You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameInsulin Human
Accession NumberDB00030  (BTD00105, BIOD00105, DB01383, DB05278, DB05215, DB05283, DB08914)
TypeBiotech
GroupsApproved, Investigational
DescriptionInsulin human is a 51 residue peptide hormone, composed of two amino acid chains covalently linked by disulfide bonds. The structure is identical to native human insulin. Recombinant insulin is synthesized by recombinant DNA techncology. Inserting the human insulin gene into the Escherichia coli bacteria or Saccharomyces cerevisiae produces insulin for human use. Inhalable insulin is a powdered form of insulin regular, delivered with a nebulizer into the lungs where it is absorbed. Exubera, developed by Inhale Therapeutics (later named Nektar Therapeutics), became the first inhaled insulin product to be marketed in 2006 by Pfizer, but poor sales led Pfizer to withdraw it in 2007. Afrezza, a monomeric inhaled insulin developed by Mannkind, was approved by the FDA in 2014.
Protein structureDb00030
Related Articles
Protein chemical formulaC257H383N65O77S6
Protein average weight5808.0 Da
Sequences
>A chain
GIVEQCCTSICSLYQLENYCN
>B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Download FASTA Format
Synonyms
High molecular weight insulin human
Human insulin
human insulin (rDNA)
Insulin (human)
Insulin human
Insulin human [rDNA origin]
Insulin Human Regular
Insulin human regular (rDNA)
Insulin human, rDNA origin
Insulin injection human biosynthetic
Insulin recombinant human
Insulin recombinant purified human
Insulin regular
Insulin, human
Regular Insulin, human
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Actraphane 30Injection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30Injection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30Injection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30Injection, suspension40 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30Injection, suspension40 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30Injection, suspension40 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 FlexpenInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 FlexpenInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 FlexpenInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 InnoletInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 InnoletInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 InnoletInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 30 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 40 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 40 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 40 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 50 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 50 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actraphane 50 PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
ActrapidInjection, solution100 iu/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
ActrapidInjection, solution100 iu/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
ActrapidInjection, solution40 iu/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
ActrapidInjection, solution40 iu/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
ActrapidInjection, solution40 iu/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
ActrapidInjection, solution100 iu/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid FlexpenInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid FlexpenInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid FlexpenInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid InnoletInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid InnoletInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid InnoletInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid PenfillInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid PenfillInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Actrapid PenfillInjection, solution100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
AfrezzaKitMannkind Corporation2014-07-11Not applicableUs
AfrezzaPowder, metered4 1/1Respiratory (inhalation)Mannkind Corporation2014-07-11Not applicableUs
AfrezzaKitSanofi Aventis U.S. Llc2014-07-11Not applicableUs
AfrezzaKitMannkind Corporation2014-07-11Not applicableUs
AfrezzaKitSanofi Aventis U.S. Llc2014-07-11Not applicableUs
AfrezzaPowder, metered4 1/1Respiratory (inhalation)Sanofi Aventis U.S. Llc2014-07-11Not applicableUs
AfrezzaKitMannkind Corporation2014-07-11Not applicableUs
AfrezzaKitSanofi Aventis U.S. Llc2014-07-11Not applicableUs
AfrezzaKitMannkind Corporation2014-07-11Not applicableUs
Humulin 70/30Injection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company2013-11-07Not applicableUs
Humulin NInjection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company2013-11-07Not applicableUs
Humulin R CartridgeSolution100 unitIntramuscular; Intravenous; SubcutaneousEli Lilly Canada Inc1992-12-31Not applicableCanada
Humulin R U-500Injection, solution500 [iU]/mLSubcutaneousEli Lilly and Company1997-01-06Not applicableUs
Humulin R U-500 KwikpenInjection, solution500 [iU]/mLSubcutaneousEli Lilly and Company2015-12-29Not applicableUs
