Identification

Name
Cetuximab
Accession Number
DB00002  (BTD00071, BIOD00071)
Type
Biotech
Groups
Approved
Description

Cetuximab is an epidermal growth factor receptor binding FAB. Cetuximab is composed of the Fv (variable; antigen-binding) regions of the 225 murine EGFr monoclonal antibody specific for the N-terminal portion of human EGFr with human IgG1 heavy and kappa light chain constant (framework) regions. Cetuximab is marketed under the brand Erbitux® by Eli Lilly and Company. In the United States, a regimen of cetuximab costs approximately $30,790 for an eight-week course.

Protein structure
Db00002
Protein chemical formula
C6484H10042N1732O2023S36
Protein average weight
145781.6 Da
Sequences
>Cetuximab heavy chain
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYN
TPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Cetuximab light chain
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPS
RFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Cetuximab
  • Cétuximab
  • Cetuximabum
  • Immunoglobulin G 1 (human-mouse monoclonal C 225 gamma 1 - chain anti-human epidermal growt factor receptor), disulfide wit human-mouse monoclonal C 225 kappa - chain, dimer
External IDs
BMS 564717 / C225
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ErbituxSolution2 mgIntravenousIm Clone Llc2008-10-28Not applicableCanada
ErbituxSolution2 mg/mLIntravenousIm Clone Llc2004-02-12Not applicableUs
ErbituxInjection, solution5 mg/mlIntravenousMerck K Ga A2004-06-29Not applicableEu
ErbituxSolution2 mg/mLIntravenousIm Clone Llc2007-10-02Not applicableUs
ErbituxInjection, solution5 mg/mlIntravenousMerck K Ga A2004-06-29Not applicableEu
Categories
UNII
PQX0D8J21J
CAS number
205923-56-4

Pharmacology

Indication

Cetuximab, used in combination with irinotecan, is indicated for the treatment of EGFR-expressing, metastatic colorectal carcinoma in patients who are refractory to irinotecan-based chemotherapy. Cetuximab administered as a single agent is indicated for the treatment of EGFR-expressing, metastatic colorectal carcinoma in patients who are intolerant to irinotecan-based chemotherapy.

Structured Indications
Not Available
Pharmacodynamics

Used in the treatment of colorectal cancer, cetuximab binds specifically to the epidermal growth factor receptor (EGFr, HER1, c-ErbB-1) on both normal and tumor cells. EGFr is over-expressed in many colorectal cancers. Cetuximab competitively inhibits the binding of epidermal growth factor (EGF) and other ligands, such as transforming growth factor–alpha. Binding of cetuximab to the EGFr blocks phosphorylation and activation of receptor-associated kinases, resulting in inhibition of cell growth, induction of apoptosis, decreased matrix metalloproteinase secretion and reduced vascular endothelial growth factor production.

Mechanism of action

Cetuximab binds to the epidermal growth factor receptor (EGFr) on both normal and tumor cells. EGFr is over-expressed in many colorectal cancers. Cetuximab competitively inhibits the binding of epidermal growth factor (EGF) and TGF alpha, thereby reducing their effects on cell growth and metastatic spread.

TargetActionsOrganism
AEpidermal growth factor receptor
antagonist
Human
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
Absorption
Not Available
Volume of distribution

appeared to be independent of dose and approximated the vascular space of 2-3 L/m2.

Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

The mean half-life for Cetuximab is 114 hours (range 75-188 hours).

Clearance

Female patients had 25% lower intrinsic clearance than male patients.

Toxicity

Pulmonary Toxicity

Interstitial lung disease (ILD) was reported in 3 of 633 (<0.5%) patients with advanced colorectal cancer receiving cetuximab. Interstitial pneumonitis with non-cardiogenic pulmonary edema resulting in death was reported in one case. Two patients had pre-existing fibrotic lung disease and experienced an acute exacerbation of their disease while receiving cetuximab in combination with irinotecan. In the clinical investigational program, an additional case of interstitial pneumonitis was reported in a patient with head and neck cancer treated with cetuximab and cisplatin. The onset of symptoms occurred between the fourth and eleventh doses of treatment in all reported cases.

Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Cetuximab Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Interacting Gene/EnzymeAllele nameGenotype(s)Defining Change(s)Type(s)DescriptionDetails
Low affinity immunoglobulin gamma Fc region receptor II-a---(T;T) / (C;T)H allelle Effect Directly StudiedPatients with this genotype may have increased progression-free survival time when using cetuximab to treat colorectal cancer.Details
Low affinity immunoglobulin gamma Fc region receptor III-A---(T;T) / (G;T)G > T Effect Directly StudiedPatients with this genotype have increased progression-free survival time when using cetuximab to treat colorectal cancer.Details

Interactions

Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Cetuximab.Approved
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Cetuximab.Experimental
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Cetuximab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Cetuximab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Cetuximab.Approved
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Cetuximab.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Cetuximab.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Cetuximab.Approved, Investigational
CymarinCymarin may decrease the cardiotoxic activities of Cetuximab.Experimental
DeslanosideDeslanoside may decrease the cardiotoxic activities of Cetuximab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Cetuximab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Cetuximab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Cetuximab.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Cetuximab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Cetuximab.Investigational
GitoformateGitoformate may decrease the cardiotoxic activities of Cetuximab.Experimental
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Cetuximab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Cetuximab.Investigational
Lanatoside CLanatoside C may decrease the cardiotoxic activities of Cetuximab.Experimental
MetildigoxinMetildigoxin may decrease the cardiotoxic activities of Cetuximab.Experimental
OleandrinOleandrin may decrease the cardiotoxic activities of Cetuximab.Experimental
OuabainOuabain may decrease the cardiotoxic activities of Cetuximab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Cetuximab.Approved, Vet Approved
PeruvosidePeruvoside may decrease the cardiotoxic activities of Cetuximab.Experimental
ProscillaridinProscillaridin may decrease the cardiotoxic activities of Cetuximab.Experimental
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Cetuximab.Approved
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Cetuximab.Investigational
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Cetuximab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Cetuximab.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Cetuximab.Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Cetuximab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Cetuximab.Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Cetuximab.Approved, Investigational
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Cetuximab.Approved
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Cetuximab.Approved
Food Interactions
Not Available

