [PubMed
]
|
| Target 2 Drug References |
- Debets-Ossenkopp YJ, Pot RG, van Westerloo DJ, Goodwin A, Vandenbroucke-Grauls CM, Berg DE, Hoffman PS, Kusters JG: Insertion of mini-IS605 and deletion of adjacent sequences in the nitroreductase (rdxA) gene cause metronidazole resistance in Helicobacter pylori NCTC11637. Antimicrob Agents Chemother. 1999 Nov;43(11):2657-62. [PubMed
]
- Sisson G, Jeong JY, Goodwin A, Bryden L, Rossler N, Lim-Morrison S, Raudonikiene A, Berg DE, Hoffman PS: Metronidazole activation is mutagenic and causes DNA fragmentation in Helicobacter pylori and in Escherichia coli containing a cloned H. pylori RdxA(+) (Nitroreductase) gene. J Bacteriol. 2000 Sep;182(18):5091-6. [PubMed
]
- Chisholm SA, Owen RJ: Mutations in Helicobacter pylori rdxA gene sequences may not contribute to metronidazole resistance. J Antimicrob Chemother. 2003 Apr;51(4):995-9. Epub 2003 Mar 13. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|
|
Drug Target 3
[top]
|
| Target 3 ID |
874 |
| Target 3 Name |
DNA |
| Target 3 Synonyms |
- Deoxyribonucleic acid
|
| Target 3 Gene Name |
Not Available |
| Target 3 Protein Sequence |
Not Available |
| Target 3 Number of Residues |
0 |
| Target 3 Molecular Weight |
7656 (double strand) |
| Target 3 Theoretical pI |
Not Available |
| Target 3 GO Classification |
|
Function
|
information storage
information transfer
|
|
Process
|
DNA replication and chromosomal cycle
DNA replication
DNA-dependent DNA replication
DNA replication, synthesis of RNA primer
transcription
transcription, DNA dependent
|
|
Component
|
cell
intracellular
nucleus
mitochondria |
|
| Target 3 General Function |
Biological information storage and information transfer |
| Target 3 Specific Function |
DNA is the molecule of heredity, as it is responsible for the genetic propagation of most inherited traits. It is a polynucleic acid that carries genetic information on cell growth, division, and function. DNA consists of two long strands of nucleotides twisted into a double helix and held together by hydrogen bonds. The sequence of nucleotides determines hereditary characteristics. Each strand serves as the template for subsequent DNA replication and as a template for mRNA production, leading to protein synthesis via ribosomes. |
| Target 3 Pathways |
|
| Target 3 Reactions |
- DNA + DNA polymerase + nNTP = 2 DNA + nNDP; DNA + RNA polymerase + NTP = mRNA + nNDP
|
| Target 3 Pfam Domain Function |
Not Available |
| Target 3 Signals |
|
| Target 3 Transmembrane Regions |
|
| Target 3 Essentiality |
Essential |
| Target 3 GenBank ID Protein |
Not Available |
| Target 3 UniProtKB/Swiss-Prot ID |
Not Available |
| Target 3 UniProtKB/Swiss-Prot Entry Name |
Not Available |
| Target 3 PDB ID |
1BNA  |
| Target 3 PDB File |
Show |
| Target 3 3D Structure |
|
| Target 3 Cellular Location |
|
| Target 3 Gene Sequence |
>Example: Dickerson dodecamer
CGCGAATTCGCG
|
| Target 3 GenBank Gene ID |
|
| Target 3 GeneCard ID |
Not Available |
| Target 3 GenAtlas ID |
Not Available |
| Target 3 HGNC ID |
Not Available |
| Target 3 Chromosome Location |
Not Available |
| Target 3 Locus |
All loci |
| Target 3 SNPs |
Not Available |
| Target 3 General References |
- Nadeau D, Marchand C: Change in the kinetics of sulphacetamide tissue distribution in Walker tumor-bearing rats. Drug Metab Dispos. 1975 Nov-Dec;3(6):565-76. [PubMed
]
|
| Target 3 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Salles JM, Salles MJ, Moraes LA, Silva MC: Invasive amebiasis: an update on diagnosis and management. Expert Rev Anti Infect Ther. 2007 Oct;5(5):893-901. [PubMed
]
- Li AQ, Dai N, Yan J, Zhu YL: [Screening for metronidazole-resistance associated gene fragments of Helicobacter pylori by suppression subtractive hybridization.] Zhejiang Da Xue Xue Bao Yi Xue Ban. 2007 Sep;36(5):465-9. [PubMed
]
|