Insulatard FlexpenInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulatard FlexpenInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulatard FlexpenInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulatard InnoletInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulatard InnoletInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulatard InnoletInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
InsulatardInjection, suspension40 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
InsulatardInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
InsulatardInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
InsulatardInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
InsulatardInjection, suspension40 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
InsulatardInjection, suspension40 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulatard PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulatard PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulatard PenfillInjection, suspension100 iu/mlSubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop InfusatInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop InfusatInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution40 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution40 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insulin Human Winthrop RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H2007-01-17Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman BasalInjection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 15Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 25Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 30Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension40 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman Comb 50Injection, suspension100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman ImplantableInjection, solution400 IU/mlIntraperitonealSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman ImplantableInjection, solution400 IU/mlIntraperitonealSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman InfusatInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman InfusatInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution40 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution40 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Insuman RapidInjection, solution100 IU/mlSubcutaneousSanofi Aventis Deutschland Gmb H1997-02-21Not applicableEu
Novolin Ge TorontoSolution100 unitIntramuscular; Intravenous; SubcutaneousNovo Nordisk Canada Inc1993-12-31Not applicableCanada
Novolin Ge Toronto PenfillSolution100 unitIntramuscular; Intravenous; SubcutaneousNovo Nordisk Canada Inc1993-12-31Not applicableCanada
Novolinset Ge Toronto Inj Liq 100u/mlLiquid100 unitIntramuscular; Intravenous; SubcutaneousNovo Nordisk A/s1999-06-282005-08-04Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Humulin 70/30Injection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company1989-06-26Not applicableUs
Humulin NInjection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company1999-02-012015-10-31Us
Humulin NInjection, suspension100 [iU]/mLSubcutaneousEli Lilly and Company1983-06-27Not applicableUs
Humulin NInjection, suspension100 [iU]/mLSubcutaneousPhysicians Total Care, Inc.1994-10-24Not applicableUs
Humulin RInjection, solution100 [iU]/mLParenteralEli Lilly and Company1983-06-27Not applicableUs
Humulin RInjection, solution100 [iU]/mLSubcutaneousPhysicians Total Care, Inc.1995-07-27Not applicableUs
Novolin 70/30Injection, suspension100 [USP'U]/mLSubcutaneousNovo Nordisk1991-06-25Not applicableUs
Novolin NInjection, suspension100 [iU]/mLSubcutaneousTYA Pharmaceuticals1991-07-01Not applicableUs
Novolin NInjection, suspension100 [iU]/mLSubcutaneousNovo Nordisk1991-07-01Not applicableUs
Novolin RInjection, solution100 [iU]/mLSubcutaneousTYA Pharmaceuticals1991-06-25Not applicableUs
Novolin RInjection, solution100 [iU]/mLSubcutaneousNovo Nordisk1991-06-25Not applicableUs
Novolinn NInjection, suspension100 [iU]/mLSubcutaneousREMEDYREPACK INC.2016-04-07Not applicableUs
Unapproved/Other Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
VelosulinInjection, solution100 IU/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
VelosulinInjection, solution100 IU/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
VelosulinInjection, solution100 IU/mlIntravenous; SubcutaneousNovo Nordisk A/s2002-10-07Not applicableEu
International Brands
NameCompany
ExuberaPfizer (withdrawn)
Humulin N PenLilly
lnsulatardLeo
NasulinNot Available
Novolin N RelionNovo Nordisk
Novolin NPHNovo Nordisk
Brand mixturesNot Available
Salts
Name/CASStructureProperties
Insulin human zinc suspension
ThumbNot applicableDBSALT001733
NPH insulin
53027-39-7
ThumbNot applicableDBSALT001734
Categories
UNII1Y17CTI5SR
CAS number11061-68-0
Pharmacology
IndicationIndicated as an adjunct to diet and exercise to improve glycemic control in adults and children with type 1 and type 2 diabetes mellitus.
Structured Indications
PharmacodynamicsInsulin regular is a short-acting insulin. When subcutaneously administered, the onset of action (as evidenced by a decrease in glucose level) occurs 30 minutes post-dose. Maximal effect occurs between 1.5 and 3.5 hours post-dose. The glucose-lowering effect occurs 8 hours post-dose. Compared to other rapid-acting insulin analogs, insulin regular has a slower onset of action and longer duration of action.
