Identification

Name
Cetuximab
Accession Number
DB00002  (BTD00071, BIOD00071)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Cetuximab is an epidermal growth factor receptor binding FAB. Cetuximab is composed of the Fv (variable; antigen-binding) regions of the 225 murine EGFr monoclonal antibody specific for the N-terminal portion of human EGFr with human IgG1 heavy and kappa light chain constant (framework) regions. Cetuximab is marketed under the brand Erbitux® by Eli Lilly and Company. In the United States, a regimen of cetuximab costs approximately $30,790 for an eight-week course.

Protein structure
Db00002
Protein chemical formula
C6484H10042N1732O2023S36
Protein average weight
145781.6 Da
Sequences
>Cetuximab heavy chain
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYN
TPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Cetuximab light chain
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPS
RFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Cetuximab
  • Cétuximab
  • Cetuximabum
  • Immunoglobulin G 1 (human-mouse monoclonal C 225 gamma 1 - chain anti-human epidermal growt factor receptor), disulfide wit human-mouse monoclonal C 225 kappa - chain, dimer
External IDs
BMS 564717 / C225
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ErbituxSolution2 mg/1mLIntravenousIm Clone Llc2004-02-12Not applicableUs
ErbituxSolution2 mgIntravenousIm Clone Llc2008-10-28Not applicableCanada
ErbituxInjection, solution5 mg/mlIntravenousMerck K Ga A2004-06-29Not applicableEu
ErbituxSolution2 mg/1mLIntravenousIm Clone Llc2007-10-02Not applicableUs
ErbituxInjection, solution5 mg/mlIntravenousMerck K Ga A2004-06-29Not applicableEu
Categories
UNII
PQX0D8J21J
CAS number
205923-56-4

Pharmacology

Indication

Cetuximab, used in combination with irinotecan, is indicated for the treatment of EGFR-expressing, metastatic colorectal carcinoma in patients who are refractory to irinotecan-based chemotherapy. Cetuximab administered as a single agent is indicated for the treatment of EGFR-expressing, metastatic colorectal carcinoma in patients who are intolerant to irinotecan-based chemotherapy.

Associated Conditions
Pharmacodynamics

Used in the treatment of colorectal cancer, cetuximab binds specifically to the epidermal growth factor receptor (EGFr, HER1, c-ErbB-1) on both normal and tumor cells. EGFr is over-expressed in many colorectal cancers. Cetuximab competitively inhibits the binding of epidermal growth factor (EGF) and other ligands, such as transforming growth factor–alpha. Binding of cetuximab to the EGFr blocks phosphorylation and activation of receptor-associated kinases, resulting in inhibition of cell growth, induction of apoptosis, decreased matrix metalloproteinase secretion and reduced vascular endothelial growth factor production.

Mechanism of action

Cetuximab binds to the epidermal growth factor receptor (EGFr) on both normal and tumor cells. EGFr is over-expressed in many colorectal cancers. Cetuximab competitively inhibits the binding of epidermal growth factor (EGF) and TGF alpha, thereby reducing their effects on cell growth and metastatic spread.

TargetActionsOrganism
AEpidermal growth factor receptor
antagonist
Human
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
Absorption
Not Available
Volume of distribution

appeared to be independent of dose and approximated the vascular space of 2-3 L/m2.

Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

The mean half-life for Cetuximab is 114 hours (range 75-188 hours).

Clearance

Female patients had 25% lower intrinsic clearance than male patients.

Toxicity

Pulmonary Toxicity

Interstitial lung disease (ILD) was reported in 3 of 633 (<0.5%) patients with advanced colorectal cancer receiving cetuximab. Interstitial pneumonitis with non-cardiogenic pulmonary edema resulting in death was reported in one case. Two patients had pre-existing fibrotic lung disease and experienced an acute exacerbation of their disease while receiving cetuximab in combination with irinotecan. In the clinical investigational program, an additional case of interstitial pneumonitis was reported in a patient with head and neck cancer treated with cetuximab and cisplatin. The onset of symptoms occurred between the fourth and eleventh doses of treatment in all reported cases.

Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Cetuximab Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Interacting Gene/EnzymeAllele nameGenotype(s)Defining Change(s)Type(s)DescriptionDetails
Low affinity immunoglobulin gamma Fc region receptor II-a---(T;T) / (C;T)H allelleEffect Directly StudiedPatients with this genotype may have increased progression-free survival time when using cetuximab to treat colorectal cancer.Details
Low affinity immunoglobulin gamma Fc region receptor III-A---(T;T) / (G;T)G > TEffect Directly StudiedPatients with this genotype have increased progression-free survival time when using cetuximab to treat colorectal cancer.Details