References

Synthesis Reference
Not Available
General References
  1. Hosokawa N, Yamamoto S, Uehara Y, Hori M, Tsuchiya KS: Effect of thiazinotrienomycin B, an ansamycin antibiotic, on the function of epidermal growth factor receptor in human stomach tumor cells. J Antibiot (Tokyo). 1999 May;52(5):485-90. [PubMed:10480573 ]
  2. Wakita H, Takigawa M: Activation of epidermal growth factor receptor promotes late terminal differentiation of cell-matrix interaction-disrupted keratinocytes. J Biol Chem. 1999 Dec 24;274(52):37285-91. [PubMed:10601294 ]
  3. Suwa T, Ueda M, Jinno H, Ozawa S, Kitagawa Y, Ando N, Kitajima M: Epidermal growth factor receptor-dependent cytotoxic effect of anti-EGFR antibody-ribonuclease conjugate on human cancer cells. Anticancer Res. 1999 Sep-Oct;19(5B):4161-5. [PubMed:10628369 ]
  4. Burke P, Schooler K, Wiley HS: Regulation of epidermal growth factor receptor signaling by endocytosis and intracellular trafficking. Mol Biol Cell. 2001 Jun;12(6):1897-910. [PubMed:11408594 ]
  5. Viloria-Petit A, Crombet T, Jothy S, Hicklin D, Bohlen P, Schlaeppi JM, Rak J, Kerbel RS: Acquired resistance to the antitumor effect of epidermal growth factor receptor-blocking antibodies in vivo: a role for altered tumor angiogenesis. Cancer Res. 2001 Jul 1;61(13):5090-101. [PubMed:11431346 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  7. Schrag D: The price tag on progress--chemotherapy for colorectal cancer. N Engl J Med. 2004 Jul 22;351(4):317-9. [PubMed:15269308 ]
  8. Snyder LC, Astsaturov I, Weiner LM: Overview of monoclonal antibodies and small molecules targeting the epidermal growth factor receptor pathway in colorectal cancer. Clin Colorectal Cancer. 2005 Nov;5 Suppl 2:S71-80. [PubMed:16336752 ]
External Links
Genbank
J00228
KEGG Drug
D03455
ChEMBL
CHEMBL1201577
Therapeutic Targets Database
DNC000788
PharmGKB
PA10040
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Cetuximab
ATC Codes
L01XC06 — Cetuximab
AHFS Codes
Not Available
PDB Entries
FDA label
Download (73.8 KB)
MSDS
Download (84.4 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0TerminatedBasic ScienceHepatic Metastases / Mucinous Adenocarcinoma of the Colon / Mucinous Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Signet Ring Adenocarcinoma of the Colon / Signet Ring Adenocarcinoma of the Rectum / Stage IV Colon Cancer / Stage IV Rectal Cancer1
0Unknown StatusDiagnosticHead and Neck Carcinoma1
1Active Not RecruitingNot AvailableCarcinoma, Squamous Cell of Head and Neck / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Carcinoma, Head And Neck1
1Active Not RecruitingTreatmentAdvanced Cancers1
1Active Not RecruitingTreatmentCancer, Advanced1
1Active Not RecruitingTreatmentCancers1
1Active Not RecruitingTreatmentHead and Neck Carcinoma1
1Active Not RecruitingTreatmentLocally Advanced Cancer in the Anal Region1
1Active Not RecruitingTreatmentNeoplasms1
1Active Not RecruitingTreatmentRecurrent Colon Carcinoma / Recurrent Hypopharyngeal Squamous Cell Carcinoma / Recurrent Laryngeal Squamous Cell Carcinoma / Recurrent Laryngeal Verrucous Carcinoma / Recurrent Lip and Oral Cavity Squamous Cell Carcinoma / Recurrent Metastatic Squamous Cell Carcinoma in the Neck With Occult Primary / Recurrent Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Recurrent Nasopharyngeal Keratinizing Squamous Cell Carcinoma / Recurrent Oral Cavity Verrucous Carcinoma / Recurrent Oropharyngeal Squamous Cell Carcinoma / Recurrent Rectal Carcinoma / Recurrent Salivary Gland Carcinoma / Salivary Gland Squamous Cell Carcinoma / Squamous Cell Carcinoma Metastatic in the Neck With Occult Primary / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Nasopharyngeal Keratinizing Squamous Cell Carcinoma / Stage IV Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage IVA Colon Cancer / Stage IVA Colon Cancer AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Verrucous Carcinoma / Stage IVA Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Major Salivary Gland Cancer AJCC v7 / Stage IVA Major Salivary Gland Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVA Oral Cavity Verrucous Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Rectal Cancer / Stage IVA Rectal Cancer AJCC v7 / Stage IVB Colon Cancer / Stage IVB Colon Cancer AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Verrucous Carcinoma / Stage IVB Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Major Salivary Gland Cancer AJCC v7 / Stage IVB Major Salivary Gland Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Verrucous Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Rectal Cancer / Stage IVB Rectal Cancer AJCC v7 / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Laryngeal Verrucous Carcinoma / Stage IVC Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVC Major Salivary Gland Cancer AJCC v7 / Stage IVC Major Salivary Gland Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Verrucous Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Tongue Carcinoma / Untreated Metastatic Squamous Cell Carcinoma to Neck With Occult Primary1
1Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
1Active Not RecruitingTreatmentStage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma1
1CompletedDiagnosticCancers / Refractory Solid Tumors1
1CompletedTreatmentAnaplastic Astrocytoma (AA) / ANAPLASTIC ASTROCYTOMA (AOA) / GBM / Glioblastoma Multiforme (GBM)1
1CompletedTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Small Cell Carcinoma / Cervical Squamous Cell Carcinoma / Stage IB Cervical Cancer / Stage IIA Cervical Cancer / Stage IIB Cervical Cancer / Stage III Cervical Cancer / Stage IVA Cervical Cancer1
1CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Advanced Adult Primary Liver Cancer / Carcinoma of the Appendix / Gastrointestinal Stromal Tumors / Metastatic Gastrointestinal Carcinoid Tumor / Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Adult Primary Liver Cancer / Recurrent Anal Cancer / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Colon Cancer / Recurrent Esophageal Cancer / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Recurrent Gastric Cancer / Recurrent Gastrointestinal Carcinoid Tumor / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Non-small Cell Lung Cancer / Recurrent Pancreatic Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Recurrent Small Intestine Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Small Intestine Adenocarcinoma / Small Intestine Leiomyosarcoma / Small Intestine Lymphoma / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Anal Cancer / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Colon Cancer / Stage IV Esophageal Cancer / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Gastric Cancer / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Pancreatic Cancer / Stage IV Rectal Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Tongue Cancer / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer1
1CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage IV Colon Cancer / Stage IV Rectal Cancer1
1CompletedTreatmentAdvanced Cancers2
1CompletedTreatmentAdvanced Solid Tumors1
1CompletedTreatmentCancer of the Colon / Colon Neoplasms / Colonic Neoplasms / Malignant Neoplasm of Colon1
1CompletedTreatmentCancer, Advanced1
1CompletedTreatmentCancer, Advanced / Liver Cancer1
1CompletedTreatmentCancer, Breast / Colorectal Cancers / Head and Neck Carcinoma / Lung Cancers / Malignant Neoplasm of Pancreas / Renal Cancers / Sarcomas / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentCancers1
1CompletedTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
1CompletedTreatmentColorectal Adenocarcinoma / Colorectal Cancers1
1CompletedTreatmentColorectal Cancers6
1CompletedTreatmentColorectal Cancers / Head and Neck Carcinoma1
1CompletedTreatmentColorectal Cancers / Head and Neck Carcinoma / Lung Cancers1
1CompletedTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Other Tumors With EGFR Dependence / Squamous Cell Head and Neck Cancer / Triple Negative Breast Cancer (TNBC)1
1CompletedTreatmentGastrointestinal Metastatic Cancer1
1CompletedTreatmentHead and Neck Carcinoma3
1CompletedTreatmentHead and Neck Carcinoma / Laryngeal Cancer / Oral Cancers / Pharyngeal Cancer / Squamous Carcinoma1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms Metastasis1
1CompletedTreatmentMalignant Neoplasm of Pancreas1
1CompletedTreatmentMalignant Neoplasm of Stomach / Precancerous Conditions1
1CompletedTreatmentMalignant Solid Tumours1
1CompletedTreatmentMetastatic Colorectal Cancers1
1CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVA Verrucous Carcinoma of the Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Verrucous Carcinoma of the Larynx / Stage IVB Verrucous Carcinoma of the Oral Cavity / Stage IVC Squamous Cell Carcinoma of the Larynx / Stage IVC Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVC Squamous Cell Carcinoma of the Oropharynx / Stage IVC Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Verrucous Carcinoma of the Larynx / Stage IVC Verrucous Carcinoma of the Oral Cavity / Tongue Cancer1
1CompletedTreatmentNeoplasms3
1CompletedTreatmentNeoplasms, Head and Neck1
1CompletedTreatmentRecurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Colon Cancer / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Stage IVA Colon Cancer / Stage IVA Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IVA Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IVA Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IVA Salivary Gland Cancer / Stage IVA Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Colon Cancer / Stage IVB Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IVB Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IVB Salivary Gland Cancer / Stage IVB Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IVC Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IVC Salivary Gland Cancer / Stage IVC Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Tongue Cancer1
1CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage III Colon Cancer / Stage III Rectal Cancer / Stage IV Colon Cancer / Stage IV Rectal Cancer1
1CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentRecurrent Head and Neck Cancer1
1CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1CompletedTreatmentTumors, Solid1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1Not Yet RecruitingTreatmentColorectal Cancers1
1Not Yet RecruitingTreatmentColorectal Cancers / Malignant Neoplasms of Digestive Organs1
1RecruitingTreatmentAdvanced Cancers2
1RecruitingTreatmentAdvanced Nonhematologic Malignancies1
1RecruitingTreatmentAdvanced Solid Tumors / Cancers1
1RecruitingTreatmentCancer, Breast / Neoplasms Metastasis / Neoplasms, Colorectal1
1RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck1
1RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Squamous Cell Carcinoma (SCC)1
1RecruitingTreatmentColorectal Cancers / Head and Neck Carcinoma1
1RecruitingTreatmentHead and Neck Squamous Cell Cancer1
1RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1RecruitingTreatmentNeoplasms, Head and Neck2
1RecruitingTreatmentPatients With Advanced or Metastatic Solid Tumors1
1RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1TerminatedTreatmentColon Mucinous Adenocarcinoma / Colon Signet Ring Cell Adenocarcinoma / Rectal Mucinous Adenocarcinoma / Rectal Signet Ring Cell Adenocarcinoma / Recurrent Colon Carcinoma / Recurrent Rectal Carcinoma / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
1TerminatedTreatmentColorectal Cancers1
1TerminatedTreatmentLung Cancers1
1TerminatedTreatmentMalignant Neoplasm of Colon1
