Ipilimumab

Identification

Name
Ipilimumab
Accession Number
DB06186
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Ipilimumab is a monoclonal antibody, more specifically a fully humanized IgG1 antibody produced in mammalian cell culture, to the cytotoxic T lymphocyte antigen-4 (CTLA-4) which activates antitumor immunity by inhibiting this major checkpoint.[2, 3] This antineoplastic agent was developed by Bristol-Myers Squibb and Medarex and FDA approved on March 25, 2011, for the treatment of melanoma.[8] On October 2015, the FDA approved expanded the indications for Ipilimumab, allowing it to be used to reduce the risk of relapsed skin cancer after surgery.[9] On July 11, 2018, the FDA approved an additional indication for the combination of low dose ipilimumab and Nivolumab for the treatment of previously treated microsatellite instability-high/deficient mismatch repair (MSI-H/dMMR) metastatic colorectal cancer.[10]

Protein structure
Db06186
Protein chemical formula
C6572H10126N1734O2080S40
Protein average weight
148000.0 Da
Sequences
>Ipilimumab heavy chain (patent appl. US20150283234) 
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
>Ipilimumab light chain 
EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • MDX-010
  • MDX-101
  • MDX-CTLA-4
  • MOAB-CTLA-4
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
YervoyLiquid5 mgIntravenousBristol Myers Squibb2012-03-08Not applicableCanada
YervoyInjection5 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2011-03-25Not applicableUs
YervoyInjection5 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2011-03-25Not applicableUs
Categories
UNII
6T8C155666
CAS number
477202-00-9

Pharmacology

Indication

Ipilimumab is approved for different conditions such as:

  • Treatment of unresectable or metastatic melanoma in patients 12 years and older.
  • Adjuvant treatment of patients with cutaneous melanoma with the pathologic involvement of regional lymph nodes of more than 1 mm who have undergone complete resection, including total lymphadenectomy.[Label]

In combination with Nivolumab, ipilimumab is approved for:

  • Treatment of patients with intermediate or poor risk, previously untreated advanced renal cell carcinoma
  • Treatment of 12 years and older patients with MSI-H/dMMR metastatic colorectal cancer with progression after treatment with fluoropyrimidine, oxaliplatin, and irinotecan.[Label]
Associated Conditions
Pharmacodynamics

In preclinical trials, ipilimumab was shown to inhibit tumor growth in mice, eradicate primary and metastatic melanomas, it has also been shown that it decreases serum prostate-specific antigens in prostate cancer patients and it produces a dose-dependent increase in T-cell activation.[4]

Ipilimumab has been shown to present an overall survival benefit in metastatic melanoma. The objective response rate of this gent has been studied to be in the range between 5-20% with disease control rates of 15-30%.[3] In clinical trials, in prostate cancer patients produce a decrease of >50% in PSA levels with a dose-response relationship between ipilimumab and CD8 T-cell activation which derived in an increase in interferon-gamma as well as lytic activity.[4]

The use of ipilimumab in combination with Nivolumab was based on the reports that indicated significant improvement in overall survival and objective response rate of 42%.[10] This combination was also confirmed by trials with progression after therapy colorectal cancer which obtained an overall response rate of 46% and 89% of those has a response duration of over 6 months.[11]

Mechanism of action

The cytotoxic T-lymphocyte antigen-4 (CTLA-4) is a cell surface molecule that plays an essential role in regulating the adaptative immune response. The activation of T-cells is tightly controlled by two main signals 1) initial binding of tumor-associated antigens on antigen presenting cells to T-cell receptors and 2) subsequent binding of B7 molecules on the antigen presenting cells to CD28 receptors on T cells. After T-cell activation, CTLA-4 will be upregulated and it will compete on the binding between CD28 and B7. The binding between CTLA-4 and B7 interrupts the stimulatory signal which in order blunts T-cell proliferation response.[6]

The action of ipilimumab produces an exacerbated autoimmunity.[3] This is explained as the absence or presence of CTLA-4 can augment or suppress the immune system's T-cell response in fighting disease. Ipilimumab is designed to block the activity of CTLA-4, thereby sustaining a potent T-cell response against tumor cells.[4]

However, this mechanism of action presents a limited clinical benefit to a fraction of treated patients an thus, it is thought that there should be an unknown mechanism related to host-dependent factors.[5]

TargetActionsOrganism
ACytotoxic T-lymphocyte protein 4Not AvailableHuman
Absorption

When administered once every 3 weeks for 4 cycles, the peak serum concentration and the AUC of ipilimumab are dose proportional within the dose range. The steady-state concentration is reached by the third dose and the accumulation rate was less or equal to 1.5.[6] In steady-state, the mean Cmin ranges from 19.4 mcg/ml to 58.1 mcg/ml when given in a dosage from 3-10 mg/kg.[Label] Once absorbed it is thought to be confined in the extracellular fluid due to its large molecular weight and it is not thought to be able to cross the blood-brain barrier.[12]

The combination of Nivolumab and ipilimumab are based on the fact that PD-1 and CTLA-4 checkpoints have nonredundant roles on T-cell modulation.[A35187]

Volume of distribution

The volume of distribution at steady-state is determined to be of 7.21L.[6]

Protein binding

No information regarding the plasma protein binding is available.