Interactions

Drug Interactions
DrugInteractionDrug group
AbciximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Abciximab.Approved
AbituzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Abituzumab.Investigational
AdalimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Adalimumab.Approved
AdecatumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Adecatumumab.Investigational
AducanumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Aducanumab.Investigational
AfelimomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Afelimomab.Investigational
AlemtuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Alemtuzumab.Approved, Investigational
AlirocumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Alirocumab.Approved
AmatuximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Amatuximab.Investigational
AMG 108The risk or severity of adverse effects can be increased when Cetuximab is combined with AMG 108.Investigational
AnifrolumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Anifrolumab.Investigational
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Cetuximab is combined with Antilymphocyte immunoglobulin (horse).Approved, Investigational
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Cetuximab is combined with Antithymocyte immunoglobulin (rabbit).Approved
ApolizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Apolizumab.Investigational
AscrinvacumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ascrinvacumab.Investigational
Asfotase AlfaThe risk or severity of adverse effects can be increased when Cetuximab is combined with Asfotase Alfa.Approved, Investigational
AtezolizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Atezolizumab.Approved, Investigational
AVE9633The risk or severity of adverse effects can be increased when Cetuximab is combined with AVE9633.Investigational
AvelumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Avelumab.Approved, Investigational
BapineuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Bapineuzumab.Investigational
BasiliximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Basiliximab.Approved, Investigational
BavituximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Bavituximab.Investigational
BectumomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Bectumomab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Belimumab.Approved
BesilesomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Besilesomab.Approved
BevacizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Bevacizumab.Approved, Investigational
BIIB015The risk or severity of adverse effects can be increased when Cetuximab is combined with BIIB015.Investigational
BimagrumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Bimagrumab.Investigational
BivatuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Bivatuzumab.Investigational
BlinatumomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Blinatumomab.Approved, Investigational
BlosozumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Blosozumab.Investigational
BococizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Bococizumab.Investigational
Brentuximab vedotinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Brentuximab vedotin.Approved, Investigational
BriakinumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Briakinumab.Investigational
BrodalumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Brodalumab.Approved, Investigational
CanakinumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Canakinumab.Approved, Investigational
CaplacizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Caplacizumab.Investigational
Capromab pendetideThe risk or severity of adverse effects can be increased when Cetuximab is combined with Capromab pendetide.Approved
CarlumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Carlumab.Investigational
CatumaxomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Catumaxomab.Approved, Investigational, Withdrawn
Certolizumab pegolThe risk or severity of adverse effects can be increased when Cetuximab is combined with Certolizumab pegol.Approved
CixutumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Cixutumumab.Investigational
ClazakizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Clazakizumab.Investigational
ClenoliximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Clenoliximab.Investigational
Coltuximab ravtansineThe risk or severity of adverse effects can be increased when Cetuximab is combined with Coltuximab ravtansine.Investigational
ConatumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Conatumumab.Investigational
ConcizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Concizumab.Investigational
CR002The risk or severity of adverse effects can be increased when Cetuximab is combined with CR002.Investigational
CrenezumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Crenezumab.Investigational
CrotedumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Crotedumab.Investigational
DacetuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Dacetuzumab.Investigational
DaclizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Daclizumab.Investigational, Withdrawn
DalotuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Dalotuzumab.Investigational
DaratumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Daratumumab.Approved
DemcizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Demcizumab.Investigational
DenosumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Denosumab.Approved
DepatuxizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Depatuxizumab.Investigational
Depatuxizumab mafodotinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Depatuxizumab mafodotin.Investigational
Digoxin Immune Fab (Ovine)The risk or severity of adverse effects can be increased when Cetuximab is combined with Digoxin Immune Fab (Ovine).Approved
DinutuximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Dinutuximab.Approved, Investigational
DulaglutideThe risk or severity of adverse effects can be increased when Cetuximab is combined with Dulaglutide.Approved, Investigational
DuligotuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Duligotuzumab.Investigational
DupilumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Dupilumab.Approved, Investigational
DurvalumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Durvalumab.Approved, Investigational
DusigitumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Dusigitumab.Investigational
EculizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Eculizumab.Approved, Investigational
EdrecolomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Edrecolomab.Experimental, Investigational
EfalizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Efalizumab.Approved, Investigational
EldelumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Eldelumab.Investigational
ElotuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Elotuzumab.Approved
EmibetuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Emibetuzumab.Investigational
EmicizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Emicizumab.Approved, Investigational
EnokizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Enokizumab.Investigational
EpratuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Epratuzumab.Investigational
EtaracizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Etaracizumab.Investigational
EtrolizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Etrolizumab.Investigational
EvolocumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Evolocumab.Approved
FanolesomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Fanolesomab.Experimental
FarletuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Farletuzumab.Investigational
FiclatuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ficlatuzumab.Investigational
FigitumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Figitumumab.Investigational
FontolizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Fontolizumab.Investigational
FremanezumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Fremanezumab.Investigational
FresolimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Fresolimumab.Investigational
FulranumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Fulranumab.Investigational
GaliximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Galiximab.Investigational
GanitumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ganitumab.Investigational
GantenerumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Gantenerumab.Investigational
Gemtuzumab ozogamicinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Gemtuzumab ozogamicin.Approved, Investigational
GevokizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Gevokizumab.Investigational
Glembatumumab vedotinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Glembatumumab vedotin.Investigational
GolimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Golimumab.Approved
GuselkumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Guselkumab.Approved, Investigational
Human cytomegalovirus immune globulinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Human cytomegalovirus immune globulin.Approved
Human Varicella-Zoster Immune GlobulinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Human Varicella-Zoster Immune Globulin.Approved
IbalizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ibalizumab.Approved, Investigational
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ibritumomab tiuxetan.Approved, Investigational
IdarucizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Idarucizumab.Approved
IGN311The risk or severity of adverse effects can be increased when Cetuximab is combined with IGN311.Investigational
IMC-1C11The risk or severity of adverse effects can be increased when Cetuximab is combined with IMC-1C11.Investigational
Immune Globulin HumanThe risk or severity of adverse effects can be increased when Cetuximab is combined with Immune Globulin Human.Approved, Investigational
InclacumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Inclacumab.Investigational
Indium In-111 satumomab pendetideThe risk or severity of adverse effects can be increased when Cetuximab is combined with Indium In-111 satumomab pendetide.Approved, Withdrawn
InebilizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Inebilizumab.Investigational
InfliximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Infliximab.Approved
Inotuzumab ozogamicinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Inotuzumab ozogamicin.Approved, Investigational
IntetumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Intetumumab.Investigational
IPH 2101The risk or severity of adverse effects can be increased when Cetuximab is combined with IPH 2101.Investigational
IpilimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ipilimumab.Approved
IratumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Iratumumab.Investigational
IxekizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ixekizumab.Approved, Investigational
LabetuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Labetuzumab.Investigational
LampalizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Lampalizumab.Investigational
LandogrozumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Landogrozumab.Investigational
LerdelimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Lerdelimumab.Investigational
LeronlimabThe risk or severity of adverse effects can be increased when Cetuximab is combined with PRO 140.Investigational
LexatumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Lexatumumab.Investigational
LigelizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ligelizumab.Investigational
Lorvotuzumab mertansineThe risk or severity of adverse effects can be increased when Cetuximab is combined with Lorvotuzumab mertansine.Investigational
LucatumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Lucatumumab.Investigational
LumiliximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Lumiliximab.Investigational
MatuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Matuzumab.Investigational
MavrilimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Mavrilimumab.Investigational
MepolizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Mepolizumab.Approved, Investigational
MilatuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Milatuzumab.Investigational
Mirvetuximab SoravtansineThe risk or severity of adverse effects can be increased when Cetuximab is combined with Mirvetuximab Soravtansine.Investigational
MogamulizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Mogamulizumab.Approved, Investigational
MotavizumabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Cetuximab.Investigational
MuromonabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Muromonab.Approved, Investigational
MYO-029The risk or severity of adverse effects can be increased when Cetuximab is combined with MYO-029.Investigational
Naptumomab EstafenatoxThe risk or severity of adverse effects can be increased when Cetuximab is combined with Naptumomab Estafenatox.Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Natalizumab.Approved, Investigational
NebacumabThe risk or severity of adverse effects can be increased when Nebacumab is combined with Cetuximab.Experimental
NecitumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Necitumumab.Approved, Investigational
NimotuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Nimotuzumab.Investigational
NivolumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Nivolumab.Approved
ObiltoxaximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Obiltoxaximab.Approved
ObinutuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Obinutuzumab.Approved, Investigational
OcrelizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ocrelizumab.Approved, Investigational
OfatumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ofatumumab.Approved
OlaratumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Olaratumab.Approved, Investigational
OlokizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Olokizumab.Investigational
OmalizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Omalizumab.Approved, Investigational
OnartuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Onartuzumab.Investigational
OregovomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Oregovomab.Investigational
OtelixizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Otelixizumab.Investigational
OzanezumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ozanezumab.Investigational
PalivizumabThe risk or severity of adverse effects can be increased when Palivizumab is combined with Cetuximab.Approved, Investigational
PanitumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Panitumumab.Approved, Investigational
PatritumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Patritumab.Investigational
PembrolizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Pembrolizumab.Approved
PertuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Pertuzumab.Approved
PexelizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Pexelizumab.Investigational
Polatuzumab VedotinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Polatuzumab Vedotin.Investigational
PRO-542The risk or severity of adverse effects can be increased when Cetuximab is combined with PRO-542.Investigational
RacotumomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Racotumomab.Investigational
RamucirumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ramucirumab.Approved, Investigational
RanibizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ranibizumab.Approved
RaxibacumabThe risk or severity of adverse effects can be increased when Raxibacumab is combined with Cetuximab.Approved
ReslizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Reslizumab.Approved, Investigational
RI 624The risk or severity of adverse effects can be increased when Cetuximab is combined with RI 624.Investigational
RIGScan CR49The risk or severity of adverse effects can be increased when Cetuximab is combined with RIGScan CR49.Investigational
RilotumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Rilotumumab.Investigational
RituximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Rituximab.Approved
RobatumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Robatumumab.Investigational
RomosozumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Romosozumab.Investigational
RontalizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Rontalizumab.Investigational
Sacituzumab govitecanThe risk or severity of adverse effects can be increased when Cetuximab is combined with Sacituzumab govitecan.Investigational
SarilumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Sarilumab.Approved, Investigational
SecukinumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Secukinumab.Approved
SeribantumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Seribantumab.Investigational
SibrotuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Sibrotuzumab.Investigational
SiltuximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Siltuximab.Approved, Investigational
SiplizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Siplizumab.Investigational
SirukumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Sirukumab.Investigational
SolanezumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Solanezumab.Investigational
SotaterceptThe risk or severity of adverse effects can be increased when Cetuximab is combined with Sotatercept.Investigational
SulesomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Sulesomab.Approved
SYM001The risk or severity of adverse effects can be increased when Cetuximab is combined with SYM001.Investigational
TabalumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tabalumab.Investigational
TanezumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tanezumab.Investigational
TarextumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tarextumab.Investigational
TB-402The risk or severity of adverse effects can be increased when Cetuximab is combined with TB-402.Investigational
Technetium Tc-99m arcitumomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Technetium Tc-99m arcitumomab.Approved, Investigational
TeplizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Teplizumab.Investigational
TeprotumumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with R1507.Investigational
Tetanus Immune GlobulinThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tetanus Immune Globulin.Approved
TildrakizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tildrakizumab.Approved, Investigational
TNX-901The risk or severity of adverse effects can be increased when Cetuximab is combined with TNX-901.Investigational
TocilizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tocilizumab.Approved
TositumomabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tositumomab.Approved, Investigational
TovetumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tovetumab.Investigational
TralokinumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tralokinumab.Investigational
TrastuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Trastuzumab.Approved, Investigational
Trastuzumab emtansineThe risk or severity of adverse effects can be increased when Cetuximab is combined with Trastuzumab emtansine.Approved, Investigational
TRC105The risk or severity of adverse effects can be increased when Cetuximab is combined with TRC105.Investigational
TremelimumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Tremelimumab.Investigational
UstekinumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Ustekinumab.Approved, Investigational
VedolizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Vedolizumab.Approved
VeltuzumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Veltuzumab.Investigational
VisilizumabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Visilizumab.Investigational
VolociximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Volociximab.Investigational
XmAb 2513The risk or severity of adverse effects can be increased when Cetuximab is combined with XmAb 2513.Investigational
XTL-001The risk or severity of adverse effects can be increased when Cetuximab is combined with XTL-001.Investigational
Food Interactions
Not Available

