Identification

Name
Ipilimumab
Accession Number
DB06186
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Ipilimumab is a fully humanized IgG1 monoclonal antibody that blocks cytotoxic T lymphocyte antigen-4 (CTLA-4).5 Blocking CTLA-4 removes an inhibitory signal from reducing the activity of T lymphocytes.1,2,5 Ipilimumab was developed by Bristol-Myers Squibb and Medarex.5

Ipilimumab was granted FDA approval on 25 March 2011.5

Protein structure
Db06186
Protein chemical formula
C6572H10126N1734O2080S40
Protein average weight
148000.0 Da
Sequences
>Ipilimumab heavy chain (patent appl. US20150283234) 
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
>Ipilimumab light chain 
EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Ipilimumab
External IDs
BMS-734016 / MDX-010 / MDX-101 / MDX-CTLA-4 / MOAB-CTLA-4
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
YervoyInjection5 mg/1mLIntravenousBaxter Pharmaceutical Solutions, LLC2011-03-252016-04-11Us
YervoyInjection5 mg/1mLIntravenousBaxter Pharmaceutical Solutions, LLC2011-03-252016-04-11Us
YervoyLiquid5 mgIntravenousBristol Myers Squibb2012-03-08Not applicableCanada
YervoyInjection5 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2011-03-25Not applicableUs
YervoyInjection5 mg/1mLIntravenousE.R. Squibb & Sons, L.L.C.2011-03-25Not applicableUs
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
International/Other Brands
Yervoy
Categories
UNII
6T8C155666
CAS number
477202-00-9

Pharmacology

Indication

Ipilimumab is indicated to treat unresectable or metastatic melanoma, as an adjuvant in the treatment of cutaneous melanoma, to treat microsatellite-high or mismatch repair deficient metastatic colorectal cancer, or to treat hepatocellular carcinoma.5 Ipilimumab with nivolumab is indicated to treat advanced renal cell carcinoma.5

Associated Conditions
Pharmacodynamics

Ipilimumab is a human IgG1 that binds CTLA-4, preventing 1 T-cell inhibition signal pathway.3 It has a long duration of action as it is given every 3 to 4 weeks.5 Patients should be counselled regarding the risk of immune-mediated adverse effects, infusion related reactions, and embryo-fetal toxicity.5

Mechanism of action

Cytotoxic T-lymphocyte antigen-4 (CTLA-4) is an inhibitory molecule that competes with the stimulatory CD28 for binding to B7 on antigen presenting cells.3 CTLA-4 and CD28 are both presented on the surface of T-cells.3 Ipilimumab is a human IgG1 that binds CTLA-4, preventing the inhibition of T-cell mediated immune responses to tumors.3

TargetActionsOrganism
ACytotoxic T-lymphocyte protein 4
inhibitor
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Cmax was 65.8µg/mL for 2-6 year olds, 70.1µg/mL for 6-<12 year olds, and 73.3µg/mL in patients 12 years and older.5 Data regarding the AUC and Tmax of ipilumumab are not readily available.3,5

Volume of distribution

The volume of distribution at steady-state of ipilimumab is 7.21L.3

Protein binding

Data regarding the protein binding of ipilimumab is not readily available.5

Metabolism

The metabolism of ipilimumab does not involve the cytochrome P450 enzyme system.5,6 Because ipilimumab is a protein, it is expected to be degraded into small peptides and amino acids by proteolytic enzymes.4

Route of elimination

Data regarding the route of elimination of ipilimumab is not readily available.5

Half life

Ipilimumab has a half life of 14.7 days.3

Clearance

Ipilimumab has a clearance of 15.3 mL/hr.3 Systemic clearance increases proportionally with body weight.6

Toxicity

Data regarding ipilumumab overdose is not readily available.5 However, the most common adverse reactions to ipilumumab are fatigue, diarrhea, pruritus, rash, and colitis.5

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbacavirAbacavir may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ipilimumab.
AbituzumabThe risk or severity of adverse effects can be increased when Ipilimumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Ipilimumab is combined with Abrilumab.
AcarboseAcarbose may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AceclofenacAceclofenac may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AcemetacinAcemetacin may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AcetaminophenAcetaminophen may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
AcetazolamideAcetazolamide may increase the excretion rate of Ipilimumab which could result in a lower serum level and potentially a reduction in efficacy.
Acetylsalicylic acidAcetylsalicylic acid may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
No interactions found.