Metabolism

The metabolism of ipilimumab does not involve the cytochrome P450 enzyme system. Because ipilimumab is a protein it is expected to be degraded into small peptides and amino acids by proteolytic enzymes.[7]

Route of elimination

The main excretion is thought to be done in the urine. It is suggested that the systemic clearance increases proportionally with body weight.[12]

Half life

It has been determined that the terminal half-life of ipilimumab is of 14.7 days.[6]

Clearance

Clearance of ipilimumab was determined to be 15.3 mL/hr.[6]

Toxicity

The toxicity effect of ipilimumab differs from other cytotoxic chemotherapies. The adverse reactions related to ipilimumab are only related to the immune response due to the mechanism of action of this agent. These adverse reactions are mainly related to certain organs such as skin, gastrointestinal tract and endocrine glands.[3]

The carcinogenic, genotoxic and fertility effect of ipilimumab has not been evaluated.[Label]

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbacavirAbacavir may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ipilimumab.
AbituzumabThe risk or severity of adverse effects can be increased when Ipilimumab is combined with Abituzumab.
AcarboseAcarbose may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AceclofenacAceclofenac may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AcemetacinAcemetacin may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AcetaminophenAcetaminophen may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Acetylsalicylic acidAcetylsalicylic acid may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AclidiniumIpilimumab may decrease the excretion rate of Aclidinium which could result in a higher serum level.
AcrivastineIpilimumab may decrease the excretion rate of Acrivastine which could result in a higher serum level.
Food Interactions
Not Available

