Identification
NamePalivizumab
Accession NumberDB00110  (BTD00097, BIOD00097)
TypeBiotech
GroupsApproved, Investigational
Description

Humanized monoclonal antibody (IgG1k) produced by recombinant DNA technology, directed to an epitope in the A antigenic site of the F protein of respiratory syncytial virus (RSV). Synagis is a composite of human (95%) and murine (5%) antibody sequences. The human heavy chain sequence was derived from the constant domains of human IgG1 and the variable framework regions of the VH genes Cor (1) and Cess (2). The human lightchain sequence was derived from the constant domain of Ck and the variable framework regions of the VL gene K104 withJk-4. Palivizumab is expressed from a stable murine (mouse) myeloma cell line (NS0). Palivizumab is composed of to heavy chains (50.6 kDa each) and two light chains (27.6 kDa each), contains 1-2% carbohydrate by weight and has a molecular weight of 147.7 kDa +/- 1 kDa (MALDI-TOF)

Protein structureDb00110
Related Articles
Protein chemical formulaNot Available
Protein average weightNot Available
Sequences
>VH region MEDI-493
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKD
YNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSS
>VH Region
QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKD
YNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSS
Download FASTA Format
Synonyms
anti-RSV
Synagis
External IDs Not Available
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SynagisPowder, for solution50 mgIntramuscularAbbvie2002-09-26Not applicableCanada
SynagisSolution100 mgIntramuscularAbbvie2016-11-03Not applicableCanada
SynagisInjection, powder, for solution100 mgIntramuscularAbbvie1999-08-13Not applicableEu
SynagisInjection, solution100 mg/mLIntramuscularMed Immune, Llc1998-06-19Not applicableUs
SynagisSolution50 mgIntramuscularAbbvie2016-11-03Not applicableCanada
SynagisPowder, for solution100 mgIntramuscularAbbvie2002-09-26Not applicableCanada
SynagisInjection, solution100 mg/mLIntramuscularAbbvie1999-08-13Not applicableEu
SynagisInjection, solution50 mg/.5mLIntramuscularMed Immune, Llc1999-12-09Not applicableUs
SynagisInjection, powder, for solution50 mgIntramuscularAbbvie1999-08-13Not applicableEu
SynagisInjection, solution100 mg/mLIntramuscularAbbvie1999-08-13Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNIIDQ448MW7KS
CAS number188039-54-5
Pharmacology
Indication

For prophylaxis of respiratory diseases casued by respiratory syncytial virus.

Structured Indications
Pharmacodynamics

Synagis exhibits neutralizing and fusion-inhibitory activity against Respiratory syncytial virus (RSV). These activities inhibit RSV replication or spread. Synagis is given to prevent the development of lower respiratory tract disease in pediatric patients.

Mechanism of action

Palivizumab binds to the fusion glycoprotein of RSV. This prevents its binding and uptake by host cellular receptors.

TargetKindPharmacological actionActionsOrganismUniProt ID
Fusion glycoprotein F0ProteinyesNot AvailableHuman respiratory syncytial virus B (strain 18537)P13843 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system.

Route of eliminationNot Available
Half life

18-20 days (in adults)

ClearanceNot Available
ToxicityNot Available
Affected organismsNot Available
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
BelimumabThe risk or severity of adverse effects can be increased when Palivizumab is combined with Belimumab.Approved
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Palivizumab.Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Palivizumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Palivizumab.Investigational
RindopepimutThe therapeutic efficacy of CDX-110 can be decreased when used in combination with Palivizumab.Investigational
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Palivizumab.Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General ReferencesNot Available
External Links
ATC CodesJ06BB16 — Palivizumab
AHFS Codes
  • 08:18.24
PDB Entries
FDA labelDownload (36.1 KB)
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
1, 2CompletedPreventionMotavizumab Administration for a Second Season for RSV Prophylaxis1
2CompletedPreventionChronic Lung Disease and <= 24 Months of Age or / Infections, Respiratory Syncytial Virus / Premature With Gestational Age <=35 Weeks and <=6 Months of Age1
2CompletedPreventionCongenital Heart Disease (CHD)1
2CompletedTreatmentUnhealthy Children With a History of Prematurity1
2, 3CompletedPreventionChronic Lung Disease of Prematurity / Congenital Heart Disease (CHD) / Infections, Respiratory Syncytial Virus / Premature Births1
3Active Not RecruitingTreatmentRespiratory Syncytial Virus (RSV)1
3CompletedPreventionInfections, Respiratory Syncytial Virus2
3CompletedSupportive CareCancers1
3RecruitingTreatmentRespiratory Syncytial Virus-bronchiolitis1
4CompletedTreatmentChronic Lung Diseases1
Not AvailableCompletedNot AvailableInfections, Respiratory Syncytial Virus1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntramuscular100 mg
Injection, powder, for solutionIntramuscular50 mg
Injection, solutionIntramuscular100 mg/mL
Injection, solutionIntramuscular50 mg/.5mL
Powder, for solutionIntramuscular100 mg
Powder, for solutionIntramuscular50 mg
SolutionIntramuscular100 mg
SolutionIntramuscular50 mg
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2197684 No2000-10-312015-08-09Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human respiratory syncytial virus B (strain 18537)
Pharmacological action
yes
General Function:
Not Available
Specific Function:
During virus entry, induces fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. The fusogenic activity is inactive untill entry into host cell endosome, where a furin-like protease cleaves off a small peptide between F1 and F2. Interacts directly with heparan sulfate and may participates in virus attachment. Furthermore, the F2 subunit was identife...
Gene Name:
F
Uniprot ID:
P13843
Uniprot Name:
Fusion glycoprotein F0
Molecular Weight:
63687.815 Da
References
  1. Huang K, Incognito L, Cheng X, Ulbrandt ND, Wu H: Respiratory syncytial virus-neutralizing monoclonal antibodies motavizumab and palivizumab inhibit fusion. J Virol. 2010 Aug;84(16):8132-40. doi: 10.1128/JVI.02699-09. Epub 2010 Jun 2. [PubMed:20519399 ]
  2. Wu H, Pfarr DS, Losonsky GA, Kiener PA: Immunoprophylaxis of RSV infection: advancing from RSV-IGIV to palivizumab and motavizumab. Curr Top Microbiol Immunol. 2008;317:103-23. [PubMed:17990791 ]
  3. Robinson KA, Odelola OA, Saldanha I, McKoy N: Palivizumab for prophylaxis against respiratory syncytial virus infection in children with cystic fibrosis. Cochrane Database Syst Rev. 2010 Feb 17;(2):CD007743. doi: 10.1002/14651858.CD007743.pub2. [PubMed:20166098 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Uniprot Name:
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Uniprot Name:
Complement C1r subcomponent
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Uniprot Name:
Complement C1q subcomponent subunit A
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Uniprot Name:
Complement C1q subcomponent subunit B
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Uniprot Name:
Complement C1q subcomponent subunit C
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Uniprot Name:
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Uniprot Name:
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Uniprot Name:
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Uniprot Name:
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Uniprot Name:
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23