References

General References
  1. Johnson DB, Peng C, Abramson RG, Ye F, Zhao S, Wolchok JD, Sosman JA, Carvajal RD, Ariyan CE: Clinical Activity of Ipilimumab in Acral Melanoma: A Retrospective Review. Oncologist. 2015 Jun;20(6):648-52. doi: 10.1634/theoncologist.2014-0468. Epub 2015 May 11. [PubMed:25964307]
  2. Thumar JR, Kluger HM: Ipilimumab: a promising immunotherapy for melanoma. Oncology (Williston Park). 2010 Dec;24(14):1280-8. [PubMed:21294471]
  3. Trinh VA, Hagen B: Ipilimumab for advanced melanoma: a pharmacologic perspective. J Oncol Pharm Pract. 2013 Sep;19(3):195-201. doi: 10.1177/1078155212459100. Epub 2012 Oct 9. [PubMed:23047236]
  4. Fellner C: Ipilimumab (yervoy) prolongs survival in advanced melanoma: serious side effects and a hefty price tag may limit its use. P T. 2012 Sep;37(9):503-30. [PubMed:23066344]
  5. FDA Approved Drug Products: Yervoy Ipilimumab Intravenous Injection [Link]
  6. BC Cancer Agency: Yervoy Monograph [Link]
External Links
KEGG Drug
D04603
PubChem Substance
347910341
RxNav
1094833
ChEMBL
CHEMBL1789844
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Ipilimumab
ATC Codes
L01XC11 — Ipilimumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (1.13 MB)
MSDS
Download (479 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Kidney Carcinoma / Metastatic Renal Cell Cancer / Renal Cancers / Stage IV Renal Cell Cancer AJCC V71
0Active Not RecruitingTreatmentLarynx / Lip, Oral Cavity and Pharynx1
0CompletedTreatmentMelanoma1
0CompletedTreatmentProstate Cancer1
0Not Yet RecruitingBasic ScienceMelanoma, Malignant1
0RecruitingTreatmentMetastatic Melanoma1
0RecruitingTreatmentSarcomas1
0TerminatedTreatmentCiliary Body and Choroid Melanoma, Medium/Large Size / Ciliary Body and Choroid Melanoma, Small Size / Extraocular Extension Melanoma / Hepatic Metastases / Iris Melanoma / Metastatic Intraocular Melanoma / Recurrent Intraocular Melanoma / Stage IV Intraocular Melanoma1
1Active Not RecruitingTreatmentALK Gene Rearrangement / EGFR Gene Mutations / Locally Advanced Lung Non-Small Cell Carcinoma / Lung Non-Small Cell Carcinoma / Stage II Lung Cancer AJCC v8 / Stage IIA Lung Cancer AJCC v8 / Stage IIB Lung Cancer AJCC v8 / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Unresectable Lung Non-Small Cell Carcinoma1
1Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemia Recurrent / Acute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplant Recipient / Chronic, recurrent Lymphocytic Leukemia / Myeloproliferative Neoplasms / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hematologic Malignancy / Recurrent Hodgkin Lymphoma / Recurrent Myelodysplastic Syndrome / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma1
1Active Not RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Chronic Lymphocytic Leukaemia (CLL) / Lymphoma, B Cell / Lymphoma, B-Cell1
1Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Stage IB2 Cervical Cancer AJCC v6 and v7 / Stage II Cervical Cancer AJCC v7 / Stage IIA Cervical Cancer AJCC v7 / Stage IIB Cervical Cancer AJCC v6 and v7 / Stage IIIB Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer AJCC v6 and v71
1Active Not RecruitingTreatmentAdvanced/Metastatic Solid Tumors or Lymphomas1
1Active Not RecruitingTreatmentBRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
1Active Not RecruitingTreatmentBreast Adenocarcinoma / Invasive Breast Carcinoma / Metastatic Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm1
1Active Not RecruitingTreatmentCancer of Head and Neck1
1Active Not RecruitingTreatmentCancer, Advanced1
1Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentGlioblastoma Multiforme (GBM) / Glioblastomas1
1Active Not RecruitingTreatmentGlioblastomas1
1Active Not RecruitingTreatmentGliosarcoma / Supratentorial Glioblastoma1
1Active Not RecruitingTreatmentHepatocellular,Carcinoma1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1Active Not RecruitingTreatmentMalignant Melanoma of Skin / Melanoma (Skin)1