1TerminatedTreatmentMalignant Neoplasm of Colon / Rectal Carcinoma1
1TerminatedTreatmentMetastatic Colorectal Cancers / Squamous Cell Carcinoma of Head and Neck1
1TerminatedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Tongue Cancer / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1TerminatedTreatmentNeoplasms1
1Unknown StatusTreatmentColorectal Cancers1
1Unknown StatusTreatmentMetastatic Breast Cancer (MBC)1
1WithdrawnTreatmentAdvanced Cancers1
1WithdrawnTreatmentStage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1WithdrawnTreatmentTumors1
1, 2Active Not RecruitingTreatmentColorectal Cancers2
1, 2Active Not RecruitingTreatmentHead and Neck Carcinoma1
1, 2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Active Not RecruitingTreatmentLung Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
1, 2Active Not RecruitingTreatmentMetastatic Cancers1
1, 2Active Not RecruitingTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IVA Salivary Gland Cancer / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVA Verrucous Carcinoma of the Oral Cavity / Stage IVB Salivary Gland Cancer / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Verrucous Carcinoma of the Larynx / Stage IVB Verrucous Carcinoma of the Oral Cavity / Stage IVC Salivary Gland Cancer / Stage IVC Squamous Cell Carcinoma of the Larynx / Stage IVC Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVC Squamous Cell Carcinoma of the Oropharynx / Stage IVC Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Verrucous Carcinoma of the Larynx / Stage IVC Verrucous Carcinoma of the Oral Cavity / Tongue Cancer1
1, 2CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage III Colon Cancer / Stage III Rectal Cancer / Stage IV Colon Cancer / Stage IV Rectal Cancer1
1, 2CompletedTreatmentBasaloid Squamous Cell Carcinoma / Carcinoma, Adenosquamous Cell / Carcinoma, Undifferentiated / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2CompletedTreatmentCancers of the Head and Neck / Neoplasms, Head and Neck1
1, 2CompletedTreatmentColon/Rectal Cancer / Colon/Rectal Cancer Rectal Cancer / Rectal Carcinoma1
1, 2CompletedTreatmentColorectal Cancers2
1, 2CompletedTreatmentEsophageal Cancers2
1, 2CompletedTreatmentHead and Neck Carcinoma2
1, 2CompletedTreatmentIncurable Metastatic Colorectal Carcinoma / Incurable Progressive, Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck1
1, 2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1, 2CompletedTreatmentMetastatic Colorectal Cancer (MCRC)1
1, 2CompletedTreatmentMetastatic Colorectal Cancers5
1, 2CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Colon Cancer / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Non-small Cell Lung Cancer / Recurrent Pancreatic Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Colon Cancer / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Lymphoepithelioma of the Oropharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Pancreatic Cancer / Stage III Rectal Cancer / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IIIb Non-small Cell Lung Cancer / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Colon Cancer / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Pancreatic Cancer / Stage IV Rectal Cancer / Stage IV Renal Cell Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1, 2CompletedTreatmentNasopharyngeal Carcinoma1
1, 2CompletedTreatmentPancreatic Cancer Metastatic1
1, 2CompletedTreatmentSquamous Cell Cancer2
1, 2Not Yet RecruitingTreatmentAdvanced Colorectal Cancer1
1, 2Not Yet RecruitingTreatmentColorectal Cancers1
1, 2Not Yet RecruitingTreatmentHead and Neck Carcinoma / Locally Advanced / Unresectable1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Not Yet RecruitingTreatmentNeoplasms, Oropharyngeal / Oropharyngeal Cancers / Squamous Carcinoma / Squamous Cell Carcinoma (SCC)1
1, 2RecruitingTreatmentAnaplastic Astrocytoma (AA) / Brain Stem Gliomas / Diffuse Intrinsic Pontine Glioma (DIPG) / Fibrillary Astrocytoma of Brain / Glioblastoma Multiforme / Glioma of Brainstem / Mixed Oligodendroglioma-Astrocytoma / Pilomyxoid Astrocytoma1
1, 2RecruitingTreatmentCancer, Advanced / Cancer, Breast / Colorectal Cancers / Esophageal Cancers / Malignant Neoplasm of Stomach1
1, 2RecruitingTreatmentCarcinoma, Adenoid Cystic1
1, 2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck2
1, 2RecruitingTreatmentColorectal Adenocarcinoma (CRC) / Gastric Adenocarcinoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Malignant Neoplasm of Nasopharynx1
1, 2RecruitingTreatmentNeoplasms, Colorectal / Tumors, Solid1
1, 2RecruitingTreatmentNeoplasms, Head and Neck1
1, 2RecruitingTreatmentRecurrent Colorectal Carcinoma / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1, 2RecruitingTreatmentRecurrent Non-small Cell Lung Cancer1
1, 2RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
1, 2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2TerminatedDiagnosticMalignant Gliomas / Neoplasms, Brain1
1, 2TerminatedTreatmentCarcinoma, Colorectal1
1, 2TerminatedTreatmentColorectal Cancers / Head and Neck Carcinoma / Neoplasms Metastasis1
1, 2TerminatedTreatmentHead and Neck Carcinoma3
1, 2TerminatedTreatmentMalignant Neoplasm of Pancreas1
1, 2TerminatedTreatmentMalignant Neoplasm of Stomach1
1, 2TerminatedTreatmentMetastatic Head and Neck Squamous Cell Carcinoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent or Metastatic Head and Neck Squamous Cell Carcinoma / Recurrent or Metastatic Head and Neck Squamous Cell Carcinoma (RM HNSCC) Patients Who Are Resistant or Ineligible/Intolerant to Platinum-based Chemotherapy1
1, 2TerminatedTreatmentNeoplasms1
1, 2TerminatedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2Unknown StatusTreatmentEsophageal Cancers1
1, 2Unknown StatusTreatmentGlioblastoma Multiforme1
1, 2Unknown StatusTreatmentMalignant Neoplasm of Pancreas1