Mechanism of actionThe primary activity of insulin is the regulation of glucose metabolism. Insulin promotes glucose and amino acid uptake into muscle and adipose tissues, and other tissues except brain and liver. It also has an anabolic role in stimulating glycogen, fatty acid, and protein synthesis. Insulin inhibits gluconeogenesis in the liver. Insulin binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor is able to autophosphorylate and phosphorylate numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. These activated proteins, in turn, lead to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC) which play a critical role in metabolism and catabolism.
TargetKindPharmacological actionActionsOrganismUniProt ID
Insulin receptorProteinyes
agonist
HumanP06213 details
Insulin-like growth factor 1 receptorProteinunknownNot AvailableHumanP08069 details
Retinoblastoma-associated proteinProteinunknownNot AvailableHumanP06400 details
Cathepsin DProteinunknownNot AvailableHumanP07339 details
Insulin-degrading enzymeProteinunknownNot AvailableHumanP14735 details
Neuroendocrine convertase 2ProteinunknownNot AvailableHumanP16519 details
Carboxypeptidase EProteinunknownNot AvailableHumanP16870 details
Neuroendocrine convertase 1ProteinunknownNot AvailableHumanP29120 details
Protein NOV homologProteinunknownNot AvailableHumanP48745 details
Low-density lipoprotein receptor-related protein 2ProteinunknownNot AvailableHumanP98164 details
Insulin-like growth factor-binding protein 7ProteinunknownNot AvailableHumanQ16270 details
Synaptotagmin-like protein 4ProteinunknownNot AvailableHumanQ96C24 details
Related Articles
AbsorptionInsulin is generally well absorbed.
Volume of distribution

0.15 L/kg

Protein binding5% protein bound
Metabolism

Insulin is predominantly cleared by metabolic degradation via a receptor-mediated process.

Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityHypoglycemia is one of the most frequent adverse events experienced by insulin users.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Insulin Human.Experimental
AcarboseAcarbose may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Insulin Human.Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Insulin Human.Approved, Vet Approved
AicarAicar may increase the hypoglycemic activities of Insulin Human.Experimental
AlogliptinAlogliptin may increase the hypoglycemic activities of Insulin Human.Approved
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Insulin Human.Approved
BalaglitazoneBalaglitazone may increase the hypoglycemic activities of Insulin Human.Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
BenmoxinBenmoxin may increase the hypoglycemic activities of Insulin Human.Withdrawn
BuforminBuformin may increase the hypoglycemic activities of Insulin Human.Withdrawn
CanagliflozinCanagliflozin may increase the hypoglycemic activities of Insulin Human.Approved
CaroxazoneCaroxazone may increase the hypoglycemic activities of Insulin Human.Withdrawn
CastanospermineCastanospermine may increase the hypoglycemic activities of Insulin Human.Experimental
ChlorpropamideInsulin Human may increase the hypoglycemic activities of Chlorpropamide.Approved
CiglitazoneCiglitazone may increase the hypoglycemic activities of Insulin Human.Experimental
CinoxacinCinoxacin may increase the hypoglycemic activities of Insulin Human.Approved, Withdrawn
CiprofloxacinCiprofloxacin may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
CitalopramCitalopram may increase the hypoglycemic activities of Insulin Human.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Insulin Human.Investigational
DeoxyspergualinDeoxyspergualin may increase the hypoglycemic activities of Insulin Human.Investigational
dersalazinedersalazine may increase the hypoglycemic activities of Insulin Human.Investigational
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Insulin Human.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Insulin Human.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Insulin Human.Illicit
DisopyramideInsulin Human may increase the hypoglycemic activities of Disopyramide.Approved
DulaglutideDulaglutide may increase the hypoglycemic activities of Insulin Human.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Insulin Human.Approved
EmpagliflozinEmpagliflozin may increase the hypoglycemic activities of Insulin Human.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Insulin Human.Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Insulin Human.Approved