References

General References
  1. Ribas A: Tumor immunotherapy directed at PD-1. N Engl J Med. 2012 Jun 28;366(26):2517-9. doi: 10.1056/NEJMe1205943. Epub 2012 Jun 2. [PubMed:22658126]
  2. Johnson DB, Peng C, Abramson RG, Ye F, Zhao S, Wolchok JD, Sosman JA, Carvajal RD, Ariyan CE: Clinical Activity of Ipilimumab in Acral Melanoma: A Retrospective Review. Oncologist. 2015 Jun;20(6):648-52. doi: 10.1634/theoncologist.2014-0468. Epub 2015 May 11. [PubMed:25964307]
  3. Thumar JR, Kluger HM: Ipilimumab: a promising immunotherapy for melanoma. Oncology (Williston Park). 2010 Dec;24(14):1280-8. [PubMed:21294471]
  4. Authors unspecified: Ipilimumab. Drugs R D. 2010;10(2):97-110. doi: 10.2165/11584510-000000000-00000. [PubMed:20698719]
  5. Romano E, Kusio-Kobialka M, Foukas PG, Baumgaertner P, Meyer C, Ballabeni P, Michielin O, Weide B, Romero P, Speiser DE: Ipilimumab-dependent cell-mediated cytotoxicity of regulatory T cells ex vivo by nonclassical monocytes in melanoma patients. Proc Natl Acad Sci U S A. 2015 May 12;112(19):6140-5. doi: 10.1073/pnas.1417320112. Epub 2015 Apr 27. [PubMed:25918390]
  6. Trinh VA, Hagen B: Ipilimumab for advanced melanoma: a pharmacologic perspective. J Oncol Pharm Pract. 2013 Sep;19(3):195-201. doi: 10.1177/1078155212459100. Epub 2012 Oct 9. [PubMed:23047236]
  7. Fellner C: Ipilimumab (yervoy) prolongs survival in advanced melanoma: serious side effects and a hefty price tag may limit its use. P T. 2012 Sep;37(9):503-30. [PubMed:23066344]
  8. FDA approval [Link]
  9. FDA letters [Link]
  10. FDA news [Link]
  11. FDA news [Link]
  12. BCC Cancer [File]
External Links
KEGG Drug
D04603
PubChem Substance
347910341
ChEMBL
CHEMBL1789844
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Ipilimumab
ATC Codes
L01XC11 — Ipilimumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (1.13 MB)
MSDS
Download (479 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Cancer / Renal Cancers / Stage IV Renal Cell Cancer AJCC V71
0Active Not RecruitingTreatmentProstate Cancer1
0CompletedTreatmentMelanoma1
0RecruitingTreatmentBlood And Marrow Transplantation / Leukemias / Malignant Lymphomas1
0RecruitingTreatmentLarynx / Lip, Oral Cavity and Pharynx1
0RecruitingTreatmentSarcomas1
0TerminatedTreatmentCiliary Body and Choroid Melanoma, Medium/Large Size / Ciliary Body and Choroid Melanoma, Small Size / Extraocular Extension Melanoma / Hepatic Metastases / Iris Melanoma / Metastatic Intraocular Melanoma / Recurrent Intraocular Melanoma / Stage IV Intraocular Melanoma1
1Active Not RecruitingBasic ScienceAdvanced Melanoma / Metastatic Melanoma1
1Active Not RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Chronic Lymphocytic Leukaemia (CLL) / Lymphoma, B Cell1
1Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Positive Para-Aortic Lymph Node / Positive Pelvic Lymph Node / Stage IB Cervical Cancer / Stage IB2 Cervical Cancer / Stage IB2 Cervical Cancer AJCC v6 and v7 / Stage II Cervical Cancer / Stage II Cervical Cancer AJCC v7 / Stage IIA Cervical Cancer / Stage IIA Cervical Cancer AJCC v7 / Stage IIB Cervical Cancer / Stage IIB Cervical Cancer AJCC v6 and v7 / Stage IIIB Cervical Cancer / Stage IIIB Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v71
1Active Not RecruitingTreatmentAdvanced Cancers1
1Active Not RecruitingTreatmentBRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1Active Not RecruitingTreatmentCancer, Advanced1
1Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentDuct Cell Adenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
1Active Not RecruitingTreatmentGlioblastomas / Gliosarcoma / Supratentorial Glioblastoma1
1Active Not RecruitingTreatmentChronic, recurrent Lymphocytic Leukemia / Hematopoietic Cell Transplantation Recipient / Myelodysplastic Syndrome / Myeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Tumors, Solid1
1Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1Active Not RecruitingTreatmentMalignant Melanoma1
1Active Not RecruitingTreatmentMelanoma2
1Active Not RecruitingTreatmentMelanoma (Skin)1
1Active Not RecruitingTreatmentMelanoma / Skin Cancers1
1Active Not RecruitingTreatmentRecurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain1
1Active Not RecruitingTreatmentSolid Cancers1
1Active Not RecruitingTreatmentStage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v71
1CompletedTreatmentAcute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Chronic Myelomonocytic Leukemia / Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes1
1CompletedTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Childhood Myelodysplastic Syndromes / Chronic Lymphocytic Leukemia (CLL) - Refractory / Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Disseminated Neuroblastoma / Neoplasms, Malignant / Ovarian Choriocarcinoma / Ovarian Embryonal Carcinoma / Ovarian Immature Teratoma / Ovarian Mature Teratoma / Ovarian Mixed Germ Cell Tumor / Ovarian Monodermal and Highly Specialized Teratoma / Ovarian Polyembryoma / Ovarian Yolk Sac Tumor / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Mantle Cell Lymphoma / Recurrent Neuroblastoma / Recurrent Ovarian Epithelial Cancer / Recurrent Ovarian Germ Cell Tumor / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage II Ovarian Epithelial Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Multiple Myeloma / Stage III Ovarian Epithelial Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Stage IV Ovarian Epithelial Cancer / Testicular Choriocarcinoma / Testicular Choriocarcinoma and Embryonal Carcinoma / Testicular Choriocarcinoma and Seminoma / Testicular Choriocarcinoma and Teratoma / Testicular Choriocarcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma / Testicular Embryonal Carcinoma and Seminoma / Testicular Embryonal Carcinoma and Teratoma / Testicular Embryonal Carcinoma and Teratoma With Seminoma / Testicular Embryonal Carcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma and Yolk Sac Tumor With Seminoma / Testicular Teratoma / Testicular Yolk Sac Tumor / Testicular Yolk Sac Tumor and Teratoma / Testicular Yolk Sac Tumor and Teratoma With Seminoma1