1, 2Unknown StatusTreatmentPlatinum-Resistant Squamous Cell Carcinoma of the Head and Neck1
1, 2Unknown StatusTreatmentRectal Carcinoma1
1, 2Unknown StatusTreatmentTumors, Solid1
1, 2WithdrawnTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Active Not RecruitingScreeningColorectal Cancers1
2Active Not RecruitingTreatmentAnal Carcinoma1
2Active Not RecruitingTreatmentC-met Overexpression / Metastatic Colorectal Cancers1
2Active Not RecruitingTreatmentCancer, Breast1
2Active Not RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck2
2Active Not RecruitingTreatmentCervical Cancers1
2Active Not RecruitingTreatmentColorectal Cancers5
2Active Not RecruitingTreatmentHead and Neck Carcinoma5
2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)2
2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Recurrent Head and Neck Carcinoma1
2Active Not RecruitingTreatmentHypopharyngeal Cancer / Laryngeal Cancer / Oropharyngeal Cancers1
2Active Not RecruitingTreatmentLung Cancers1
2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2Active Not RecruitingTreatmentMetastatic Cancers1
2Active Not RecruitingTreatmentMetastatic Colorectal Cancers4
2Active Not RecruitingTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Tongue Cancer / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
2Active Not RecruitingTreatmentMultiple Myeloma, Neoplasms1
2Active Not RecruitingTreatmentNeoplasms by Site / Neoplasms, Head and Neck / Squamous Cell Cancers of the Head and Neck1
2Active Not RecruitingTreatmentNeoplasms, Esophageal1
2Active Not RecruitingTreatmentNeoplasms, Head and Neck1
2Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
2Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Hypopharynx Stage III / Squamous Cell Carcinoma of the Hypopharynx Stage IV / Squamous Cell Carcinoma of the Larynx Stage III / Squamous Cell Carcinoma of the Larynx Stage IV / Squamous Cell Carcinoma of the Oral Cavity Stage III / Squamous Cell Carcinoma of the Oral Cavity Stage IV / Squamous Cell Carcinoma of the Oropharynx Stage III / Squamous Cell Carcinoma of the Oropharynx Stage IV1
2CompletedNot AvailableMalignant Gliomas1
2CompletedNot AvailableTumors, Solid2
2CompletedDiagnosticCancers1
2CompletedTreatmentAbdominal wall neoplasm / Cancer, Ovarian / Fallopian Tube Neoplasms1
2CompletedTreatmentAdenocarcinoma Of Esophagus / Squamous Cell Carcinoma of Esophagus1
2CompletedTreatmentAdenocarcinoma of Colon / Adenocarcinoma of Rectum / Metastatic Disease1
2CompletedTreatmentAdenocarcinoma of Gallbladder / Cholangiocarcinomas1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Recurrent Non-small Cell Lung Cancer / Squamous Cell Carcinoma of Lung / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Large Cell Lung Cancer / Malignant Pleural Effusions / Recurrent Non-small Cell Lung Cancer / Squamous Cell Carcinoma of Lung / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2CompletedTreatmentAdenocarcinoma of the Rectum / Mucinous Adenocarcinoma of the Colon / Recurrent Colon Cancer / Recurrent Rectal Cancer / Signet Ring Adenocarcinoma of the Colon / Stage IV Colon Cancer / Stage IV Rectal Cancer1
2CompletedTreatmentAdenocarcinomas1
2CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2CompletedTreatmentAdvanced Biliary Cancer1
2CompletedTreatmentAdvanced Colorectal Cancer1
2CompletedTreatmentAdvanced Non-Small Cell Lung Cancer1
2CompletedTreatmentAnal Carcinoma1
2CompletedTreatmentAndrogen-independent Prostate Cancer1
2CompletedTreatmentBladder Cancers1
2CompletedTreatmentCancer of Head and Neck1
2CompletedTreatmentCancer of the Larynx / Cancer of the Oral Cavity / Cancer of the Pharynx / Head and Neck Carcinoma / Nose Neoplasms / Paranasal Sinus Neoplasms1
2CompletedTreatmentCancer of the Lung / Carcinoma NOS / Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Lung1
2CompletedTreatmentCancer, Advanced1
2CompletedTreatmentCancer, Breast3
2CompletedTreatmentCancer, Ovarian / Primary Peritoneal Cavity Cancer1
2CompletedTreatmentCancers2
2CompletedTreatmentCarcinoma of Larynx / Squamous Cell Carcinoma of the Hypopharynx1
2CompletedTreatmentCarcinoma of the Head and Neck1
2CompletedTreatmentCarcinoma, Colorectal1
2CompletedTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors1
2CompletedTreatmentCervical Cancers2
2CompletedTreatmentCervical Squamous Cell Carcinoma / Recurrent Cervical Carcinoma1
2CompletedTreatmentColorectal Cancer (CRC) / Neoplasms, Colorectal1
2CompletedTreatmentColorectal Cancers17
2CompletedTreatmentColorectal Cancers / Hepatic Metastases1
2CompletedTreatmentColorectal Cancers / Metastatic Cancers3
2CompletedTreatmentColorectal Cancers / Neoplasms Metastasis2
2CompletedTreatmentColorectal Cancers / Tumors1
2CompletedTreatmentColorectal Cancers / Unresectable Liver Metastasis1
2CompletedTreatmentComplex Regional Pain Syndromes (CRPS) / Neurocostal neuralgia1
2CompletedTreatmentEndometrial Cancers1
2CompletedTreatmentEsophageal Cancers3
2CompletedTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach2
2CompletedTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach / Neoplasms Metastasis1
2CompletedTreatmentGastric Cancer Adenocarcinoma Metastatic1
2CompletedTreatmentHead and Neck Carcinoma14
2CompletedTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
2CompletedTreatmentHead and Neck Carcinoma / Precancerous Conditions2
2CompletedTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentHead and Neck / Head and Neck Carcinoma / Recurrent Disease / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentHead and Neck / Squamous Cell Cancer1
2CompletedTreatmentHepatocellular,Carcinoma1
2CompletedTreatmentHypopharynx Cancer / Laryngeal Cancer1
2CompletedTreatmentLiver Cancer1
2CompletedTreatmentLiver Only Metastasis From KRAS Exon 2 Wild Type (Under Protocol 1.0-1.2 Edition) and RAS Wild Type (Under Protocol 2.0 Edition) Colorectal Cancer1