References

General References
  1. Hosokawa N, Yamamoto S, Uehara Y, Hori M, Tsuchiya KS: Effect of thiazinotrienomycin B, an ansamycin antibiotic, on the function of epidermal growth factor receptor in human stomach tumor cells. J Antibiot (Tokyo). 1999 May;52(5):485-90. [PubMed:10480573]
  2. Wakita H, Takigawa M: Activation of epidermal growth factor receptor promotes late terminal differentiation of cell-matrix interaction-disrupted keratinocytes. J Biol Chem. 1999 Dec 24;274(52):37285-91. [PubMed:10601294]
  3. Suwa T, Ueda M, Jinno H, Ozawa S, Kitagawa Y, Ando N, Kitajima M: Epidermal growth factor receptor-dependent cytotoxic effect of anti-EGFR antibody-ribonuclease conjugate on human cancer cells. Anticancer Res. 1999 Sep-Oct;19(5B):4161-5. [PubMed:10628369]
  4. Burke P, Schooler K, Wiley HS: Regulation of epidermal growth factor receptor signaling by endocytosis and intracellular trafficking. Mol Biol Cell. 2001 Jun;12(6):1897-910. [PubMed:11408594]
  5. Viloria-Petit A, Crombet T, Jothy S, Hicklin D, Bohlen P, Schlaeppi JM, Rak J, Kerbel RS: Acquired resistance to the antitumor effect of epidermal growth factor receptor-blocking antibodies in vivo: a role for altered tumor angiogenesis. Cancer Res. 2001 Jul 1;61(13):5090-101. [PubMed:11431346]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  7. Schrag D: The price tag on progress--chemotherapy for colorectal cancer. N Engl J Med. 2004 Jul 22;351(4):317-9. [PubMed:15269308]
  8. Snyder LC, Astsaturov I, Weiner LM: Overview of monoclonal antibodies and small molecules targeting the epidermal growth factor receptor pathway in colorectal cancer. Clin Colorectal Cancer. 2005 Nov;5 Suppl 2:S71-80. [PubMed:16336752]
External Links
Genbank
J00228
KEGG Drug
D03455
PubChem Substance
46507042
ChEMBL
CHEMBL1201577
Therapeutic Targets Database
DNC000788
PharmGKB
PA10040
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Cetuximab
ATC Codes
L01XC06 — Cetuximab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (73.8 KB)
MSDS
Download (84.4 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedDiagnosticHead and Neck Carcinoma1
0TerminatedBasic ScienceHepatic Metastases / Metastatic Colon Cancer / Mucinous Adenocarcinoma of the Colon / Mucinous Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Signet Ring Adenocarcinoma of the Colon / Signet Ring Adenocarcinoma of the Rectum / Stage IV Rectal Cancer1
1Active Not RecruitingOtherCarcinoma, Squamous Cell of Head and Neck / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Squamous Cell Carcinoma, Head And Neck1
1Active Not RecruitingTreatmentAdvanced Cancers1
1Active Not RecruitingTreatmentCancer, Advanced1
1Active Not RecruitingTreatmentHead and Neck Squamous Cell Cancer1
1Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1Active Not RecruitingTreatmentLocally Advanced Cancer in the Anal Region1
1Active Not RecruitingTreatmentRecurrent Colon Carcinoma / Recurrent Hypopharyngeal Squamous Cell Carcinoma / Recurrent Laryngeal Squamous Cell Carcinoma / Recurrent Laryngeal Verrucous Carcinoma / Recurrent Lip and Oral Cavity Squamous Cell Carcinoma / Recurrent Metastatic Squamous Cell Carcinoma in the Neck With Occult Primary / Recurrent Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Recurrent Nasopharyngeal Keratinizing Squamous Cell Carcinoma / Recurrent Oral Cavity Verrucous Carcinoma / Recurrent Oropharyngeal Squamous Cell Carcinoma / Recurrent Rectal Carcinoma / Recurrent Salivary Gland Carcinoma / Salivary Gland Squamous Cell Carcinoma / Squamous Cell Carcinoma Metastatic in the Neck With Occult Primary / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Nasopharyngeal Keratinizing Squamous Cell Carcinoma / Stage IV Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage IVA Colon Cancer / Stage IVA Colon Cancer AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Verrucous Carcinoma / Stage IVA Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Major Salivary Gland Cancer AJCC v7 / Stage IVA Major Salivary Gland Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVA Oral Cavity Verrucous Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Rectal Cancer / Stage IVA Rectal Cancer AJCC v7 / Stage IVB Colon Cancer / Stage IVB Colon Cancer AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Verrucous Carcinoma / Stage IVB Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Major Salivary Gland Cancer AJCC v7 / Stage IVB Major Salivary Gland Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Verrucous Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Rectal Cancer / Stage IVB Rectal Cancer AJCC v7 / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Laryngeal Verrucous Carcinoma / Stage IVC Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVC Major Salivary Gland Cancer AJCC v7 / Stage IVC Major Salivary Gland Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Verrucous Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Tongue Carcinoma / Untreated Metastatic Squamous Cell Carcinoma to Neck With Occult Primary1
1Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
1Active Not RecruitingTreatmentStage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v71
1CompletedDiagnosticCancers / Refractory Solid Tumors1
1CompletedTreatmentAnaplastic Astrocytoma (AA) / ANAPLASTIC ASTROCYTOMA (AOA) / GBM / Glioblastoma Multiforme (GBM)1
1CompletedTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Small Cell Carcinoma / Cervical Squamous Cell Carcinoma / Stage IB Cervical Cancer / Stage IIA Cervical Cancer / Stage IIB Cervical Cancer / Stage III Cervical Cancer / Stage IVA Cervical Cancer1
1CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Advanced Adult Primary Liver Cancer / Advanced Gastric Cancer / Carcinoma of the Appendix / Gastrointestinal Stromal Tumors / Metastatic Colon Cancer / Metastatic Gastrointestinal Carcinoid Tumor / Metastatic Squamous Neck Cancer With Occult Primary / Non-Small Cell Lung Cancer Recurrent / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Adult Primary Liver Cancer / Recurrent Anal Cancer / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Colon Cancer / Recurrent Esophageal Cancer / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Recurrent Gastric Cancer / Recurrent Gastrointestinal Carcinoid Tumor / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Pancreatic Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Recurrent Small Intestine Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Small Intestine Adenocarcinoma / Small Intestine Leiomyosarcoma / Small Intestine Lymphoma / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Anal Cancer / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esophageal Cancer / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Pancreatic Cancer / Stage IV Rectal Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Tongue Cancer / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer1
1CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Metastatic Colon Cancer / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage IV Rectal Cancer1
1CompletedTreatmentAdvanced Cancers2
1CompletedTreatmentAdvanced Nonhematologic Malignancies1
1CompletedTreatmentAdvanced Solid Tumors1
1CompletedTreatmentCancer of the Colon / Colon Neoplasms / Colonic Neoplasms / Malignant Neoplasm of Colon1
1CompletedTreatmentCancer, Advanced1
1CompletedTreatmentCancer, Advanced / Liver Cancer1
1CompletedTreatmentCancer, Breast / Colorectal Cancers / Head and Neck Carcinoma / Lung Cancers / Malignant Neoplasm of Pancreas / Renal Cancers / Sarcomas / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentCancers2
1CompletedTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
1CompletedTreatmentColorectal Adenocarcinoma / Colorectal Cancers1
1CompletedTreatmentColorectal Cancers6
1CompletedTreatmentColorectal Cancers / Head and Neck Carcinoma1
1CompletedTreatmentColorectal Cancers / Head and Neck Carcinoma / Lung Cancers1
1CompletedTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Other Tumors With EGFR Dependence / Squamous Cell Head and Neck Cancer / Triple Negative Breast Cancer (TNBC)1
1CompletedTreatmentColorectal Cancers / Neoplasms, Colorectal1
1CompletedTreatmentGastrointestinal Metastatic Cancer1
1CompletedTreatmentHead and Neck Carcinoma4
1CompletedTreatmentHead and Neck Carcinoma / Laryngeal Cancer / Oral Cancers / Pharyngeal Cancer / Squamous Carcinoma1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms Metastasis1
1CompletedTreatmentMalignant Neoplasm of Pancreas1
1CompletedTreatmentMalignant Neoplasm of Stomach / Precancerous Conditions1
1CompletedTreatmentMalignant Solid Tumours1
1CompletedTreatmentMetastatic Colon Cancer / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage III Colon Cancer / Stage III Rectal Cancer / Stage IV Rectal Cancer1
1CompletedTreatmentMetastatic Colorectal Cancers1
1CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVA Verrucous Carcinoma of the Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Verrucous Carcinoma of the Larynx / Stage IVB Verrucous Carcinoma of the Oral Cavity / Stage IVC Squamous Cell Carcinoma of the Larynx / Stage IVC Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVC Squamous Cell Carcinoma of the Oropharynx / Stage IVC Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Verrucous Carcinoma of the Larynx / Stage IVC Verrucous Carcinoma of the Oral Cavity / Tongue Cancer1
1CompletedTreatmentNeoplasms4
1CompletedTreatmentNeoplasms, Head and Neck1
1CompletedTreatmentRecurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Colon Cancer / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Stage IVA Colon Cancer / Stage IVA Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IVA Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IVA Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IVA Salivary Gland Cancer / Stage IVA Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Colon Cancer / Stage IVB Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IVB Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IVB Salivary Gland Cancer / Stage IVB Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IVC Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IVC Salivary Gland Cancer / Stage IVC Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Tongue Cancer1
1CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentRecurrent Head and Neck Cancer1
1CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1CompletedTreatmentTumors, Solid1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1Not Yet RecruitingTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
1Not Yet RecruitingTreatmentColorectal Cancers1
1Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1RecruitingTreatmentAdvanced Cancers2
1RecruitingTreatmentAdvanced Solid Tumors / Colorectal Cancers / EGFR Positive Solid Tumor / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular,Carcinoma / HER2 Positive Gastric Cancer / Her2-Positive Breast Cancer / Lung Cancer Small Cell Lung Cancer (SCLC) / Malignant Neoplasm of Pancreas / Renal Cell Adenocarcinoma1
1RecruitingTreatmentCancer of Head and Neck / Cancer, Breast / Tumors, Solid1
1RecruitingTreatmentCancer, Breast / Neoplasms Metastasis / Neoplasms, Colorectal1
1RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck1
1RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Squamous Cell Carcinoma (SCC)1
1RecruitingTreatmentColorectal Cancers / Head and Neck Carcinoma1
1RecruitingTreatmentColorectal Cancers / Malignant Neoplasms of Digestive Organs1
1RecruitingTreatmentCutaneous Squamous Cell Carcinoma / Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
1RecruitingTreatmentHead and Neck Squamous Cell Cancer / Metastatic Head and Neck Squamous Cell Cancer / Recurrent Head and Neck Squamous Cell Cancer1
1RecruitingTreatmentMetastatic Colorectal Cancers1
1RecruitingTreatmentNeoplasms, Head and Neck2
1RecruitingTreatmentPatients With Advanced or Metastatic Solid Tumors1
1RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1TerminatedTreatmentColon Mucinous Adenocarcinoma / Colon Signet Ring Cell Adenocarcinoma / Rectal Mucinous Adenocarcinoma / Rectal Signet Ring Cell Adenocarcinoma / Recurrent Colon Carcinoma / Recurrent Rectal Carcinoma / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
1TerminatedTreatmentColorectal Cancers1
1TerminatedTreatmentLung Cancers1
1TerminatedTreatmentMalignant Neoplasm of Colon1
1TerminatedTreatmentMalignant Neoplasm of Colon / Rectal Carcinoma1
1TerminatedTreatmentMetastatic Colorectal Cancers / Squamous Cell Carcinoma of Head and Neck (SCCHN) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1TerminatedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Tongue Cancer / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1TerminatedTreatmentNeoplasms1
1Unknown StatusTreatmentColorectal Cancers1
1Unknown StatusTreatmentMetastatic Breast Cancer (MBC)1
1WithdrawnTreatmentAdvanced Cancers1
1WithdrawnTreatmentColorectal Cancers1
1WithdrawnTreatmentStage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1WithdrawnTreatmentTumors1
1, 2Active Not RecruitingTreatmentCancer, Advanced / Cancer, Breast / Colorectal Cancers / Esophageal Cancers / Malignant Neoplasm of Stomach1
1, 2Active Not RecruitingTreatmentColorectal Cancers2
1, 2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Active Not RecruitingTreatmentLung Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
1, 2Active Not RecruitingTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IVA Salivary Gland Cancer / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVA Verrucous Carcinoma of the Oral Cavity / Stage IVB Salivary Gland Cancer / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Verrucous Carcinoma of the Larynx / Stage IVB Verrucous Carcinoma of the Oral Cavity / Stage IVC Salivary Gland Cancer / Stage IVC Squamous Cell Carcinoma of the Larynx / Stage IVC Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVC Squamous Cell Carcinoma of the Oropharynx / Stage IVC Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Verrucous Carcinoma of the Larynx / Stage IVC Verrucous Carcinoma of the Oral Cavity / Tongue Cancer1
1, 2CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Metastatic Colon Cancer / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage III Colon Cancer / Stage III Rectal Cancer / Stage IV Rectal Cancer1
1, 2CompletedTreatmentCancers of the Head and Neck / Neoplasms, Head and Neck1
1, 2CompletedTreatmentColorectal Cancers2
1, 2CompletedTreatmentEsophageal Cancers2
1, 2CompletedTreatmentHead and Neck Carcinoma3
1, 2CompletedTreatmentIncurable Metastatic Colorectal Carcinoma / Incurable Progressive, Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck1
1, 2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1, 2CompletedTreatmentMetastatic Colon Cancer / Metastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Non-Small Cell Lung Cancer Recurrent / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Colon Cancer / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Pancreatic Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Colon Cancer / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Lymphoepithelioma of the Oropharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Pancreatic Cancer / Stage III Rectal Cancer / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IIIb Non-small Cell Lung Cancer / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Pancreatic Cancer / Stage IV Rectal Cancer / Stage IV Renal Cell Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1, 2CompletedTreatmentMetastatic Colorectal Cancer (MCRC)1