1CompletedTreatmentAdvanced Melanoma2
1CompletedTreatmentAdverse Effect of Radiation Therapy / Effects of Immunotherapy / Melanoma1
1CompletedTreatmentCD20 Positive / Recurrent B-Cell Non-Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma1
1CompletedTreatmentCancer, Breast / Head and Neck Carcinoma / Malignancies / Malignant Lymphomas / Melanoma / Triple-Negative Breast Cancer (TNBC)1
1CompletedTreatmentCancer, Breast / Invasive Adenocarcinoma of the Breast1
1CompletedTreatmentCancer,NOS1
1CompletedTreatmentCastrate Resistant Prostate Cancer (CRPC) / Prostate Cancer1
1CompletedTreatmentGastrointestinal Stromal Tumors / Stage III Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma1
1CompletedTreatmentHuman Immunodeficiency Virus (HIV)1
1CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1CompletedTreatmentMalignant Lymphomas1
1CompletedTreatmentMalignant Lymphomas / Neuroblastomas / Sarcomas / Wilms' tumor1
1CompletedTreatmentMalignant Melanoma2
1CompletedTreatmentMalignant Neoplasm of Pancreas1
1CompletedTreatmentMelanoma3
1CompletedTreatmentProstatic Neoplasms1
1CompletedTreatmentRecurrent Prostate Carcinoma / Stage IV Prostate Cancer / Stage IV Prostate Cancer AJCC v71
1CompletedTreatmentTransitional Cell Carcinoma1
1CompletedTreatmentTumors, Solid1
1CompletedTreatmentUnresectable Melanoma1
1Not Yet RecruitingTreatmentAcute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / Refractory Acute Myeloid Leukemia1
1Not Yet RecruitingTreatmentColorectal neoplasms malignant / Hepatic Metastases1
1Not Yet RecruitingTreatmentGlioblastoma Multiforme (GBM) / Glioblastomas1
1Not Yet RecruitingTreatmentGlioblastomas1
1Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1Not Yet RecruitingTreatmentPathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v81
1Not Yet RecruitingTreatmentRenal Cancers1
1Not Yet RecruitingTreatmentSolid Tumor, Adult1
1RecruitingBasic ScienceMelanoma1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingTreatmentAcute Myeloid Leukemia and Myelodysplastic Syndrome1
1RecruitingTreatmentAdenocarcinoma of the Pancreas / Colon Carcinoma Metastatic in the Liver / Colorectal Adenocarcinoma / Resectable Pancreatic Carcinoma / Stage I Pancreatic Cancer / Stage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage II Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1RecruitingTreatmentAdult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Recurrent Classic Hodgkin Lymphoma / Recurrent Classical Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentAdvanced Cancers / Advanced Malignant Solid Neoplasm / C-KIT Tyrosine Kinase Protein Overexpression / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Metastatic Gastrointestinal Stromal Tumor / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Unresectable Melanoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentAdvanced Cancers / Melanoma1
1RecruitingTreatmentAdvanced Malignancies1
1RecruitingTreatmentAdvanced Tumor / Metastatic Tumors1
1RecruitingTreatmentAdvanced/Metastatic Solid Tumors or Lymphomas1
1RecruitingTreatmentB Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Recurrent B Acute Lymphoblastic Leukemia / Refractory B Acute Lymphoblastic Leukemia1
1RecruitingTreatmentBladder Small Cell Neuroendocrine Carcinoma / Clear Cell Renal Cell Carcinoma / Infiltrating Bladder Urothelial Carcinoma Sarcomatoid Variant / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Kidney Medullary Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Renal Cell Carcinoma / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Sarcomatoid Renal Cell Carcinoma / Solid Neoplasms / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma / Stage III Bladder Adenocarcinoma AJCC v6 and v7 / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Penile Cancer / Stage III Penile Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer / Stage III Urethral Cancer AJCC v7 / Stage IIIa Penile Cancer / Stage IIIa Penile Cancer AJCC v7 / Stage IIIb Penile Cancer / Stage IIIb Penile Cancer AJCC v7 / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Adenocarcinoma AJCC v7 / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Squamous Cell Carcinoma AJCC v7 / Stage IV Bladder Urothelial Carcinoma / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Penile Cancer / Stage IV Penile Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer / Stage IV Urethral Cancer AJCC v7 / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma1
1RecruitingTreatmentBlasts 5 Percent or More of Bone Marrow Nucleated Cells / Chimerism / Hematopoietic Cell Transplantation Recipient / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Myelodysplastic Syndrome With Excess Blasts-1 / Myelodysplastic Syndrome With Excess Blasts-2 / Previously Treated Myelodysplastic Syndromes / Recurrent Acute Myeloid Leukemia With Myelodysplasia-Related Changes / Recurrent Adult Acute Myeloid Leukemia / Refractory Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Untreated Adult Acute Myeloid Leukemia1
1RecruitingTreatmentBreast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm1
1RecruitingTreatmentCancer, Advanced2
1RecruitingTreatmentGlioblastomas1
1RecruitingTreatmentHepatic Metastases / Uveal Melanoma1
1RecruitingTreatmentHepatocellular,Carcinoma1
1RecruitingTreatmentMalignant Gliomas1