1Active Not RecruitingTreatmentMelanoma3
1Active Not RecruitingTreatmentMelanoma, Uveal1
1Active Not RecruitingTreatmentMelanoma / Novel Coronavirus Infectious Disease (COVID-19)1
1Active Not RecruitingTreatmentMelanoma / Skin Cancers1
1Active Not RecruitingTreatmentMetastatic Malignant Neoplasm in the Liver / Metastatic Uveal Melanoma1
1Active Not RecruitingTreatmentMetastatic Melanoma1
1Active Not RecruitingTreatmentStage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v71
1Active Not RecruitingTreatmentStages III Skin Melanoma1
1CompletedBasic ScienceAdvanced Melanoma / Metastatic Melanoma1
1CompletedBasic ScienceMelanoma1
1CompletedTreatmentAcute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Chronic Myelomonocytic Leukemia / Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes1
1CompletedTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Childhood Myelodysplastic Syndromes / Chronic Lymphocytic Leukemia (CLL) - Refractory / Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Disseminated Neuroblastoma / Neoplasms, Malignant / Ovarian Choriocarcinoma / Ovarian Embryonal Carcinoma / Ovarian Immature Teratoma / Ovarian Mature Teratoma / Ovarian Mixed Germ Cell Tumor / Ovarian Monodermal and Highly Specialized Teratoma / Ovarian Polyembryoma / Ovarian Yolk Sac Tumor / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Mantle Cell Lymphoma / Recurrent Neuroblastoma / Recurrent Ovarian Epithelial Cancer / Recurrent Ovarian Germ Cell Tumor / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage II Ovarian Epithelial Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Multiple Myeloma / Stage III Ovarian Epithelial Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Stage IV Ovarian Epithelial Cancer / Testicular Choriocarcinoma / Testicular Choriocarcinoma and Embryonal Carcinoma / Testicular Choriocarcinoma and Seminoma / Testicular Choriocarcinoma and Teratoma / Testicular Choriocarcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma / Testicular Embryonal Carcinoma and Seminoma / Testicular Embryonal Carcinoma and Teratoma / Testicular Embryonal Carcinoma and Teratoma With Seminoma / Testicular Embryonal Carcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma and Yolk Sac Tumor With Seminoma / Testicular Teratoma / Testicular Yolk Sac Tumor / Testicular Yolk Sac Tumor and Teratoma / Testicular Yolk Sac Tumor and Teratoma With Seminoma1
1CompletedTreatmentAdvanced Cancers1
1CompletedTreatmentAdvanced Melanoma2
1CompletedTreatmentAdverse Effect of Radiation Therapy / Effects of Immunotherapy / Melanoma1
1CompletedTreatmentBreast Cancer / Head and Neck Carcinoma / Malignancies / Malignant Lymphomas / Melanoma / Triple Negative Breast Cancer (TNBC) / Triple-Negative Breast Cancer (TNBC)1
1CompletedTreatmentBreast Cancer / Invasive Adenocarcinoma of the Breast1
1CompletedTreatmentCD20 Positive / Recurrent B-Cell Non-Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma1
1CompletedTreatmentCancer,NOS1
1CompletedTreatmentCastrate Resistant Prostate Cancer (CRPC) / Prostate Cancer1
1CompletedTreatmentClear Cell Renal Cell Carcinoma / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Colon / Malignant Neoplasm of Pancreas / Melanoma / Mesothelioma / Ovarian Cancer / Prostate Cancer / Soft Tissue Sarcoma (STS) / Thyroid Cancers / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1CompletedTreatmentDuct Cell Adenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
1CompletedTreatmentGastrointestinal Stromal Tumors / Stage III Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma1
1CompletedTreatmentHepatic Metastases / Melanoma, Uveal1
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
1CompletedTreatmentIntraocular Melanoma / Malignant Melanoma of Skin / Melanoma (Skin)1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Cancer (SCLC) / Tumors, Solid1