1, 2CompletedTreatmentMetastatic Colorectal Cancers5
1, 2CompletedTreatmentNasopharyngeal Carcinoma1
1, 2CompletedTreatmentPancreatic Cancer Metastatic1
1, 2CompletedTreatmentPlatinum-Resistant Squamous Cell Carcinoma of the Head and Neck1
1, 2CompletedTreatmentRectal Carcinoma1
1, 2CompletedTreatmentSquamous Cell Cancer2
1, 2Not Yet RecruitingTreatmentAdvanced Colorectal Cancer1
1, 2Not Yet RecruitingTreatmentColorectal Cancers1
1, 2Not Yet RecruitingTreatmentHead and Neck Carcinoma / Locally Advanced / Unresectable1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Not Yet RecruitingTreatmentNeoplasms, Head and Neck1
1, 2RecruitingTreatmentAnaplastic Astrocytoma (AA) / Brain Stem Gliomas / Diffuse Intrinsic Pontine Glioma (DIPG) / Fibrillary Astrocytoma of Brain / Glioblastoma Multiforme (GBM) / Glioma of Brainstem / Mixed Oligodendroglioma-Astrocytoma / Pilomyxoid Astrocytoma1
1, 2RecruitingTreatmentCarcinoma, Adenoid Cystic1
1, 2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck3
1, 2RecruitingTreatmentColorectal Adenocarcinoma (CRC) / Gastric Adenocarcinoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / Squamous Cell Cancer / Squamous Cell Carcinoma of the Hypopharynx / Squamous Cell Carcinoma of the Larynx / Squamous Cell Carcinoma of the Oral Cavity / Squamous Cell Carcinoma of the Oropharynx / Squamous Cell Carcinoma of the Paranasal Sinus1
1, 2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Malignant Neoplasm of Nasopharynx1
1, 2RecruitingTreatmentHepatocellular Carcinoma Non-resectable / Recurrent Hepatocellular Carcinoma1
1, 2RecruitingTreatmentMCRC / Metastatic Colorectal Cancers1
1, 2RecruitingTreatmentNeoplasms, Colorectal / Tumors, Solid1
1, 2RecruitingTreatmentNeoplasms, Head and Neck1
1, 2RecruitingTreatmentNon-Small Cell Lung Cancer Recurrent1
1, 2RecruitingTreatmentRecurrent Colorectal Carcinoma / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1, 2RecruitingTreatmentSquamous Cell Carcinoma (SCC)2
1, 2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2TerminatedDiagnosticMalignant Gliomas / Neoplasms, Brain1
1, 2TerminatedTreatmentBasaloid Squamous Cell Carcinoma / Carcinoma, Adenosquamous Cell / Carcinoma, Undifferentiated / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2TerminatedTreatmentCarcinoma, Colorectal1
1, 2TerminatedTreatmentColo-rectal Cancer / Colon/Rectal Cancer / Colon/Rectal Cancer Rectal Cancer / Rectal Carcinoma1
1, 2TerminatedTreatmentColorectal Cancers / Head and Neck Carcinoma / Neoplasms Metastasis1
1, 2TerminatedTreatmentHead and Neck Carcinoma3
1, 2TerminatedTreatmentMalignant Neoplasm of Pancreas1
1, 2TerminatedTreatmentMalignant Neoplasm of Stomach1
1, 2TerminatedTreatmentMetastatic Cancers1
1, 2TerminatedTreatmentMetastatic Head and Neck Squamous Cell Carcinoma / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent or Metastatic Head and Neck Squamous Cell Carcinoma / Recurrent or Metastatic Head and Neck Squamous Cell Carcinoma (RM HNSCC) Patients Who Are Resistant or Ineligible/Intolerant to Platinum-based Chemotherapy1
1, 2TerminatedTreatmentNeoplasms1
1, 2TerminatedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1, 2Unknown StatusTreatmentEsophageal Cancers1
1, 2Unknown StatusTreatmentGlioblastoma Multiforme (GBM)1
1, 2Unknown StatusTreatmentMalignant Neoplasm of Pancreas1
1, 2Unknown StatusTreatmentTumors, Solid1
1, 2WithdrawnTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2WithdrawnTreatmentNeoplasms, Oropharyngeal / Oropharyngeal Cancers / Squamous Carcinoma / Squamous Cell Carcinoma (SCC)1
2Active Not RecruitingTreatmentAnal Carcinoma1
2Active Not RecruitingTreatmentC-met Overexpression / Metastatic Colorectal Cancers1
2Active Not RecruitingTreatmentCancer, Breast1
2Active Not RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck2
2Active Not RecruitingTreatmentCervical Cancers1
2Active Not RecruitingTreatmentColorectal Adenocarcinoma / KRAS wt Allele / Metastatic Colorectal Cancers / NRAS wt Allele / RAS Wild Type / Stage IV Colorectal Cancer / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
2Active Not RecruitingTreatmentColorectal Cancers6
2Active Not RecruitingTreatmentHead and Neck Carcinoma5
2Active Not RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)2
2Active Not RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Recurrent Head and Neck Carcinoma1
2Active Not RecruitingTreatmentLung Cancers1
2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2Active Not RecruitingTreatmentMetastatic Cancers1
2Active Not RecruitingTreatmentMetastatic Colorectal Cancers3
2Active Not RecruitingTreatmentNeoplasms by Site / Neoplasms, Head and Neck / Squamous Cell Cancers of the Head and Neck1
2Active Not RecruitingTreatmentNeoplasms, Esophageal1
2Active Not RecruitingTreatmentNeoplasms, Head and Neck1
2Active Not RecruitingTreatmentRectal Cancer Stage III1
2Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)3
2Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Hypopharynx Stage III / Squamous Cell Carcinoma of the Hypopharynx Stage IV / Squamous Cell Carcinoma of the Larynx Stage III / Squamous Cell Carcinoma of the Larynx Stage IV / Squamous Cell Carcinoma of the Oral Cavity Stage III / Squamous Cell Carcinoma of the Oral Cavity Stage IV / Squamous Cell Carcinoma of the Oropharynx Stage III / Squamous Cell Carcinoma of the Oropharynx Stage IV1
2Active Not RecruitingTreatmentMCRC1
2CompletedNot AvailableMalignant Gliomas1
2CompletedNot AvailableTumors, Solid2
2CompletedDiagnosticCancers1
2CompletedScreeningColorectal Cancers1
2CompletedTreatmentAbdominal wall neoplasm / Cancer of the Ovary / Fallopian Tube Neoplasms1
2CompletedTreatmentAdenocarcinoma Of Esophagus / Squamous Cell Carcinoma of Esophagus1
2CompletedTreatmentAdenocarcinoma of Colon / Adenocarcinoma of Rectum / Metastatic Disease1
2CompletedTreatmentAdenocarcinoma of Gallbladder / Cholangiocarcinomas1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Non-Small Cell Lung Cancer Recurrent / Squamous Cell Carcinoma of Lung / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Large Cell Lung Cancer / Malignant Pleural Effusions / Non-Small Cell Lung Cancer Recurrent / Squamous Cell Carcinoma of Lung / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2CompletedTreatmentAdenocarcinoma of the Rectum / Metastatic Colon Cancer / Mucinous Adenocarcinoma of the Colon / Recurrent Colon Cancer / Recurrent Rectal Cancer / Signet Ring Adenocarcinoma of the Colon / Stage IV Rectal Cancer1
2CompletedTreatmentAdenocarcinomas1
2CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2CompletedTreatmentAdvanced Biliary Cancer1
2CompletedTreatmentAdvanced Colorectal Cancer1
2CompletedTreatmentAdvanced Non-Small Cell Lung Cancer1
2CompletedTreatmentAnal Carcinoma1
2CompletedTreatmentAndrogen-independent Prostate Cancer1
2CompletedTreatmentBladder Cancers1
2CompletedTreatmentCancer of Head and Neck1
2CompletedTreatmentCancer of the Larynx / Cancer of the Oral Cavity / Cancer of the Pharynx / Head and Neck Carcinoma / Nose Neoplasms / Paranasal Sinus Neoplasms1
2CompletedTreatmentCancer of the Lung / Carcinoma NOS / Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Lung1
2CompletedTreatmentCancer of the Ovary / Primary Peritoneal Cavity Cancer1
2CompletedTreatmentCancer, Advanced1
2CompletedTreatmentCancer, Breast3
2CompletedTreatmentCancers2