1RecruitingTreatmentMalignant Neoplasm of Pancreas / Melanoma / Prostate Cancer / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentMalignant Peritoneal Neoplasm / Malignant Retroperitoneal Neoplasm / Peritoneal Carcinomatosis / Recurrent Cervical Carcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage IV Cervical Cancer AJCC v8 / Stage IV Fallopian Tube Cancer AJCC v8 / Stage IV Ovarian Cancer AJCC v8 / Stage IV Primary Peritoneal Cancer AJCC v8 / Stage IV Uterine Corpus Cancer AJCC v8 / Stage IVA Cervical Cancer AJCC v8 / Stage IVA Fallopian Tube Cancer AJCC v8 / Stage IVA Ovarian Cancer AJCC v8 / Stage IVA Primary Peritoneal Cancer AJCC v8 / Stage IVA Uterine Corpus Cancer AJCC v8 / Stage IVB Cervical Cancer AJCC v8 / Stage IVB Fallopian Tube Cancer AJCC v8 / Stage IVB Ovarian Cancer AJCC v8 / Stage IVB Primary Peritoneal Cancer AJCC v8 / Stage IVB Uterine Corpus Cancer AJCC v81
1RecruitingTreatmentMelanoma1
1RecruitingTreatmentMelanoma and Other Malignant Neoplasms of Skin1
1RecruitingTreatmentMetastatic Hormone-sensitive Prostate Cancer1
1RecruitingTreatmentMetastatic Melanoma3
1RecruitingTreatmentMetastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
1RecruitingTreatmentMetastatic Solid Tumors / Treatment-Refractory Cancers1
1RecruitingTreatmentNewly Diagnosed Glioblastoma1
1RecruitingTreatmentProstate Cancer1
1RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
1RecruitingTreatmentStage IV Small Cell Lung Cancer1
1RecruitingTreatmentTransitional Cell Carcinoma1
1RecruitingTreatmentTumors, Solid1
1TerminatedOtherMelanoma1
1TerminatedTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Non-Small Cell Lung Cancer Recurrent / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Recurrent Melanoma / Recurrent Ovarian Epithelial Cancer / Stage IV Melanoma / Stage IV Non-Small Cell Lung Cancer1
1TerminatedTreatmentMalignant Melanoma1
1TerminatedTreatmentMelanoma1
1TerminatedTreatmentMetastatic Melanoma1
1TerminatedTreatmentNewly Diagnosed Melanoma Metastases in the Brain and Spine1
1TerminatedTreatmentProstate Cancer1
1TerminatedTreatmentStage III or IV Melanoma1
1TerminatedTreatmentUnresectable or Metastatic Melanoma1
1WithdrawnTreatmentChronic Myeloid Leukemia (CML)1
1WithdrawnTreatmentMalignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)1
1WithdrawnTreatmentMelanoma1
1WithdrawnTreatmentMelanoma / Sarcomas1
1, 2Active Not RecruitingTreatmentAdvanced Malignancies / Advanced or Metastatic Malignancies1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors / Tumors, Solid1
1, 2Active Not RecruitingTreatmentCancer,NOS1
1, 2Active Not RecruitingTreatmentExtensive-Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)1
1, 2Active Not RecruitingTreatmentHepatocellular,Carcinoma1
1, 2Active Not RecruitingTreatmentLiver Cancer / Lung Cancers1
1, 2Active Not RecruitingTreatmentMSS / RAS-mutant Colorectal Cancer1
1, 2Active Not RecruitingTreatmentMalignancies1
1, 2Active Not RecruitingTreatmentMalignant Melanoma1
1, 2Active Not RecruitingTreatmentMelanoma1
1, 2Active Not RecruitingTreatmentMetastatic Melanoma1
1, 2Active Not RecruitingTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2Active Not RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
1, 2Active Not RecruitingTreatmentOvarian Cancer Metastatic1
1, 2Active Not RecruitingTreatmentProstate Cancer1
1, 2CompletedTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma1
1, 2CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)1
1, 2CompletedTreatmentMelanoma1
1, 2CompletedTreatmentMelanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma1
1, 2CompletedTreatmentMetastatic Melanoma1
1, 2CompletedTreatmentNeoplasms Metastasis / Prostate Cancer1
1, 2CompletedTreatmentRecurrent Melanoma / Stage IV Melanoma1
1, 2CompletedTreatmentUnresectable Stage III or IV Malignant Melanoma1
1, 2Not Yet RecruitingTreatmentGrade II Meningioma / Grade III Meningioma / Recurrent Meningiomas1
1, 2Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
1, 2Not Yet RecruitingTreatmentLarynx / LIP / Oral Cavity Cancer / Pharynx Cancer1
1, 2RecruitingPreventionStage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2RecruitingTreatmentAdenocarcinoma of the Pancreas1
1, 2RecruitingTreatmentAdvanced Malignancies / Metastatic Cancers / Metastatic Malignancy1
1, 2RecruitingTreatmentAdvanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma1
1, 2RecruitingTreatmentAdvanced Solid Tumors1
1, 2RecruitingTreatmentCancer, Advanced3
1, 2RecruitingTreatmentCancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1, 2RecruitingTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
1, 2RecruitingTreatmentCarcinoma,Non-Small-Cell Lung / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentChildhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Melanoma / Refractory Neuroblastoma / Refractory Non-Hodgkin's lymphoma / Refractory Osteosarcoma / Refractory Rhabdomyosarcoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1, 2RecruitingTreatmentClassical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Classic Hodgkin Lymphoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
1, 2RecruitingTreatmentColorectal Cancers / Gastroesophageal Adenocarcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Transitional Cell Carcinoma / Tumors, Solid1
1, 2RecruitingTreatmentHepatic Metastases / Uveal Melanoma1
1, 2RecruitingTreatmentImmunotherapy / Neoplasms, Head and Neck1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers1
1, 2RecruitingTreatmentLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1, 2RecruitingTreatmentMalignancies2
1, 2RecruitingTreatmentMalignancies / Neoplasms / Tumors1
1, 2RecruitingTreatmentMalignant Lymphomas / Multiple Myeloma (MM)1
1, 2RecruitingTreatmentMalignant Lymphomas / Tumors, Solid1
1, 2RecruitingTreatmentMelanoma2
1, 2RecruitingTreatmentMelanoma / Melanoma Stage Iii / Melanoma Stage Iv1
1, 2RecruitingTreatmentMelanoma / Renal Cell Adenocarcinoma1
1, 2RecruitingTreatmentMetastatic Brain Tumors / Metastatic Malignant Neoplasm in the Brain / Stage IV Non-Small Cell Lung Cancer AJCC v71
1, 2RecruitingTreatmentMetastatic Melanoma2