ExenatideExenatide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
FleroxacinFleroxacin may increase the hypoglycemic activities of Insulin Human.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Insulin Human.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Insulin Human.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Insulin Human.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
FurazolidoneFurazolidone may increase the hypoglycemic activities of Insulin Human.Approved, Vet Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Insulin Human.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
GlibornurideGlibornuride may increase the hypoglycemic activities of Insulin Human.Withdrawn
GliclazideInsulin Human may increase the hypoglycemic activities of Gliclazide.Approved
GlimepirideInsulin Human may increase the hypoglycemic activities of Glimepiride.Approved
GlipizideInsulin Human may increase the hypoglycemic activities of Glipizide.Approved
GliquidoneGliquidone may increase the hypoglycemic activities of Insulin Human.Approved
GlyburideInsulin Human may increase the hypoglycemic activities of Glyburide.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Insulin Human.Withdrawn
GusperimusGusperimus may increase the hypoglycemic activities of Insulin Human.Investigational
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Insulin Human.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Insulin Human.Investigational, Withdrawn
Insulin AspartInsulin Human may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirInsulin Human may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineInsulin Human may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin GlulisineInsulin Human may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin LisproInsulin Human may increase the hypoglycemic activities of Insulin Lispro.Approved
Insulin PorkInsulin Pork may increase the hypoglycemic activities of Insulin Human.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Insulin Human.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Insulin Human.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Insulin Human.Approved
LanreotideInsulin Human may increase the hypoglycemic activities of Lanreotide.Approved
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Insulin Human.Approved
LinagliptinLinagliptin may increase the hypoglycemic activities of Insulin Human.Approved
LiraglutideLiraglutide may increase the hypoglycemic activities of Insulin Human.Approved
LomefloxacinLomefloxacin may increase the hypoglycemic activities of Insulin Human.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Insulin Human.Withdrawn
MecaserminInsulin Human may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
MesalazineMesalazine may increase the hypoglycemic activities of Insulin Human.Approved
MetforminMetformin may increase the hypoglycemic activities of Insulin Human.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Insulin Human.Investigational
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Insulin Human.Approved
MifepristoneInsulin Human may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MiglitolMiglitol may increase the hypoglycemic activities of Insulin Human.Approved
MiglustatMiglustat may increase the hypoglycemic activities of Insulin Human.Approved
MilnacipranMilnacipran may increase the hypoglycemic activities of Insulin Human.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Insulin Human.Approved
MitiglinideMitiglinide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
MoclobemideMoclobemide may increase the hypoglycemic activities of Insulin Human.Approved
MoxifloxacinMoxifloxacin may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Insulin Human.Approved
NateglinideInsulin Human may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NCX 4016NCX 4016 may increase the hypoglycemic activities of Insulin Human.Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Insulin Human.Approved, Withdrawn
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Insulin Human.Investigational
NialamideNialamide may increase the hypoglycemic activities of Insulin Human.Withdrawn
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Insulin Human.Investigational
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Insulin Human.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Insulin Human.Withdrawn