2CompletedTreatmentCarcinoma of Larynx / Squamous Cell Carcinoma of the Hypopharynx1
2CompletedTreatmentCarcinoma of the Head and Neck1
2CompletedTreatmentCarcinoma, Colorectal1
2CompletedTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors1
2CompletedTreatmentCervical Cancers2
2CompletedTreatmentCervical Squamous Cell Carcinoma / Recurrent Cervical Carcinoma1
2CompletedTreatmentColorectal Cancer (CRC) / Neoplasms, Colorectal1
2CompletedTreatmentColorectal Cancers17
2CompletedTreatmentColorectal Cancers / Hepatic Metastases1
2CompletedTreatmentColorectal Cancers / Metastatic Cancers3
2CompletedTreatmentColorectal Cancers / Neoplasms Metastasis2
2CompletedTreatmentColorectal Cancers / Tumors1
2CompletedTreatmentColorectal Cancers / Unresectable Liver Metastasis1
2CompletedTreatmentComplex Regional Pain Syndromes (CRPS) / Neurocostal neuralgia1
2CompletedTreatmentEndometrial Cancers1
2CompletedTreatmentEsophageal Cancers3
2CompletedTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach2
2CompletedTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach / Neoplasms Metastasis1
2CompletedTreatmentGastric Cancer Adenocarcinoma Metastatic1
2CompletedTreatmentHead and Neck Cancer Squamous Cell / Head Neck Cancer Squamous Cell1
2CompletedTreatmentHead and Neck Carcinoma15
2CompletedTreatmentHead and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
2CompletedTreatmentHead and Neck Carcinoma / Precancerous Conditions2
2CompletedTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2CompletedTreatmentHead and Neck / Head and Neck Carcinoma / Recurrent Disease / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentHead and Neck / Squamous Cell Cancer1
2CompletedTreatmentHepatocellular,Carcinoma1
2CompletedTreatmentHypopharyngeal Cancer / Laryngeal Cancer / Oropharyngeal Cancers1
2CompletedTreatmentHypopharynx Cancer / Laryngeal Cancer1
2CompletedTreatmentLiver Cancer1
2CompletedTreatmentLiver Only Metastasis From KRAS Exon 2 Wild Type (Under Protocol 1.0-1.2 Edition) and RAS Wild Type (Under Protocol 2.0 Edition) Colorectal Cancer1
2CompletedTreatmentLocally Advanced / Metastatic / Unresectable1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)17
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
2CompletedTreatmentLung Cancers7
2CompletedTreatmentMalignant Neoplasm of Colon1
2CompletedTreatmentMalignant Neoplasm of Colon / Rectum Cancer1
2CompletedTreatmentMalignant Neoplasm of Pancreas8
2CompletedTreatmentMalignant Neoplasm of Stomach5
2CompletedTreatmentMetastases / Neoplasms / Neoplasms, Colorectal1
2CompletedTreatmentMetastatic Breast Cancer (MBC) / Triple Negative Locally Advanced Non-resectable Breast Cancer1
2CompletedTreatmentMetastatic Colon Cancer1
2CompletedTreatmentMetastatic Colorectal Cancers10
2CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Tongue Cancer / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
2CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Salivary Gland Squamous Cell Carcinoma / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IVA Salivary Gland Cancer / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVA Verrucous Carcinoma of the Oral Cavity / Stage IVB Salivary Gland Cancer / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVB Verrucous Carcinoma of the Larynx / Stage IVB Verrucous Carcinoma of the Oral Cavity / Stage IVC Salivary Gland Cancer / Stage IVC Squamous Cell Carcinoma of the Larynx / Stage IVC Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVC Squamous Cell Carcinoma of the Oropharynx / Stage IVC Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IVC Verrucous Carcinoma of the Larynx / Stage IVC Verrucous Carcinoma of the Oral Cavity / Tongue Cancer / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
2CompletedTreatmentMucinous Gastrointestinal Adenocarcinoma1
2CompletedTreatmentMultiple Myeloma, Neoplasms1
2CompletedTreatmentNasopharyngeal Carcinoma3
2CompletedTreatmentNeoplasm Metastases / Neoplasms, Colorectal1
2CompletedTreatmentNeoplasms, Breast1
2CompletedTreatmentNeoplasms, Colorectal2
2CompletedTreatmentNeoplasms, Head and Neck3
2CompletedTreatmentNeoplasms, Head and Neck / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentNon-Small Cell Lung Cancer Recurrent / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentOesophageal Carcinoma1
2CompletedTreatmentPancreatic Cancer Metastatic1
2CompletedTreatmentPreviously Untreated Metastatic Colorectal Cancer1
2CompletedTreatmentProstate Cancer1
2CompletedTreatmentRectal Carcinoma4
2CompletedTreatmentRectal Neoplasms1
2CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
2CompletedTreatmentRecurrent Hypopharyngeal Squamous Cell Carcinoma / Recurrent Laryngeal Squamous Cell Carcinoma / Recurrent Laryngeal Verrucous Carcinoma / Recurrent Lip and Oral Cavity Squamous Cell Carcinoma / Recurrent Metastatic Squamous Cell Carcinoma in the Neck With Occult Primary / Recurrent Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Recurrent Nasopharyngeal Keratinizing Squamous Cell Carcinoma / Recurrent Oral Cavity Verrucous Carcinoma / Recurrent Oropharyngeal Squamous Cell Carcinoma / Recurrent Salivary Gland Carcinoma / Salivary Gland Squamous Cell Carcinoma / Squamous Cell Carcinoma Metastatic in the Neck With Occult Primary / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Nasopharyngeal Keratinizing Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Verrucous Carcinoma / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVA Oral Cavity Verrucous Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Verrucous Carcinoma / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVB Oral Cavity Verrucous Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Verrucous Carcinoma / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVC Major Salivary Gland Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVC Oral Cavity Verrucous Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma / Tongue Carcinoma1
2CompletedTreatmentSarcomas1
2CompletedTreatmentSkin Diseases / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentSquamous Cell Carcinoma (SCC)2
2CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
2CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck Cancer1
2CompletedTreatmentStage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer1
2CompletedTreatmentStage III Non-Small Cell Lung Cancer1
2CompletedTreatmentTime to Progression1
2CompletedTreatmentUrologic Neoplasms1
2Not Yet RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck1
2Not Yet RecruitingTreatmentColorectal Cancers1
2Not Yet RecruitingTreatmentColorectal Neoplasms, Malignant1
2Not Yet RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers / MSI1
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers1
2Not Yet RecruitingTreatmentRectum Cancer1
2Not Yet RecruitingTreatmentSkin Neoplasms1
2RecruitingTreatmentAdvanced Head and Neck Squamous Cell Carcinoma1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentCancer of Colon1
2RecruitingTreatmentCancer of Head and Neck / Cancers of the Head and Neck / Carcinoma, Squamous Cell of the Head and Neck / Head and Neck Carcinoma / Neoplasms, Head and Neck / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentCancer of the Colon / Colon Neoplasms / Malignant Neoplasm of Colon / Neoplasms, Colonic1
2RecruitingTreatmentCancers of the Head and Neck / Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentCetuximab Effect / Chemotherapy Effect / Esophageal Cancer, Squamous Cell1
2RecruitingTreatmentCholangiocarcinoma of the Extrahepatic Bile Duct / Gallbladder Cancer1
2RecruitingTreatmentColo-rectal Cancer / Hepatic Metastases1