1, 2RecruitingTreatmentNon Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentRefractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma1
1, 2RecruitingTreatmentStage III/IV Melanoma1
1, 2RecruitingTreatmentVarious Advanced Cancer1
1, 2SuspendedTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Colon Cancer / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Melanoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Rectal Cancer / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentAdult Grade III Lymphomatoid Granulomatosis / B-Cell Chronic Lymphocytic Leukemia / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentMelanoma1
1, 2TerminatedTreatmentMelanoma / Metastatic Melanoma1
1, 2TerminatedTreatmentMetastatic Cancers1
1, 2TerminatedTreatmentUnresectable Stage III or Stage IV Melanoma1
1, 2WithdrawnTreatmentAdvanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage III Uveal Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm1
1, 2WithdrawnTreatmentHepatic Metastases / Lung Cancer Metastatic / Metastatic Brain Tumors / Metastatic Melanoma1
1, 2WithdrawnTreatmentMelanoma2
1, 2WithdrawnTreatmentMetastatic Melanoma1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Human Papillomavirus Infections / Recurrent Cervical Carcinoma / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v71
2Active Not RecruitingTreatmentAdenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer1
2Active Not RecruitingTreatmentAdvanced or Metastatic Melanoma1
2Active Not RecruitingTreatmentCancer of the Ovary / Platinum-sensitive Ovarian Cancer, Second-line, Third-line, or Fourth-line1
2Active Not RecruitingTreatmentHead and Neck Carcinoma1
2Active Not RecruitingTreatmentHepatic Metastases / Lung Cancer Metastatic / Recurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2Active Not RecruitingTreatmentMicrosatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer1
2Active Not RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2Active Not RecruitingTreatmentMelanoma7
2Active Not RecruitingTreatmentMelanoma Stage Iii / Melanoma Stage Iv1
2Active Not RecruitingTreatmentMelanoma / Metastatic Brain Tumors2
2Active Not RecruitingTreatmentMelanoma / Metastatic Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Uveal Melanoma1
2Active Not RecruitingTreatmentMesothelioma1
2Active Not RecruitingTreatmentMetastatic Brain Tumors / Metastatic Melanoma1
2Active Not RecruitingTreatmentMetastatic Castration Sensitive Prostate Cancer1
2Active Not RecruitingTreatmentMetastatic Melanoma / Mucosal Melanoma / Recurrent Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IV Uveal Melanoma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Unresectable Melanoma1
2Active Not RecruitingTreatmentProstate Cancer1
2Active Not RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentRecurrent Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma1
2Active Not RecruitingTreatmentRecurrent Melanoma / Stage IIIA Melanoma / Stage IIIB Melanoma / Stage IIIc Melanoma / Stage IV Melanoma1
2Active Not RecruitingTreatmentRecurrent Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Unresectable Melanoma1
2Active Not RecruitingTreatmentRecurrent Melanoma / Stage IV Skin Melanoma1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
2Active Not RecruitingTreatmentTransitional Cell Carcinoma1
2Active Not RecruitingTreatmentUntreated Stage III Melanoma or Stage IV Melanoma1
2Active Not RecruitingTreatmentUveal Melanoma1
2CompletedTreatmentAdenocarcinomas / Cancer, Breast1
2CompletedTreatmentBrain Metastasis / Melanoma1
2CompletedTreatmentExtensive Stage Small Cell Lung Cancer1
2CompletedTreatmentIn-transit Metastases Melanoma Stage IIIB and IIIC1
2CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)2
2CompletedTreatmentLocally Advanced (Unresectable) or Metastatic Adenocarcinoma of the Gastric and Gastro-esophageal Junction1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers1
2CompletedTreatmentMalignant Melanoma3
2CompletedTreatmentMalignant Melanoma Stage III / Malignant Melanoma Stage IV1
2CompletedTreatmentMalignant Neoplasm of Pancreas1
2CompletedTreatmentMelanoma9
2CompletedTreatmentMelanoma (Skin)1
2CompletedTreatmentMetastatic Leiomyosarcoma / Unresectable Leiomyosarcoma / Uterine Corpus Leiomyosarcoma1
2CompletedTreatmentMetastatic Malignant Melanoma1
2CompletedTreatmentMetastatic Melanoma2
2CompletedTreatmentOcular Melanoma1
2CompletedTreatmentProstate Cancer3
2CompletedTreatmentProstatic Neoplasms1
2CompletedTreatmentRenal Cancers1
2Enrolling by InvitationTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Carcinoma1
2Not Yet RecruitingTreatmentAdenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Clinical Stage I Esophageal Adenocarcinoma AJCC v8 / Clinical Stage I Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v81
2Not Yet RecruitingTreatmentAdvanced Melanoma / Metastatic Melanoma / Metastatic Melanoma Stratified by MHC-II Expression1
2Not Yet RecruitingTreatmentAppendiceal Tumor / Colorectal Tumors / Mucinous Neoplasm1
2Not Yet RecruitingTreatmentBasal Cell Nevus Syndrome1
2Not Yet RecruitingTreatmentBreast Neoplasm Female / Cancer, Breast / Carcinoma, Breast / Tumors, Breast1
2Not Yet RecruitingTreatmentCancer, Breast1
2Not Yet RecruitingTreatmentChondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentClassic Kaposi Sarcoma1
2Not Yet RecruitingTreatmentCutaneous Melanoma, Stage III / Cutaneous Melanoma, Stage IV / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Unresectable Melanoma1
2Not Yet RecruitingTreatmentGastric and Esophagogastric Junction Adenocarcinoma1
2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Not Yet RecruitingTreatmentHepatocellular Carcinoma (HCC)1
2Not Yet RecruitingTreatmentInoperable œsophageal Cancer1
2Not Yet RecruitingTreatmentMelanoma1
2Not Yet RecruitingTreatmentMelanoma Stage Iv1