2CompletedTreatmentLocally Advanced / Metastatic / Unresectable1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)17
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
2CompletedTreatmentLung Cancers7
2CompletedTreatmentMalignant Neoplasm of Colon1
2CompletedTreatmentMalignant Neoplasm of Colon / Rectal Carcinoma1
2CompletedTreatmentMalignant Neoplasm of Colon / Rectum Cancer1
2CompletedTreatmentMalignant Neoplasm of Pancreas8
2CompletedTreatmentMalignant Neoplasm of Stomach5
2CompletedTreatmentMetastases / Neoplasms / Neoplasms, Colorectal1
2CompletedTreatmentMetastatic Breast Cancer (MBC) / Triple Negative Locally Advanced Non-resectable Breast Cancer1
2CompletedTreatmentMetastatic Colon Cancer1
2CompletedTreatmentMetastatic Colorectal Cancers9
2CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IVA Salivary Gland Cancer / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVA Verrucous Carcinoma of the Oral Cavity / Stage IVB Salivary Gland Cancer / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Verrucous Carcinoma of the Larynx / Stage IVB Verrucous Carcinoma of the Oral Cavity / Stage IVC Salivary Gland Cancer / Stage IVC Squamous Cell Carcinoma of the Larynx / Stage IVC Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVC Squamous Cell Carcinoma of the Oropharynx / Stage IVC Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Verrucous Carcinoma of the Larynx / Stage IVC Verrucous Carcinoma of the Oral Cavity / Tongue Cancer / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
2CompletedTreatmentMucinous Gastrointestinal Adenocarcinoma1
2CompletedTreatmentNasopharyngeal Carcinoma3
2CompletedTreatmentNeoplasm Metastases / Neoplasms, Colorectal1
2CompletedTreatmentNeoplasms, Breast1
2CompletedTreatmentNeoplasms, Colorectal2
2CompletedTreatmentNeoplasms, Head and Neck3
2CompletedTreatmentNeoplasms, Head and Neck / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentOesophageal Carcinoma1
2CompletedTreatmentPancreatic Cancer Metastatic1
2CompletedTreatmentPreviously Untreated Metastatic Colorectal Cancer1
2CompletedTreatmentProstate Cancer1
2CompletedTreatmentRectal Carcinoma4
2CompletedTreatmentRectal Neoplasms1
2CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
2CompletedTreatmentRecurrent Hypopharyngeal Squamous Cell Carcinoma / Recurrent Laryngeal Squamous Cell Carcinoma / Recurrent Laryngeal Verrucous Carcinoma / Recurrent Lip and Oral Cavity Squamous Cell Carcinoma / Recurrent Metastatic Squamous Cell Carcinoma in the Neck With Occult Primary / Recurrent Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Recurrent Nasopharyngeal Keratinizing Squamous Cell Carcinoma / Recurrent Oral Cavity Verrucous Carcinoma / Recurrent Oropharyngeal Squamous Cell Carcinoma / Recurrent Salivary Gland Carcinoma / Salivary Gland Squamous Cell Carcinoma / Squamous Cell Carcinoma Metastatic in the Neck With Occult Primary / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Nasopharyngeal Keratinizing Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Verrucous Carcinoma / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVA Oral Cavity Verrucous Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Verrucous Carcinoma / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVB Oral Cavity Verrucous Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Verrucous Carcinoma / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVC Major Salivary Gland Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVC Oral Cavity Verrucous Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma / Tongue Carcinoma1
2CompletedTreatmentRecurrent Non-small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentSarcomas1
2CompletedTreatmentSkin Diseases / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentSquamous Cell Carcinoma (SCC)2
2CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck Cancer1
2CompletedTreatmentStage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer1
2CompletedTreatmentStage III Non-Small Cell Lung Cancer1
2CompletedTreatmentTime to Progression1
2CompletedTreatmentUrologic Neoplasms1
2Not Yet RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck1
2Not Yet RecruitingTreatmentColorectal Cancers1
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers / MSI1
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers1
2Not Yet RecruitingTreatmentNeoplasms, Head and Neck1
2Not Yet RecruitingTreatmentRectum Cancer1
2Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentCancer of Head and Neck / Cancers of the Head and Neck / Carcinoma, Squamous Cell of the Head and Neck / Head and Neck Carcinoma / Neoplasms, Head and Neck / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentCancers of the Head and Neck / Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentCholangiocarcinoma of the Extrahepatic Bile Duct / Gallbladder Cancer1
2RecruitingTreatmentColorectal Adenocarcinoma / KRAS wt Allele / Metastatic Colorectal Cancers / NRAS wt Allele / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
2RecruitingTreatmentColorectal Cancers4
2RecruitingTreatmentCutaneous Squamous Cell Carcinoma / Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / HNSCC / Hypopharynx Cancer / Laryngeal Cancer / Lip SCC / Nasopharynx Cancer / Neoplasms, Head and Neck / Oral Cavity Cancer / Oropharynx Cancers / Sinonasal Carcinoma1
2RecruitingTreatmentHead and Neck Carcinoma1
2RecruitingTreatmentHead and Neck Carcinoma / Recurrent1
2RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentIncurable Colorectal Cancer / RAS-wild-type1
2RecruitingTreatmentLocally Advanced Thoracic Middle-lower Segment Esophageal Squamous Cell Carcinoma1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2RecruitingTreatmentMetastatic Colorectal Cancers3