2RecruitingTreatmentColon Adenocarcinoma / ERBB2 Gene Amplification / Rectal Adenocarcinoma / Recurrent Colon Carcinoma / Recurrent Rectal Carcinoma / Stage III Colon Cancer AJCC v7 / Stage III Rectal Cancer AJCC v7 / Stage IIIA Colon Cancer AJCC v7 / Stage IIIA Rectal Cancer AJCC v7 / Stage IIIB Colon Cancer AJCC v7 / Stage IIIB Rectal Cancer AJCC v7 / Stage IIIC Colon Cancer AJCC v7 / Stage IIIC Rectal Cancer AJCC v7 / Stage IV Colon Cancer AJCC v7 / Stage IV Rectal Cancer AJCC v7 / Stage IVA Colon Cancer AJCC v7 / Stage IVA Rectal Cancer AJCC v7 / Stage IVB Colon Cancer AJCC v7 / Stage IVB Rectal Cancer AJCC v71
2RecruitingTreatmentColorectal Cancers1
2RecruitingTreatmentCutaneous Squamous Cell Carcinoma / Head and Neck Carcinoma / Head and Neck Squamous Cell Carcinoma (HNSCC) / HNSCC / Hypopharynx Cancer / Laryngeal Cancer / Lip SCC / Nasopharynx Cancer / Neoplasms, Head and Neck / Oral Cavity Cancer / Oropharynx Cancers / Sinonasal Carcinoma1
2RecruitingTreatmentHead and Neck Basaloid Carcinoma / Head and Neck Carcinoma / HNSCC / Oropharyngeal Cancers / Recurrent Head and Neck Squamous Cell Carcinoma / Recurrent Oropharyngeal Squamous Cell Carcinoma / Squamous Cell Carcinoma of Unknown Primary Origin / Stage IV Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IV Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IV Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage IV Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVA Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage IVC Oropharyngeal Squamous Cell Carcinoma AJCC v71
2RecruitingTreatmentHead and Neck Carcinoma1
2RecruitingTreatmentHead and Neck Carcinoma / Recurrent1
2RecruitingTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma (SCC)1
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentIncurable Colorectal Cancer / RAS-wild-type1
2RecruitingTreatmentLocally Advanced Thoracic Middle-lower Segment Esophageal Squamous Cell Carcinoma1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2RecruitingTreatmentMetastatic Colorectal Cancers4
2RecruitingTreatmentMetastatic or Recurrent Head and Neck Squamous Cell Cancer / Metastatic or Recurrent HNSCC1
2RecruitingTreatmentNeoplasms, Head and Neck1
2RecruitingTreatmentOropharynx Cancers1
2RecruitingTreatmentSquamous Cell Cancers of the Head and Neck1
2RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2SuspendedTreatmentColorectal Cancers1
2TerminatedDiagnosticAdenocarcinoma of the Pancreas1
2TerminatedTreatmentCancer of Larynx1
2TerminatedTreatmentCancer of the Ovary1
2TerminatedTreatmentCervix Cancer1
2TerminatedTreatmentColorectal Cancers8
2TerminatedTreatmentColorectal Cancers / Metastases1
2TerminatedTreatmentEsophageal Cancers3
2TerminatedTreatmentGlioblastomas1
2TerminatedTreatmentHead and Neck Carcinoma2
2TerminatedTreatmentHead and Neck Carcinoma / Squamous Carcinoma1
2TerminatedTreatmentHead and Neck Squamous Cell Cancer1
2TerminatedTreatmentHuman Papilloma Virus (HPV) / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2TerminatedTreatmentLaryngeal Neoplasms / Mouth Neoplasms / Neoplasms, Head and Neck / Neoplasms, Pharyngeal1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2TerminatedTreatmentLung Cancers1
2TerminatedTreatmentMalignant Neoplasm of Colon / Rectal Carcinoma1
2TerminatedTreatmentMetastatic Colorectal Cancers6
2TerminatedTreatmentMultiple Myeloma (MM)1
2TerminatedTreatmentNasopharyngeal Carcinoma1
2TerminatedTreatmentNeoplasms, Colorectal1
2TerminatedTreatmentPancreatic Cancer Metastatic1
2TerminatedTreatmentProstatic Neoplasms1
2TerminatedTreatmentRectal Carcinoma1
2TerminatedTreatmentResectable Esophageal Cancer1
2TerminatedTreatmentSquamous Cell Cancers of the Head and Neck1
2TerminatedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Unknown StatusBasic ScienceMetastatic Colorectal Cancers1
2Unknown StatusPreventionHead and Neck Carcinoma1
2Unknown StatusTreatmentAnal Carcinoma1
2Unknown StatusTreatmentCancer of the Cervix1
2Unknown StatusTreatmentCarcinoma NOS / Unknown Primary Neoplasms1
2Unknown StatusTreatmentCarcinoma, Colorectal1
2Unknown StatusTreatmentCholangiocarcinomas1
2Unknown StatusTreatmentColorectal Cancers3
2Unknown StatusTreatmentColorectal Cancers / Hepatic Metastases1
2Unknown StatusTreatmentColorectal Cancers / Metastatic Cancers2
2Unknown StatusTreatmentColorectal Cancers / Peritoneal Cavity Cancer1
2Unknown StatusTreatmentEsophageal Cancers2
2Unknown StatusTreatmentHead and Neck Carcinoma2
2Unknown StatusTreatmentHepatic Lesions / Hepatic Metastases / Metastatic Colorectal Cancers1
2Unknown StatusTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2Unknown StatusTreatmentMetastatic Colorectal Cancers2
2Unknown StatusTreatmentNasopharyngeal Carcinoma1
2Unknown StatusTreatmentNeoadjuvant Treatment / Rectal Neoplasms1
2Unknown StatusTreatmentNeoplasms, Oropharyngeal1
2Unknown StatusTreatmentRectal Carcinoma2
2Unknown StatusTreatmentRecurrent or Metastatic Disease / Squamous Cell Head and Neck Carcinoma1
2Unknown StatusTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Unknown StatusTreatmentSquamous Cell Carcinoma of the Head / Squamous Cell Carcinoma of the Neck1
2WithdrawnNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Lung1
2WithdrawnTreatmentColorectal Cancers2
2WithdrawnTreatmentColorectal Cancers / Malignant Neoplasm of Colon1
2WithdrawnTreatmentHead and Neck Carcinoma2
2WithdrawnTreatmentLung Cancers1
2WithdrawnTreatmentMalignant Neoplasm of Pancreas1
2WithdrawnTreatmentMetastatic Colorectal Cancers1
2WithdrawnTreatmentOesophageal Carcinoma1
2WithdrawnTreatmentSquamous Cell Carcinoma of the Penis1
2, 3Active Not RecruitingTreatmentStage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVA Verrucous Carcinoma of the Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Verrucous Carcinoma of the Larynx / Stage IVB Verrucous Carcinoma of the Oral Cavity / Tongue Cancer1
2, 3CompletedDiagnosticColorectal Cancers1
2, 3Not Yet RecruitingTreatmentColorectal Cancers2
2, 3RecruitingTreatmentColorectal Cancer Stage IV / Metastasis1
2, 3RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2, 3SuspendedTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Squamous Cell Carcinoma of Unknown Primary Origin / Stage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v71
2, 3Unknown StatusTreatmentEsophageal Cancers1
3Active Not RecruitingTreatmentAdenocarcinoma of Lung Stage IV / Recurrent Large Cell Lung Carcinoma / Recurrent Lung Adenocarcinoma / Recurrent Squamous Cell Lung Carcinoma / Stage IV Large Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma1
3Active Not RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Esophageal Cancers1
3Active Not RecruitingTreatmentCarcinoma, Colorectal1
3Active Not RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck1
3Active Not RecruitingTreatmentColorectal Cancers1
3Active Not RecruitingTreatmentEsophageal Cancers1
3Active Not RecruitingTreatmentFollicular Lymphoma (FL)1
3Active Not RecruitingTreatmentHNSCC1
3Active Not RecruitingTreatmentHPV Positive Oropharyngeal Squamous Cell Carcinoma1
3Active Not RecruitingTreatmentHead Neck Cancer Squamous Cell Recurrent1
3Active Not RecruitingTreatmentHead and Neck Carcinoma1
3Active Not RecruitingTreatmentHead and Neck Carcinoma / Metastatic Head and Neck Squamous Cell Carcinoma / Recurrent Head and Neck Squamous Cell Carcinoma1
3Active Not RecruitingTreatmentHead and Neck Carcinoma / Precancerous Conditions1
3Active Not RecruitingTreatmentHead and Neck Squamous Cell Cancer1
3Active Not RecruitingTreatmentLocally Advanced Head and Neck Cancer1
3Active Not RecruitingTreatmentLung Cancers / Radiation Toxicity1