2Not Yet RecruitingTreatmentNeuroendocrine Carcinomas1
2Not Yet RecruitingTreatmentVarious Advanced Cancer1
2RecruitingTreatmentAcinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Carcinoma, Adenoid Cystic / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Desmoid-Type Fibromatosis / Endometrial Adenocarcinomas / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Gastric Undifferentiated Carcinoma / Gastrointestinal Stromal Tumors / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metaplastic breast carcinoma / Metastatic Malignant Neoplasm of Unknown Primary Origin / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Rare Disorder / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Carcinoma / Vulvar Squamous Cell Carcinoma1
2RecruitingTreatmentAcute Bilineal Leukemia / Acute Biphenotypic Leukemia (ABL) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute, recurrent Myeloid Leukemia / Chronic Myelomonocytic Leukemia / Leukemias / Myelodysplastic Syndrome / Refractory Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Therapy-Related Acute Myeloid Leukemia1
2RecruitingTreatmentAdenocarcinoma of the Stomach / Esophageal Cancers / Gastrooesophageal Cancer / HER2 Positive Gastric Cancer / Malignant Neoplasm of Stomach / Metastatic Gastric Cancers1
2RecruitingTreatmentAdenocarcinoma of the Stomach / Gastrooesophageal Cancer1
2RecruitingTreatmentAdrenocortical Carcinoma / Genitourinary Cancers / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell1
2RecruitingTreatmentAdvanced Gastric Cancer1
2RecruitingTreatmentAdvanced Metastatic Cancer1
2RecruitingTreatmentAdvanced Non-Small Cell Lung Carcinoma / Metastatic Non-Small Cell Lung Carcinoma1
2RecruitingTreatmentAdvanced Renal Cell Carcinoma1
2RecruitingTreatmentAdvanced Solid Tumors1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentAnal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Recurrent Anal Canal Carcinoma / Stage IV Anal Canal Cancer / Stage IV Anal Canal Cancer AJCC v6 and v71
2RecruitingTreatmentBasal Cell Carcinoma (BCC)1
2RecruitingTreatmentBiliary Tract Neoplasms1
2RecruitingTreatmentBladder Cancers1
2RecruitingTreatmentCancer of the Ovary / Clear Cell Adenocarcinoma / Extra Renal Origin / Fallopian Tube Cancer / Primary Peritoneal Carcinoma1
2RecruitingTreatmentCancer of the Ovary / Malignant Neoplasm of Female Breast / Malignant Neoplasm of Stomach1
2RecruitingTreatmentCancer, Advanced2
2RecruitingTreatmentCancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma1
2RecruitingTreatmentCancer, Breast / Luminal B1
2RecruitingTreatmentCarcinoid Tumors / Neuroendocrine Tumors1
2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck1
2RecruitingTreatmentChromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma1
2RecruitingTreatmentClear Cell Metastatic Renal Cell Carcinoma1
2RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
2RecruitingTreatmentColon Carcinoma1
2RecruitingTreatmentCutaneous Melanoma / Melanoma / Mucosal Melanoma / Ocular Melanoma / Oligometastatic Melanoma / Stage III Acral Lentiginous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Uveal Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Uveal Melanoma AJCC v7 / Stage IV Acral Lentiginous Melanoma AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma AJCC v71
2RecruitingTreatmentEsophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Esophagus / Metastatic Esophageal Cancer / Metastatic Oesophageal Cancer / Oesophageal Cancer Nos1
2RecruitingTreatmentEye and Orbit1
2RecruitingTreatmentGBM / MGMT-unmethylated Glioblastoma (GBM)1
2RecruitingTreatmentGastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours1
2RecruitingTreatmentGastrointestinal Stromal Tumors1
2RecruitingTreatmentHER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma1
2RecruitingTreatmentHead and Neck Carcinoma1
2RecruitingTreatmentHepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs1
2RecruitingTreatmentKidney Cancer Metastatic / Kidney Cancer, Stage IV / Renal Cancers1
2RecruitingTreatmentLeptomeningeal Carcinomatosis / Melanoma1
2RecruitingTreatmentLeukemias / Myelodysplastic Syndrome1
2RecruitingTreatmentLimited Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)8
2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers / Relapsed Small cell lung cancer1
2RecruitingTreatmentLung Cancers1
2RecruitingTreatmentMalignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer1
2RecruitingTreatmentMajor Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma1
2RecruitingTreatmentMalignant Melanoma2
2RecruitingTreatmentMalignant Melanoma Stage III1
2RecruitingTreatmentMalignant Neoplasm of Colon1
2RecruitingTreatmentMalignant Neoplasm of Pancreas1
2RecruitingTreatmentMelanoma3
2RecruitingTreatmentMetastatic Biliary Tract Cancer / Pancreatic Cancer Metastatic1
2RecruitingTreatmentMetastatic Brain Tumors / Metastatic Melanoma1
2RecruitingTreatmentMetastatic Cancers / Metastatic Castration Resistant Prostate Cancer1
2RecruitingTreatmentMetastatic Melanoma3
2RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2RecruitingTreatmentMucosal Melanoma1
2RecruitingTreatmentNasopharyngeal Carcinoma1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Skin Cancers1
2RecruitingTreatmentOther Disorders of Kidney and Ureter / Renal Medullary Carcinoma1
2RecruitingTreatmentPan Tumor1
2RecruitingTreatmentProstate Cancer3
2RecruitingTreatmentProstate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma1
2RecruitingTreatmentProstatic Neoplasms1
2RecruitingTreatmentRecurrent Glioblastoma1
2RecruitingTreatmentRenal Cancers1
2RecruitingTreatmentRenal Cell Adenocarcinoma2
2RecruitingTreatmentSalivary Gland Cancers1
2RecruitingTreatmentStage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2RecruitingTreatmentStage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
2RecruitingTreatmentStage IV Melanoma / Unresectable Stage III Melanoma1