2RecruitingTreatmentMetastatic or Recurrent HNSCC1
2RecruitingTreatmentNeoplasms, Head and Neck1
2RecruitingTreatmentSquamous Cell Cancers of the Head and Neck1
2RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
2TerminatedTreatmentCancer of Larynx1
2TerminatedTreatmentCancer, Ovarian1
2TerminatedTreatmentCervix Cancer1
2TerminatedTreatmentColorectal Cancers8
2TerminatedTreatmentColorectal Cancers / Metastases1
2TerminatedTreatmentEsophageal Cancers3
2TerminatedTreatmentGlioblastomas1
2TerminatedTreatmentHead and Neck Carcinoma1
2TerminatedTreatmentHead and Neck Carcinoma / Squamous Carcinoma1
2TerminatedTreatmentHead and Neck Squamous Cell Cancer1
2TerminatedTreatmentHuman Papilloma Virus (HPV) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2TerminatedTreatmentLaryngeal Neoplasms / Mouth Neoplasms / Neoplasms, Head and Neck / Neoplasms, Pharyngeal1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2TerminatedTreatmentLung Cancers1
2TerminatedTreatmentMetastatic Colorectal Cancers6
2TerminatedTreatmentMultiple Myeloma (MM)1
2TerminatedTreatmentNasopharyngeal Carcinoma1
2TerminatedTreatmentNeoplasms, Colorectal1
2TerminatedTreatmentPancreatic Cancer Metastatic1
2TerminatedTreatmentProstatic Neoplasms1
2TerminatedTreatmentRectal Carcinoma1
2TerminatedTreatmentResectable Esophageal Cancer1
2TerminatedTreatmentSquamous Cell Cancers of the Head and Neck1
2TerminatedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Unknown StatusBasic ScienceMetastatic Colorectal Cancers1
2Unknown StatusPreventionHead and Neck Carcinoma1
2Unknown StatusTreatmentAnal Carcinoma1
2Unknown StatusTreatmentCancer of the Cervix1
2Unknown StatusTreatmentCarcinoma NOS / Unknown Primary Neoplasms1
2Unknown StatusTreatmentCarcinoma, Colorectal1
2Unknown StatusTreatmentCholangiocarcinomas1
2Unknown StatusTreatmentColorectal Cancers3
2Unknown StatusTreatmentColorectal Cancers / Hepatic Metastases1
2Unknown StatusTreatmentColorectal Cancers / Metastatic Cancers2
2Unknown StatusTreatmentColorectal Cancers / Peritoneal Cavity Cancer1
2Unknown StatusTreatmentEsophageal Cancers2
2Unknown StatusTreatmentHead Neck Cancer Squamous Cell1
2Unknown StatusTreatmentHead and Neck Carcinoma4
2Unknown StatusTreatmentHepatic Lesions / Hepatic Metastases / Metastatic Colorectal Cancers1
2Unknown StatusTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2Unknown StatusTreatmentMetastatic Colorectal Cancers2
2Unknown StatusTreatmentNasopharyngeal Carcinoma1
2Unknown StatusTreatmentNeoadjuvant Treatment / Rectal Neoplasms1
2Unknown StatusTreatmentNeoplasms, Oropharyngeal1
2Unknown StatusTreatmentRectal Carcinoma2
2Unknown StatusTreatmentRecurrent or Metastatic Disease / Squamous Cell Head and Neck Carcinoma1
2Unknown StatusTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Unknown StatusTreatmentSquamous Cell Carcinoma of the Head / Squamous Cell Carcinoma of the Neck1
2WithdrawnNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Lung1
2WithdrawnTreatmentColorectal Cancers2
2WithdrawnTreatmentColorectal Cancers / Malignant Neoplasm of Colon1
2WithdrawnTreatmentHead and Neck Carcinoma2
2WithdrawnTreatmentLung Cancers1
2WithdrawnTreatmentMalignant Neoplasm of Pancreas1
2WithdrawnTreatmentMetastatic Colorectal Cancers1
2WithdrawnTreatmentOesophageal Carcinoma1
2WithdrawnTreatmentSquamous Cell Carcinoma of the Penis1
2, 3Active Not RecruitingTreatmentStage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVA Verrucous Carcinoma of the Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Verrucous Carcinoma of the Larynx / Stage IVB Verrucous Carcinoma of the Oral Cavity / Tongue Cancer1
2, 3CompletedDiagnosticColorectal Cancers1
2, 3Not Yet RecruitingTreatmentColorectal Cancers2
2, 3Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Stage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v71
2, 3RecruitingTreatmentColorectal Cancer Stage IV / Metastasis1
2, 3RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2, 3Unknown StatusTreatmentEsophageal Cancers1
3Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Esophageal Cancers1
3Active Not RecruitingTreatmentColorectal Cancers1
3Active Not RecruitingTreatmentEsophageal Cancers1
3Active Not RecruitingTreatmentFollicular Lymphoma (FL)1
3Active Not RecruitingTreatmentHNSCC1
3Active Not RecruitingTreatmentHead and Neck Carcinoma1
3Active Not RecruitingTreatmentHead and Neck Carcinoma / Precancerous Conditions1
3Active Not RecruitingTreatmentHead and Neck Squamous Cell Cancer1
3Active Not RecruitingTreatmentLung Cancers / Radiation Toxicity1
3Active Not RecruitingTreatmentMetastatic Colorectal Cancers3
3Active Not RecruitingTreatmentMetastatic Head and Neck Cancer / Recurrent Head and Neck Cancer1
3Active Not RecruitingTreatmentRecurrent Large Cell Lung Carcinoma / Recurrent Lung Adenocarcinoma / Recurrent Squamous Cell Lung Carcinoma / Stage IV Large Cell Lung Carcinoma / Stage IV Lung Adenocarcinoma / Stage IV Squamous Cell Lung Carcinoma1
3Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)3
3CompletedTreatmentAdenocarcinoma of the Colon / Stage III Colon Cancer1
3CompletedTreatmentColorectal Cancers5
3CompletedTreatmentColorectal Cancers / Quality of Life1
3CompletedTreatmentEpidermal Growth Factor Receptor (EGFR) Expressing Metastatic Colorectal Cancer1
3CompletedTreatmentHead and Neck Carcinoma1
3CompletedTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
3CompletedTreatmentMalignant Neoplasm of Pancreas1
3CompletedTreatmentMalignant Neoplasm of Stomach1
3CompletedTreatmentMetastatic Colorectal Cancers3
3CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
3Not Yet RecruitingTreatmentHNSCC1
3RecruitingTreatmentAntineoplastic Agents1
3RecruitingTreatmentBRAF V600E-mutant Metastatic Colorectal Cancer1
3RecruitingTreatmentCarcinoma, Colorectal1
3RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck1