3Active Not RecruitingTreatmentMetastatic Colorectal Cancers2
3Active Not RecruitingTreatmentMetastatic Head and Neck Cancer / Recurrent Head and Neck Cancer1
3Active Not RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)3
3CompletedTreatmentAdenocarcinoma of the Colon / Stage III Colon Cancer1
3CompletedTreatmentColorectal Cancers6
3CompletedTreatmentColorectal Cancers / Quality of Life1
3CompletedTreatmentEpidermal Growth Factor Receptor (EGFR) Expressing Metastatic Colorectal Cancer1
3CompletedTreatmentHead and Neck Carcinoma1
3CompletedTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
3CompletedTreatmentMalignant Neoplasm of Pancreas1
3CompletedTreatmentMalignant Neoplasm of Stomach1
3CompletedTreatmentMetastatic Colorectal Cancers4
3CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
3RecruitingTreatmentAntineoplastic Agents1
3RecruitingTreatmentBRAF V600E-mutant Metastatic Colorectal Cancer1
3RecruitingTreatmentHNSCC1
3RecruitingTreatmentHead and Neck Carcinoma2
3RecruitingTreatmentLaryngeal Squamous Cell Carcinoma Stage III / Laryngeal Squamous Cell Carcinoma Stage IV / Locally Advanced Malignant Neoplasm / Oropharyngeal Squamous Cell Carcinoma Stage III / Oropharyngeal Squamous Cell Carcinoma Stage IV / Squamous Cell Carcinoma of the Hypopharynx Stage III / Squamous Cell Carcinoma of the Hypopharynx Stage IV / Squamous Cell Carcinoma of the Oral Cavity Stage III / Squamous Cell Carcinoma of the Oral Cavity Stage IV1
3RecruitingTreatmentMetastatic Colorectal Cancers2
3RecruitingTreatmentNasopharyngeal Carcinoma1
3RecruitingTreatmentOropharyngeal Squamous Cell Carcinoma1
3RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
3TerminatedTreatmentColorectal Cancers2
3TerminatedTreatmentHead and Neck Carcinoma2
3TerminatedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
3Unknown StatusTreatmentColorectal Cancers2
3Unknown StatusTreatmentColorectal Cancers / Metastatic Cancers1
3Unknown StatusTreatmentColorectal Cancers / Neoplasms Metastasis1
3Unknown StatusTreatmentMetastatic Colorectal Cancers / Skin Toxicities1
3WithdrawnTreatmentColorectal Cancers1
3WithdrawnTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
4Active Not RecruitingTreatmentMetastatic Colorectal Cancers1
4RecruitingTreatmentNeoplasms, Head and Neck1
4TerminatedTreatmentColorectal Cancers / Neoplasms Metastasis1
4Unknown StatusTreatmentHead and Neck Carcinoma1
4Unknown StatusTreatmentNeoplasms Metastasis / Neoplasms, Colorectal / Neoplasms, Hepatic1
Not AvailableActive Not RecruitingNot AvailableMetastatic Colorectal Cancers1
Not AvailableActive Not RecruitingTreatmentHpv / Squamous Cell Carcinoma of the Oropharynx1
Not AvailableCompletedNot AvailableColorectal Cancers1
Not AvailableCompletedNot AvailableHead and Neck Carcinoma3
Not AvailableCompletedNot AvailableMetastatic Colorectal Cancers2
Not AvailableCompletedNot AvailableNeoplasms, Colorectal1
Not AvailableCompletedTreatmentColorectal Cancers1
Not AvailableCompletedTreatmentColorectal Cancers / Liver Metastasis1
Not AvailableCompletedTreatmentMalignant Neoplasm of Pancreas2
Not AvailableCompletedTreatmentMetastatic Colorectal Cancers1
Not AvailableRecruitingNot AvailableColorectal Cancers / Drug Resistance / Mass Spectrometry / RAS-RAF Pathway Deregulation1
Not AvailableRecruitingTreatmentRecurrent Skin Cancer / Squamous Cell Carcinoma of the Skin1
Not AvailableSuspendedTreatmentStage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Verrucous Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IVA Squamous Cell Carcinoma of the Larynx / Stage IVA Squamous Cell Carcinoma of the Oropharynx / Stage IVA Verrucous Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Larynx / Stage IVB Squamous Cell Carcinoma of the Oropharynx / Stage IVB Verrucous Carcinoma of the Larynx / Tongue Cancer1
Not AvailableTerminatedNot AvailableLA SCCHN / Unresectable Locally Advanced Squamous Cell Carcinoma of Head and Neck1
Not AvailableTerminatedNot AvailableNeoplasms, Colorectal2
Not AvailableTerminatedNot AvailableSquamous Cell Carcinoma (SCC)1
Not AvailableTerminatedTreatmentAdenocarcinoma Of Esophagus1
Not AvailableTerminatedTreatmentHead and Neck Carcinoma1
Not AvailableTerminatedTreatmentHead and Neck Squamous Cell Cancer1
Not AvailableUnknown StatusNot AvailableEpidermoid Head and Neck Cancer1
Not AvailableWithdrawnNot AvailableNeoplasms, Squamous Cell1
Not AvailableWithdrawnTreatmentColorectal Cancers / Hepatic Metastases1
Not AvailableWithdrawnTreatmentHead and Neck Carcinoma1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Cardinal Health
  • Catalent Pharma Solutions
  • ImClone Systems Inc.
  • Oso Biopharmaceuticals Manufacturing LLC
Dosage forms
FormRouteStrength
Injection, solutionIntravenous5 mg/ml
SolutionIntravenous2 mg
SolutionIntravenous2 mg/1mL
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1340417No1999-03-022016-03-02Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.413Not Available
isoelectric point8.48Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Ubiquitin protein ligase binding
Specific Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TG...
Gene Name
EGFR
Uniprot ID
P00533
Uniprot Name
Epidermal growth factor receptor
Molecular Weight
134276.185 Da
References
  1. Hosokawa N, Yamamoto S, Uehara Y, Hori M, Tsuchiya KS: Effect of thiazinotrienomycin B, an ansamycin antibiotic, on the function of epidermal growth factor receptor in human stomach tumor cells. J Antibiot (Tokyo). 1999 May;52(5):485-90. [PubMed:10480573]
  2. Wakita H, Takigawa M: Activation of epidermal growth factor receptor promotes late terminal differentiation of cell-matrix interaction-disrupted keratinocytes. J Biol Chem. 1999 Dec 24;274(52):37285-91. [PubMed:10601294]
  3. Suwa T, Ueda M, Jinno H, Ozawa S, Kitagawa Y, Ando N, Kitajima M: Epidermal growth factor receptor-dependent cytotoxic effect of anti-EGFR antibody-ribonuclease conjugate on human cancer cells. Anticancer Res. 1999 Sep-Oct;19(5B):4161-5. [PubMed:10628369]
  4. Burke P, Schooler K, Wiley HS: Regulation of epidermal growth factor receptor signaling by endocytosis and intracellular trafficking. Mol Biol Cell. 2001 Jun;12(6):1897-910. [PubMed:11408594]
  5. Viloria-Petit A, Crombet T, Jothy S, Hicklin D, Bohlen P, Schlaeppi JM, Rak J, Kerbel RS: Acquired resistance to the antitumor effect of epidermal growth factor receptor-blocking antibodies in vivo: a role for altered tumor angiogenesis. Cancer Res. 2001 Jul 1;61(13):5090-101. [PubMed:11431346]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Snyder LC, Astsaturov I, Weiner LM: Overview of monoclonal antibodies and small molecules targeting the epidermal growth factor receptor pathway in colorectal cancer. Clin Colorectal Cancer. 2005 Nov;5 Suppl 2:S71-80. [PubMed:16336752]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Negri DR, Tosi E, Valota O, Ferrini S, Cambiaggi A, Sforzini S, Silvani A, Ruffini PA, Colnaghi MI, Canevari S: In vitro and in vivo stability and anti-tumour efficacy of an anti-EGFR/anti-CD3 F(ab')2 bispecific monoclonal antibody. Br J Cancer. 1995 Oct;72(4):928-33. [PubMed:7547242]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Zhang W, Gordon M, Schultheis AM, Yang DY, Nagashima F, Azuma M, Chang HM, Borucka E, Lurje G, Sherrod AE, Iqbal S, Groshen S, Lenz HJ: FCGR2A and FCGR3A polymorphisms associated with clinical outcome of epidermal growth factor receptor expressing metastatic colorectal cancer patients treated with single-agent cetuximab. J Clin Oncol. 2007 Aug 20;25(24):3712-8. [PubMed:17704420]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]

Drug created on June 13, 2005 07:24 / Updated on September 17, 2018 20:34