Synaptic vesicular amine transporter

Details

Name
Synaptic vesicular amine transporter
Synonyms
  • Monoamine transporter
  • Solute carrier family 18 member 2
  • SVMT
  • VAT2
  • Vesicular amine transporter 2
  • VMAT2
Gene Name
SLC18A2
Organism
Human
Amino acid sequence
>lcl|BSEQ0000236|Synaptic vesicular amine transporter
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE
DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS
SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS
VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS
ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC
ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS
VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM
AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Number of residues
514
Molecular Weight
55712.075
Theoretical pI
5.91
GO Classification
Functions
monoamine transmembrane transporter activity
Processes
dopamine transport / synaptic transmission / monoamine transport / negative regulation of reactive oxygen species biosynthetic process / neurotransmitter secretion / neurotransmitter loading into synaptic vesicle / response to toxic substance / transmembrane transport / sequestering of neurotransmitter / post-embryonic development / locomotory behavior / response to amphetamine
Components
membrane / plasma membrane / synaptic vesicle / integral component of plasma membrane / clathrin-sculpted monoamine transport vesicle membrane
General Function
Monoamine transmembrane transporter activity
Specific Function
Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
Pfam Domain Function
Transmembrane Regions
21-41 130-150 160-180 190-210 220-242 249-271 292-311 329-352 358-378 390-410 415-435 441-462
Cellular Location
Cytoplasmic vesicle membrane
Gene sequence
>lcl|BSEQ0009946|Synaptic vesicular amine transporter (SLC18A2)
ATGGCCCTGAGCGAGCTGGCGCTGGTCCGCTGGCTGCAGGAGAGCCGCCGCTCGCGGAAG
CTCATCCTGTTCATCGTGTTCCTGGCGCTGCTGCTGGACAACATGCTGCTCACTGTCGTG
GTCCCCATCATCCCAAGTTATCTGTACAGCATTAAGCATGAGAAGAATGCTACAGAAATC
CAGACGGCCAGGCCAGTGCACACTGCCTCCATCTCAGACAGCTTCCAGAGCATCTTCTCC
TATTATGATAACTCGACTATGGTCACCGGGAATGCTACCAGAGACCTGACACTTCATCAG
ACCGCCACACAGCACATGGTGACCAACGCGTCCGCTGTTCCTTCCGACTGTCCCAGTGAA
GACAAAGACCTCCTGAATGAAAACGTGCAAGTTGGTCTGTTGTTTGCCTCGAAAGCCACC
GTCCAGCTCATCACCAACCCTTTCATAGGACTACTGACCAACAGAATTGGCTATCCAATT
CCCATATTTGCGGGATTCTGCATCATGTTTGTCTCAACAATTATGTTTGCCTTCTCCAGC
AGCTATGCCTTCCTGCTGATTGCCAGGTCGCTGCAGGGCATCGGCTCGTCCTGCTCCTCT
GTGGCTGGGATGGGCATGCTTGCCAGTGTCTACACAGATGATGAAGAGAGAGGCAACGTC
ATGGGAATCGCCTTGGGAGGCCTGGCCATGGGGGTCTTAGTGGGCCCCCCCTTCGGGAGT
GTGCTCTATGAGTTTGTGGGGAAGACGGCTCCGTTCCTGGTGCTGGCCGCCCTGGTACTC
TTGGATGGAGCTATTCAGCTCTTTGTGCTCCAGCCGTCCCGGGTGCAGCCAGAGAGTCAG
AAGGGGACACCCCTAACCACGCTGCTGAAGGACCCGTACATCCTCATTGCTGCAGGCTCC
ATCTGCTTTGCAAACATGGGCATCGCCATGCTGGAGCCAGCCCTGCCCATCTGGATGATG
GAGACCATGTGTTCCCGAAAGTGGCAGCTGGGCGTTGCCTTCTTGCCAGCTAGTATCTCT
TATCTCATTGGAACCAATATTTTTGGGATACTTGCACACAAAATGGGGAGGTGGCTTTGT
GCTCTTCTGGGAATGATAATTGTTGGAGTCAGCATTTTATGTATTCCATTTGCAAAAAAC
ATTTATGGACTCATAGCTCCGAACTTTGGAGTTGGTTTTGCAATTGGAATGGTGGATTCG
TCAATGATGCCTATCATGGGCTACCTCGTAGACCTGCGGCACGTGTCCGTCTATGGGAGT
GTGTACGCCATTGCGGATGTGGCATTTTGTATGGGGTATGCTATAGGTCCTTCTGCTGGT
GGTGCTATTGCAAAGGCAATTGGATTTCCATGGCTCATGACAATTATTGGGATAATTGAT
ATTCTTTTTGCCCCTCTCTGCTTTTTTCTTCGAAGTCCACCTGCCAAAGAAGAAAAAATG
GCTATTCTCATGGATCACAACTGCCCTATTAAAACAAAAATGTACACTCAGAATAATATC
CAGTCATATCCGATAGGTGAAGATGAAGAATCTGAAAGTGACTGA
Chromosome Location
10
Locus
10q25
External Identifiers
ResourceLink
UniProtKB IDQ05940
UniProtKB Entry NameVMAT2_HUMAN
GenBank Protein ID292335
GenBank Gene IDL09118
GenAtlas IDSLC18A2
HGNC IDHGNC:10935
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00206Reserpineapproved, investigationalyesinhibitorDetails
DB09363Rauwolfia serpentina rootapproved, investigationalyesinhibitorDetails
DB04844Tetrabenazineapproved, investigationalyesinhibitorDetails
DB01089DeserpidineapprovedyesinhibitorDetails
DB00865Benzphetamineapproved, illicityesinducerDetails
DB00182Amphetamineapproved, illicit, investigationalyesinhibitorDetails
DB06714PropylhexedrineapprovedyesDetails
DB06706IsomethepteneapprovedyesinhibitorDetails
DB01454Midomafetamineexperimental, illicit, investigationalyesinhibitorDetails
DB01576Dextroamphetamineapproved, illicityesinducerDetails
DB014724-Methoxyamphetamineexperimental, illicityesinhibitorDetails
DB01577Methamphetamineapproved, illicityesinhibitorDetails
DB01363Ephedraapproved, nutraceutical, withdrawnyesinhibitorDetails
DB01442MMDAexperimental, illicityesinhibitorDetails
DB01364EphedrineapprovedunknowninhibitorDetails
DB00368NorepinephrineapprovedunknownbinderDetails
DB12161Deutetrabenazineapproved, investigationalyesinhibitorDetails
DB00988DopamineapprovedunknownDetails
DB00502HaloperidolapprovedunknownDetails
DB05381Histamineapproved, investigationalunknownDetails
DB08839Serotonininvestigational, nutraceuticalunknownDetails
DB00579Mazindolapproved, investigationalunknownDetails
DB04821NomifensinewithdrawnunknownDetails