2RecruitingTreatmentSystemic Connective Tissue Disorders1
2RecruitingTreatmentThyroid Cancers1
2RecruitingTreatmentUveal Melanoma1
2RecruitingTreatmentVarious Advanced Cancer1
2SuspendedTreatmentGastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Metastatic Liposarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Liposarcoma1
2SuspendedTreatmentC-MET Gene Amplification / MET Exon 14 Mutation / Metastatic Lung Non-Squamous Non-Small Cell Carcinoma / Metastatic Non-Squamous Non-Small Cell Lung Carcinoma / Recurrent Non-Squamous Non-Small Cell Lung Carcinoma / RET/PTC Rearrangement / ROS1 Gene Rearrangement / Stage IV Non-Small Cell Lung Cancer AJCC v71
2SuspendedTreatmentPancreatic Adenocarcinoma Metastatic1
2TerminatedTreatmentA Combination of Adoptive T Cell Therapy and Ipilimumab Could Increase the Proportion of CR Patients, and Durability of Response1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2TerminatedTreatmentMalignant Melanoma1
2TerminatedTreatmentMelanoma2
2TerminatedTreatmentMetastatic Melanoma2
2TerminatedTreatmentProstate Cancer1
2Unknown StatusTreatmentMalignant Melanoma, Metastatic1
2WithdrawnTreatmentCervical Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oesophageal Carcinoma / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma1
2WithdrawnTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
2WithdrawnTreatmentMelanoma (Skin)1
2WithdrawnTreatmentMelanoma / Metastatic Melanoma1
2WithdrawnTreatmentNeuroendocrine Carcinoma of the Skin1
2WithdrawnTreatmentProstate Cancer1
2, 3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v71
2, 3SuspendedTreatmentRecurrent Melanoma of the Skin / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3Active Not RecruitingTreatmentAdvanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
3Active Not RecruitingTreatmentHigh Risk Stage III Melanoma1
3Active Not RecruitingTreatmentLung Cancers1
3Active Not RecruitingTreatmentMelanoma7
3Active Not RecruitingTreatmentMelanoma of Unknown Primary / Recurrent Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma1
3Active Not RecruitingTreatmentMesothelioma1
3Active Not RecruitingTreatmentMetastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Mucosal Melanoma of the Head and Neck / Stage III Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVA Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVC Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck AJCC v7 / Stages III Skin Melanoma1
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentUnresectable or Metastatic Melanoma1
3CompletedTreatmentLung Cancer - Non Small Cell (Squamous) / Lung Cancer - Non Small Cell Squamous / Lung Cancer Non-Small Cell Cancer (NSCLC)1
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3CompletedTreatmentMelanoma2
3CompletedTreatmentMelanoma / Metastases1
3CompletedTreatmentProstate Cancer2
3CompletedTreatmentSmall Cell Lung Carcinoma1
3Not Yet RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
3Not Yet RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
3RecruitingTreatmentBRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
3RecruitingTreatmentHead and Neck Carcinoma2
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)5
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs1
3RecruitingTreatmentMetastatic Brain Tumors1
3RecruitingTreatmentMetastatic Melanoma2
3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v71
3RecruitingTreatmentRenal Cell Adenocarcinoma2
3RecruitingTreatmentUrothelial Cancer1
3RecruitingTreatmentVarious Advanced Cancer1
3WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
4Active Not RecruitingTreatmentMalignant Melanoma1
4Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
4RecruitingTreatmentLung Cancers1
4TerminatedTreatmentMetastatic Melanoma1
Not AvailableActive Not RecruitingNot AvailableAdenocarcinomas1
Not AvailableActive Not RecruitingTreatmentCancer, Breast1
Not AvailableActive Not RecruitingTreatmentMetastatic Melanoma1
Not AvailableCompletedNot AvailableAdvanced Melanoma1
Not AvailableCompletedNot AvailableMelanoma3
Not AvailableCompletedTreatmentPreviously Untreated and Histologically Confirmed Stage III (Unresectable) or Stage IV Melanoma1
Not AvailableNo Longer AvailableNot AvailableMalignant Melanoma1
Not AvailableNo Longer AvailableNot AvailableMelanoma1
Not AvailableRecruitingNot AvailableAcral lentiginous melanoma / Mucosal Melanoma1
Not AvailableRecruitingNot AvailableMelanoma2
Not AvailableTemporarily Not AvailableNot AvailableGlioblastomas / Glioma of Brain1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
InjectionIntravenous5 mg/1mL
LiquidIntravenous5 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2381770No2007-08-072020-08-08Canada

Properties

State
Solid
Experimental Properties
PropertyValueSource
melting point (°C)80-90 ºC (based on IgG properties)McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282
boiling point (°C)Fab and Fc domains denaturates at 60 and 70 ºC respectivelyArnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility50 mg/mlHuman IgG purified. Product Information
isoelectric point6.1-8.5 Agrisera Information about IgG antibodies.

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
General Function
Not Available
Specific Function
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of t...
Gene Name
CTLA4
Uniprot ID
P16410
Uniprot Name
Cytotoxic T-lymphocyte protein 4
Molecular Weight
24655.63 Da
References
  1. Yang JC, Hughes M, Kammula U, Royal R, Sherry RM, Topalian SL, Suri KB, Levy C, Allen T, Mavroukakis S, Lowy I, White DE, Rosenberg SA: Ipilimumab (anti-CTLA4 antibody) causes regression of metastatic renal cell cancer associated with enteritis and hypophysitis. J Immunother. 2007 Nov-Dec;30(8):825-30. [PubMed:18049334]

Drug created on March 19, 2008 10:16 / Updated on December 12, 2018 07:17