OctreotideInsulin Human may increase the hypoglycemic activities of Octreotide.Approved, Investigational
OfloxacinOfloxacin may increase the hypoglycemic activities of Insulin Human.Approved
OlsalazineOlsalazine may increase the hypoglycemic activities of Insulin Human.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
OxymetholoneOxymetholone may increase the hypoglycemic activities of Insulin Human.Approved, Illicit
PargylinePargyline may increase the hypoglycemic activities of Insulin Human.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
PasireotideInsulin Human may increase the hypoglycemic activities of Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Insulin Human.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Insulin Human.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Insulin Human.Approved
PentamidineInsulin Human may increase the hypoglycemic activities of Pentamidine.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Insulin Human.Approved
PhenforminPhenformin may increase the hypoglycemic activities of Insulin Human.Approved, Withdrawn
PheniprazinePheniprazine may increase the hypoglycemic activities of Insulin Human.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Insulin Human.Withdrawn
PioglitazonePioglitazone may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
PirlindolePirlindole may increase the hypoglycemic activities of Insulin Human.Approved
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Insulin Human.Withdrawn
PramlintidePramlintide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Insulin Human.Investigational
QuinineInsulin Human may increase the hypoglycemic activities of Quinine.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Insulin Human.Approved
RepaglinideInsulin Human may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RosiglitazoneRosiglitazone may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Insulin Human.Approved
SafrazineSafrazine may increase the hypoglycemic activities of Insulin Human.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Insulin Human.Approved, Vet Approved
SaxagliptinSaxagliptin may increase the hypoglycemic activities of Insulin Human.Approved
SelegilineSelegiline may increase the hypoglycemic activities of Insulin Human.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Insulin Human.Approved
SitagliptinSitagliptin may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Insulin Human.Approved
StanozololStanozolol may increase the hypoglycemic activities of Insulin Human.Approved, Vet Approved
SulfadiazineInsulin Human may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazoleInsulin Human may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazoleInsulin Human may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SulodexideSulodexide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
SunitinibInsulin Human may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Insulin Human.Withdrawn
TestosteroneTestosterone may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
ThiazolidinedioneThiazolidinedione may increase the hypoglycemic activities of Insulin Human.Investigational
TolazamideInsulin Human may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamideInsulin Human may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Insulin Human.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Insulin Human.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Insulin Human.Approved
TroglitazoneTroglitazone may increase the hypoglycemic activities of Insulin Human.Withdrawn
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Insulin Human.Approved, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Insulin Human.Approved
VildagliptinVildagliptin may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
VogliboseVoglibose may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Insulin Human.Withdrawn
Food InteractionsNot Available
References
Synthesis Reference

Humulin is synthesized in a special non-disease-producing laboratory strain of Escherichia coli bacteria that has been genetically altered to produce human insulin.

General References
  1. Herrmann BL, Kasser C, Keuthage W, Huptas M, Dette H, Klute A: Comparison of insulin aspart vs. regular human insulin with or without insulin detemir concerning adipozytokines and metabolic effects in patients with type 2 diabetes mellitus. Exp Clin Endocrinol Diabetes. 2013 Apr;121(4):210-3. doi: 10.1055/s-0033-1334905. Epub 2013 Mar 19. [PubMed:23512415 ]