1CompletedTreatmentMalignant Lymphomas1
1CompletedTreatmentMalignant Lymphomas / Neuroblastomas / Sarcomas / Wilms' tumor1
1CompletedTreatmentMalignant Neoplasm of Pancreas1
1CompletedTreatmentMelanoma6
1CompletedTreatmentMelanoma, Malignant3
1CompletedTreatmentMetastatic Melanoma1
1CompletedTreatmentProstate Cancer1
1CompletedTreatmentProstatic Neoplasms1
1CompletedTreatmentRecurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain1
1CompletedTreatmentRecurrent Prostate Carcinoma / Stage IV Prostate Cancer / Stage IV Prostate Cancer AJCC v71
1CompletedTreatmentSolid Cancers1
1CompletedTreatmentTransitional Cell Carcinoma1
1CompletedTreatmentTumors, Solid1
1CompletedTreatmentUnresectable Melanoma1
1Not Yet RecruitingTreatmentAggressive Variant Prostate Carcinoma / Castration-Resistant Prostate Carcinoma / Metastatic Clear Cell Renal Cell Carcinoma / Metastatic Hormone Refractory Prostate Cancer / Metastatic Malignant Solid Neoplasm / Stage IV Prostate Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Stage IVA Prostate Cancer AJCC v8 / Stage IVB Prostate Cancer AJCC v8 / Urothelial carcinoma ureter metastatic1
1Not Yet RecruitingTreatmentCancer, Advanced1
1Not Yet RecruitingTreatmentFibrolamellar Hepatocellular Carcinoma (FLC)1
1Not Yet RecruitingTreatmentGlioblastomas / Gliomas, Malignant / Grade III Glioma / Recurrent Glioblastoma / Recurrent Grade III Glioma / Recurrent Malignant Gliomas1
1Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1Not Yet RecruitingTreatmentMelanoma1
1Not Yet RecruitingTreatmentMetastatic Adenocarcinoma1
1Not Yet RecruitingTreatmentNon-Small Cell Lung Cancer With Mutation in Epidermal Growth Factor Receptor (Disorder)1
1Not Yet RecruitingTreatmentRecurrent Head and Neck Squamous Cell Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1Not Yet RecruitingTreatmentRenal Cell Adenocarcinoma / Stage IV Renal Cell Carcinoma1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingTreatmentAcute Myeloid Leukemia and Myelodysplastic Syndrome1
1RecruitingTreatmentAdenocarcinoma of the Pancreas / Colon Carcinoma Metastatic in the Liver / Colorectal Adenocarcinoma / Resectable Pancreatic Carcinoma / Stage I Pancreatic Cancer / Stage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage II Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
1RecruitingTreatmentAdvanced Cancers / Advanced Malignant Solid Neoplasm / C-KIT Tyrosine Kinase Protein Overexpression / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Metastatic Gastrointestinal Stromal Tumor / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Unresectable Melanoma / Unresectable Solid Neoplasm1
1RecruitingTreatmentAdvanced Cancers / Melanoma1
1RecruitingTreatmentAdvanced Clear Cell Renal Cell Carcinoma / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Kidney Small Cell Carcinoma / Metastatic Bladder Small Cell Carcinoma / Metastatic Bladder Squamous Cell Carcinoma / Metastatic Bladder Urothelial Carcinoma / Metastatic Kidney Medullary Carcinoma / Metastatic Malignant Genitourinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Renal Cell Carcinoma / Metastatic Renal Pelvis Urothelial Carcinoma / Metastatic Sarcomatoid Renal Cell Carcinoma / Metastatic Ureter Urothelial Carcinoma / Metastatic Urethral Urothelial Carcinoma / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma AJCC v6 and v7 / Stage III Bladder Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Penile Cancer AJCC v7 / Stage III Renal Cell Cancer AJCC v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer AJCC v7 / Stage IIIa Penile Cancer AJCC v7 / Stage IIIb Penile Cancer AJCC v7 / Stage IV Bladder Adenocarcinoma AJCC v7 / Stage IV Bladder Squamous Cell Carcinoma AJCC v7 / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Penile Cancer AJCC v7 / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer AJCC v71