3RecruitingTreatmentHPV Positive Oropharyngeal Squamous Cell Carcinoma1
3RecruitingTreatmentHead Neck Cancer Squamous Cell Recurrent1
3RecruitingTreatmentHead and Neck Carcinoma2
3RecruitingTreatmentLaryngeal Squamous Cell Carcinoma Stage III / Laryngeal Squamous Cell Carcinoma Stage IV / Locally Advanced Malignant Neoplasm / Oropharyngeal Squamous Cell Carcinoma Stage III / Oropharyngeal Squamous Cell Carcinoma Stage IV / Squamous Cell Carcinoma of the Hypopharynx Stage III / Squamous Cell Carcinoma of the Hypopharynx Stage IV / Squamous Cell Carcinoma of the Oral Cavity Stage III / Squamous Cell Carcinoma of the Oral Cavity Stage IV1
3RecruitingTreatmentLocally Advanced Head and Neck Cancer1
3RecruitingTreatmentMetastatic Colorectal Cancers1
3RecruitingTreatmentNasopharyngeal Carcinoma1
3RecruitingTreatmentOropharyngeal Squamous Cell Carcinoma1
3TerminatedTreatmentColorectal Cancers1
3TerminatedTreatmentHead and Neck Carcinoma1
3TerminatedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
3Unknown StatusTreatmentColorectal Cancers2
3Unknown StatusTreatmentColorectal Cancers / Metastatic Cancers1
3Unknown StatusTreatmentColorectal Cancers / Neoplasms Metastasis1
3Unknown StatusTreatmentMetastatic Colorectal Cancers / Skin Toxicities1
3WithdrawnTreatmentColorectal Cancers1
4Active Not RecruitingTreatmentMetastatic Colorectal Cancers1
4RecruitingTreatmentNeoplasms, Head and Neck1
4TerminatedTreatmentColorectal Cancers / Neoplasms Metastasis1
4Unknown StatusTreatmentHead and Neck Carcinoma1
4Unknown StatusTreatmentNeoplasms Metastasis / Neoplasms, Colorectal / Neoplasms, Hepatic1
Not AvailableActive Not RecruitingNot AvailableMetastatic Colorectal Cancers1
Not AvailableActive Not RecruitingTreatmentHpv / Squamous Cell Carcinoma of the Oropharynx1
Not AvailableCompletedNot AvailableColorectal Cancers1
Not AvailableCompletedNot AvailableHead and Neck Carcinoma3
Not AvailableCompletedNot AvailableMetastatic Colorectal Cancers2
Not AvailableCompletedNot AvailableNeoplasms, Colorectal1
Not AvailableCompletedTreatmentColorectal Cancers1
Not AvailableCompletedTreatmentColorectal Cancers / Liver Metastasis1
Not AvailableCompletedTreatmentMalignant Neoplasm of Pancreas2
Not AvailableCompletedTreatmentMetastatic Colorectal Cancers1
Not AvailableRecruitingTreatmentRecurrent Skin Cancer / Squamous Cell Carcinoma of the Skin1
Not AvailableSuspendedTreatmentStage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Verrucous Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Verrucous Carcinoma of the Larynx / Tongue Cancer1
Not AvailableTerminatedNot AvailableLA SCCHN / Unresectable Locally Advanced Squamous Cell Carcinoma of Head and Neck1
Not AvailableTerminatedNot AvailableNeoplasms, Colorectal2
Not AvailableTerminatedNot AvailableSquamous Cell Carcinoma (SCC)1
Not AvailableTerminatedTreatmentAdenocarcinoma Of Esophagus1
Not AvailableTerminatedTreatmentHead and Neck Carcinoma1
Not AvailableTerminatedTreatmentHead and Neck Squamous Cell Cancer1
Not AvailableUnknown StatusNot AvailableEpidermoid Head and Neck Cancer1
Not AvailableWithdrawnNot AvailableNeoplasms, Squamous Cell1
Not AvailableWithdrawnTreatmentColorectal Cancers / Hepatic Metastases1
Not AvailableWithdrawnTreatmentHead and Neck Carcinoma1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous5 mg/ml
SolutionIntravenous2 mg
SolutionIntravenous2 mg/mL
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1340417 No1999-03-022016-03-02Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.413Not Available
isoelectric point8.48Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Ubiquitin protein ligase binding
Specific Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TG...
Gene Name
EGFR
Uniprot ID
P00533
Uniprot Name
Epidermal growth factor receptor
Molecular Weight
134276.185 Da
References
  1. Hosokawa N, Yamamoto S, Uehara Y, Hori M, Tsuchiya KS: Effect of thiazinotrienomycin B, an ansamycin antibiotic, on the function of epidermal growth factor receptor in human stomach tumor cells. J Antibiot (Tokyo). 1999 May;52(5):485-90. [PubMed:10480573 ]
  2. Wakita H, Takigawa M: Activation of epidermal growth factor receptor promotes late terminal differentiation of cell-matrix interaction-disrupted keratinocytes. J Biol Chem. 1999 Dec 24;274(52):37285-91. [PubMed:10601294 ]
  3. Suwa T, Ueda M, Jinno H, Ozawa S, Kitagawa Y, Ando N, Kitajima M: Epidermal growth factor receptor-dependent cytotoxic effect of anti-EGFR antibody-ribonuclease conjugate on human cancer cells. Anticancer Res. 1999 Sep-Oct;19(5B):4161-5. [PubMed:10628369 ]
  4. Burke P, Schooler K, Wiley HS: Regulation of epidermal growth factor receptor signaling by endocytosis and intracellular trafficking. Mol Biol Cell. 2001 Jun;12(6):1897-910. [PubMed:11408594 ]
  5. Viloria-Petit A, Crombet T, Jothy S, Hicklin D, Bohlen P, Schlaeppi JM, Rak J, Kerbel RS: Acquired resistance to the antitumor effect of epidermal growth factor receptor-blocking antibodies in vivo: a role for altered tumor angiogenesis. Cancer Res. 2001 Jul 1;61(13):5090-101. [PubMed:11431346 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Snyder LC, Astsaturov I, Weiner LM: Overview of monoclonal antibodies and small molecules targeting the epidermal growth factor receptor pathway in colorectal cancer. Clin Colorectal Cancer. 2005 Nov;5 Suppl 2:S71-80. [PubMed:16336752 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Negri DR, Tosi E, Valota O, Ferrini S, Cambiaggi A, Sforzini S, Silvani A, Ruffini PA, Colnaghi MI, Canevari S: In vitro and in vivo stability and anti-tumour efficacy of an anti-EGFR/anti-CD3 F(ab')2 bispecific monoclonal antibody. Br J Cancer. 1995 Oct;72(4):928-33. [PubMed:7547242 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Drug created on June 13, 2005 07:24 / Updated on September 01, 2017 15:53