  2. Lepore M, Pampanelli S, Fanelli C, Porcellati F, Bartocci L, Di Vincenzo A, Cordoni C, Costa E, Brunetti P, Bolli GB: Pharmacokinetics and pharmacodynamics of subcutaneous injection of long-acting human insulin analog glargine, NPH insulin, and ultralente human insulin and continuous subcutaneous infusion of insulin lispro. Diabetes. 2000 Dec;49(12):2142-8. [PubMed:11118018 ]
  3. Owens DR, Coates PA, Luzio SD, Tinbergen JP, Kurzhals R: Pharmacokinetics of 125I-labeled insulin glargine (HOE 901) in healthy men: comparison with NPH insulin and the influence of different subcutaneous injection sites. Diabetes Care. 2000 Jun;23(6):813-9. [PubMed:10841002 ]
  4. Danne T, Lupke K, Walte K, Von Schuetz W, Gall MA: Insulin detemir is characterized by a consistent pharmacokinetic profile across age-groups in children, adolescents, and adults with type 1 diabetes. Diabetes Care. 2003 Nov;26(11):3087-92. [PubMed:14578244 ]
  5. Owens DR, Bolli GB: Beyond the era of NPH insulin--long-acting insulin analogs: chemistry, comparative pharmacology, and clinical application. Diabetes Technol Ther. 2008 Oct;10(5):333-49. doi: 10.1089/dia.2008.0023. [PubMed:18715209 ]
External Links
ATC CodesNot Available
AHFS Codes
  • 68:20.08
  • 92:02.00*
PDB Entries
FDA labelDownload (133 KB)
MSDSDownload (47 KB)
Pharmacoeconomics
Manufacturers
  • Novo nordisk inc
Packagers
Dosage forms
FormRouteStrength
Kit
Powder, meteredRespiratory (inhalation)4 1/1
Injection, suspensionSubcutaneous100 [iU]/mL
Injection, solutionParenteral100 [iU]/mL
Injection, solutionSubcutaneous100 [iU]/mL
Injection, solutionSubcutaneous500 [iU]/mL
Injection, suspensionSubcutaneous100 IU/ml
Injection, suspensionSubcutaneous40 IU/ml
Injection, solutionSubcutaneous100 IU/ml
Injection, solutionIntravenous; Subcutaneous100 IU/ml
Injection, solutionIntravenous; Subcutaneous40 IU/ml
Injection, solutionIntraperitoneal400 IU/ml
Injection, suspensionSubcutaneous100 [USP'U]/mL
SolutionIntramuscular; Intravenous; Subcutaneous100 unit
LiquidIntramuscular; Intravenous; Subcutaneous100 unit
Prices
Unit descriptionCostUnit
NovoLIN R PenFill 100 unit/ml Solution Five 3ml Cartridges Per Box = 15ml162.26USD cartridge
NovoLIN R 100 unit/ml Solution 10ml Vial73.19USD vial
Novolin r 100 unit/ml cartridg33.33USD ml
NovoLIN R InnoLet 100 unit/ml Solution 3ml Cartridge24.17USD cartridge
Humulin N Cartridge 100 unit/ml Cartridge2.99USD cartridge
Humulin R Cartridge 100 unit/ml Cartridge2.99USD cartridge
Novolin Ge Toronto Penfill 100 unit/ml Cartridge2.8USD cartridge
Novolin Ge Nph Penfill 100 unit/ml Cartridge2.78USD cartridge
Humulin N 100 unit/ml2.29USD cartridge
Humulin R 100 unit/ml2.29USD cartridge
Novolin Ge Nph 100 unit/ml2.14USD cartridge
Novolin Ge Toronto 100 unit/ml2.14USD cartridge
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2183577 No2007-10-302015-02-07Canada
CA2253393 No2007-10-092017-05-07Canada
US6257233 No1999-05-142019-05-14Us
US6444226 No2000-06-292020-06-29Us
US6546929 No1999-05-142019-05-14Us
US6582728 No2000-06-242020-06-24Us
US6652885 No2000-06-292020-06-29Us
US6685967 No1998-09-112018-09-11Us
US7291132 No2004-08-092024-08-09Us
US7305986 No2003-01-162023-01-16Us
US7464706 No2003-03-022023-03-02Us
US7648960 No2000-06-292020-06-29Us
US7943178 No2000-06-292020-06-29Us
US7943572 No2006-08-102026-08-10Us
US8119593 No2009-08-112029-08-11Us
US8146588 No2003-04-242023-04-24Us
US8156936 No2003-01-162023-01-16Us
US8215300 No2002-11-242022-11-24Us
US8227409 No2011-03-082031-03-08Us
US8258095 No2009-08-112029-08-11Us
US8389470 No2000-06-292020-06-29Us
US8424518 No2011-10-172031-10-17Us
US8485180 No2010-03-252030-03-25Us
US8499757 No2012-02-192032-02-19Us
US8551528 No2010-06-112030-06-11Us
US8623817 No2009-09-182029-09-18Us
US8636001 No2012-07-122032-07-12Us
US8729019 No2008-12-262028-12-26Us
US8734845 No2010-06-112030-06-11Us
US8778403 No2010-06-112030-06-11Us
US8889099 No2000-06-292020-06-29Us
US8912193 No2009-06-122029-06-12Us
US8950397 No2001-07-202021-07-20Us
US9192675 No2009-06-122029-06-12Us
US9283193 No2006-09-142026-09-14Us
USRE37872 No1993-02-122010-02-12Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point81 °CKhachidze, D.G. et al., J. Biol. Phys. Chem. 1:64-67 (2001)
hydrophobicity0.218Not Available
isoelectric point5.39Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor signaling protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 ...