1RecruitingTreatmentAdvanced Colon Adenocarcinoma / Metastatic Colon Adenocarcinoma / Metastatic Colorectal Adenocarcinoma / Metastatic Colorectal Carcinoma / Metastatic Rectal Adenocarcinoma / Stage III Colon Cancer AJCC v8 / Stage III Rectal Cancer AJCC v8 / Stage IIIA Colon Cancer AJCC v8 / Stage IIIA Rectal Cancer AJCC v8 / Stage IIIB Colon Cancer AJCC v8 / Stage IIIB Rectal Cancer AJCC v8 / Stage IIIC Colon Cancer AJCC v8 / Stage IIIC Rectal Cancer AJCC v8 / Stage IV Colon Cancer AJCC v8 / Stage IV Colorectal Cancer AJCC v8 / Stage IV Rectal Cancer AJCC v8 / Stage IVA Colon Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVA Rectal Cancer AJCC v8 / Stage IVB Colon Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVB Rectal Cancer AJCC v8 / Stage IVC Colon Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v8 / Stage IVC Rectal Cancer AJCC v81
1RecruitingTreatmentAdvanced Malignancies1
1RecruitingTreatmentAdvanced Renal Cell Carcinoma / Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma / Stage III Renal Cell Cancer AJCC v8 / Stage III Renal Cell Cancer American Joint Committee on Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer American Joint Committee on Cancer AJCC v8 / Unresectable Renal Cell Carcinoma1
1RecruitingTreatmentAdvanced Solid Cancers1
1RecruitingTreatmentAdvanced Tumor / Metastatic Tumors1
1RecruitingTreatmentAgnogenic Myeloid Metaplasia / Chronic Myelomonocytic Leukemia / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes / Myeloproliferative Neoplasms1
1RecruitingTreatmentAcute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / Myelodysplastic Syndrome / Refractory Acute Myelogenous Leukemia (AML)1
1RecruitingTreatmentAnatomic Stage 0 Breast Cancer AJCC v8 / Anatomic Stage I Breast Cancer AJCC v8 / Anatomic Stage IA Breast Cancer AJCC v8 / Anatomic Stage IB Breast Cancer AJCC v8 / Anatomic Stage II Breast Cancer AJCC v8 / Anatomic Stage IIA Breast Cancer AJCC v8 / Anatomic Stage IIB Breast Cancer AJCC v8 / Anatomic Stage IIIA Breast Cancer AJCC v8 / Anatomic Stage IIIB Breast Cancer AJCC v8 / HER2/Neu Negative / Invasive Ductal Carcinoma, Not Otherwise Specified / Progesterone Receptor Negative / Prognostic Stage 0 Breast Cancer AJCC v8 / Prognostic Stage I Breast Cancer AJCC v8 / Prognostic Stage IA Breast Cancer AJCC v8 / Prognostic Stage IB Breast Cancer AJCC v8 / Prognostic Stage II Breast Cancer AJCC v8 / Prognostic Stage IIA Breast Cancer AJCC v8 / Prognostic Stage IIB Breast Cancer AJCC v8 / Prognostic Stage IIIA Breast Cancer AJCC v8 / Prognostic Stage IIIB Breast Cancer AJCC v8 / Triple-Negative Breast Carcinoma1
1RecruitingTreatmentBreast Cancer1
1RecruitingTreatmentBreast Cancer / Leukemia Acute Myeloid Leukemia (AML) / Malignant Neoplasm of Pancreas / Prostate Cancer1
1RecruitingTreatmentCancer, Advanced2
1RecruitingTreatmentCancer, Bladder / Cholangiocarcinomas / Malignant Neoplasm of Colon / Malignant Neoplasm of Stomach / Melanoma / Ovarian Cancer / Palpable Subcutaneous Malignant Lesions / Renal Cell Adenocarcinoma / Tumors, Solid1
1RecruitingTreatmentClinical Stage III Cutaneous Melanoma AJCC v8 / Clinical Stage III Merkel Cell Carcinoma AJCC v8 / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Clinical Stage IV Merkel Cell Carcinoma AJCC v8 / High-Frequency Microsatellite Instability / Metastatic Basal cell carcinoma / Metastatic Melanoma / Metastatic Merkel Cell Carcinoma / Metastatic Skin Squamous Cell Carcinoma / Pathologic Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage III Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIA Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIA Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIB Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v8 / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Pathologic Stage IV Merkel Cell Carcinoma AJCC v8 / Unresectable Basal Cell Carcinoma / Unresectable Melanoma / Unresectable Merkel Cell Carcinoma1
1RecruitingTreatmentColorectal Cancers / Malignant Neoplasm of Pancreas1