Gene Name:
INSR
Uniprot ID:
P06213
Molecular Weight:
156331.465 Da
References
  1. Desbuquois B, Chauvet G, Kouach M, Authier F: Cell itinerary and metabolic fate of proinsulin in rat liver: in vivo and in vitro studies. Endocrinology. 2003 Dec;144(12):5308-21. Epub 2003 Sep 11. [PubMed:12970169 ]
  2. Chen LM, Yang XW, Tang JG: Acidic residues on the N-terminus of proinsulin C-Peptide are important for the folding of insulin precursor. J Biochem. 2002 Jun;131(6):855-9. [PubMed:12038982 ]
  3. Bell DS: Insulin therapy in diabetes mellitus: how can the currently available injectable insulins be most prudently and efficaciously utilised? Drugs. 2007;67(13):1813-27. [PubMed:17722952 ]
  4. Tanti JF, Jager J: Cellular mechanisms of insulin resistance: role of stress-regulated serine kinases and insulin receptor substrates (IRS) serine phosphorylation. Curr Opin Pharmacol. 2009 Dec;9(6):753-62. doi: 10.1016/j.coph.2009.07.004. Epub 2009 Aug 13. [PubMed:19683471 ]
  5. Chiu SL, Cline HT: Insulin receptor signaling in the development of neuronal structure and function. Neural Dev. 2010 Mar 15;5:7. doi: 10.1186/1749-8104-5-7. [PubMed:20230616 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation,...
Gene Name:
IGF1R
Uniprot ID:
P08069
Molecular Weight:
154791.73 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Ubiquitin protein ligase binding
Specific Function:
Key regulator of entry into cell division that acts as a tumor suppressor. Promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C. Acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. Directly involved in heterochromatin formation by maintaining over...
Gene Name:
RB1
Uniprot ID:
P06400
Molecular Weight:
106158.335 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Aspartic-type endopeptidase activity
Specific Function:
Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Gene Name:
CTSD
Uniprot ID:
P07339
Molecular Weight:
44551.845 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Zinc ion binding
Specific Function:
Plays a role in the cellular breakdown of insulin, IAPP, glucagon, bradykinin, kallidin and other peptides, and thereby plays a role in intercellular peptide signaling. Degrades amyloid formed by APP and IAPP. May play a role in the degradation and clearance of naturally secreted amyloid beta-protein by neurons and microglia.(Microbial infection) The membrane-associated isoform acts as an entry...
Gene Name:
IDE
Uniprot ID:
P14735
Molecular Weight:
117967.49 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Responsible for the release of glucagon from proglucagon in pancreatic A cells.
Gene Name:
PCSK2
Uniprot ID:
P16519
Molecular Weight:
70564.735 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Zinc ion binding
Specific Function:
Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.
Gene Name:
CPE
Uniprot ID:
P16870
Molecular Weight:
53150.185 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin, insulin and AGRP.
Gene Name:
PCSK1
Uniprot ID:
P29120
Molecular Weight:
84150.92 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Notch binding
Specific Function:
Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival (PubMed:15181016, PubMed:15611078, PubMed:12695522, PubMed:21344378, PubMed:12050162). Acts by binding to integrins or membrane receptors such as NOTCH1 (PubMed:12695522, PubMed:21344378, PubMed:15611078). Essential regulator of hematopoietic stem and p...
Gene Name:
NOV
Uniprot ID:
P48745
Molecular Weight:
39161.82 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Calcium ion binding
Specific Function:
Acts together with cubilin to mediate HDL endocytosis (By similarity). May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release.
Gene Name:
LRP2
Uniprot ID:
P98164
Molecular Weight:
521952.77 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
Gene Name:
IGFBP7
Uniprot ID:
Q16270
Molecular Weight:
29130.055 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Zinc ion binding
Specific Function:
Modulates exocytosis of dense-core granules and secretion of hormones in the pancreas and the pituitary. Interacts with vesicles containing negatively charged phospholipids in a Ca(2+)-independent manner (By similarity).
Gene Name:
SYTL4
Uniprot ID:
Q96C24
Molecular Weight:
76022.99 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inducer
General Function:
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function:
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N...
Gene Name:
CYP1A2
Uniprot ID:
P05177
Molecular Weight:
58293.76 Da
References
  1. Drug Interactions: Cytochrome P450 Drug Interaction Table [Link]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on December 09, 2016 03:37