1RecruitingTreatmentColorectal neoplasms malignant / Hepatic Metastases1
1RecruitingTreatmentFallopian Tubes / High Grade Serous Ovarian / Primary Peritoneal Cancer1
1RecruitingTreatmentGlioblastomas1
1RecruitingTreatmentGliomas, Malignant1
1RecruitingTreatmentMalignant Neoplasm of Pancreas / Melanoma / Prostate Cancer / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingTreatmentMalignant Neoplasm of Stomach1
1RecruitingTreatmentMalignant Peritoneal Neoplasm / Malignant Retroperitoneal Neoplasm / Peritoneal Carcinomatosis / Platinum-Resistant Fallopian Tube Carcinoma / Platinum-Resistant Ovarian Carcinoma / Platinum-Resistant Primary Peritoneal Carcinoma / Recurrent Cervical Carcinoma / Recurrent Endometrial Carcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Stage IV Cervical Cancer AJCC v8 / Stage IV Fallopian Tube Cancer AJCC v8 / Stage IV Ovarian Cancer AJCC v8 / Stage IV Primary Peritoneal Cancer AJCC v8 / Stage IVA Cervical Cancer AJCC v8 / Stage IVA Fallopian Tube Cancer AJCC v8 / Stage IVA Ovarian Cancer AJCC v8 / Stage IVA Primary Peritoneal Cancer AJCC v8 / Stage IVB Cervical Cancer AJCC v8 / Stage IVB Fallopian Tube Cancer AJCC v8 / Stage IVB Ovarian Cancer AJCC v8 / Stage IVB Primary Peritoneal Cancer AJCC v81
1RecruitingTreatmentMelanoma1
1RecruitingTreatmentMetastases to soft tissue / Tumors, Solid1
1RecruitingTreatmentMetastatic Hormone-sensitive Prostate Cancer1
1RecruitingTreatmentMetastatic Melanoma1
1RecruitingTreatmentMetastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
1RecruitingTreatmentMetastatic Solid Tumors / Treatment-Refractory Cancers1
1RecruitingTreatmentNeoplasms, Malignant1
1RecruitingTreatmentNeuroblastomas / Pediatric Solid Tumors1
1RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Pathologic Stage IIIA Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIB Merkel Cell Carcinoma AJCC v81
1RecruitingTreatmentNewly Diagnosed Glioblastoma / Newly Diagnosed High Grade Glioma1
1RecruitingTreatmentPathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v81
1RecruitingTreatmentAcute, recurrent Myeloid Leukemia / Recurrent Acute Myeloid Leukemia With Myelodysplasia-Related Changes / Recurrent Myelodysplastic Syndrome / Refractory Acute Myelogenous Leukemia (AML) / Refractory Myelodysplastic Syndrome / Secondary Acute Myeloid Leukemia (Secondary AML, sAML)1
1RecruitingTreatmentRecurrent B Acute Lymphoblastic Leukemia / Recurrent Mixed Phenotype Acute Leukemia / Refractory B Acute Lymphoblastic Leukemia / Refractory Mixed Phenotype Acute Leukemia1
1RecruitingTreatmentRecurrent Glioblastoma / Refractory Glioblastoma1
1RecruitingTreatmentRenal Cancers1
1RecruitingTreatmentSolid Tumor, Adult1
1RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)2
1RecruitingTreatmentStage III Prostate Cancer / Stage IIIA Prostate Cancer / Stage IIIB Prostate Cancer / Stage IIIC Prostate Cancer / Stage IV Prostate Cancer / Stage IVA Prostate Cancer / Stage IVB Prostate Cancer1
1RecruitingTreatmentStage IV Small Cell Lung Cancer1
1RecruitingTreatmentTransitional Cell Carcinoma1
1RecruitingTreatmentTumors, Solid1
1SuspendedTreatmentAdvanced Malignant Solid Neoplasm / Cancer, Anal / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Recurrent Classic Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Unresectable Solid Neoplasm1
1TerminatedOtherMelanoma1
1TerminatedTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Non-Small Cell Lung Cancer Recurrent / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Recurrent Melanoma / Recurrent Ovarian Epithelial Cancer / Stage IV Melanoma / Stage IV Non-Small Cell Lung Cancer1
1TerminatedTreatmentMelanoma3
1TerminatedTreatmentMelanoma, Malignant1
1TerminatedTreatmentMetastatic Melanoma1
1TerminatedTreatmentNewly Diagnosed Melanoma Metastases in the Brain and Spine1
1TerminatedTreatmentProstate Cancer1
1TerminatedTreatmentStage III or IV Melanoma1
1TerminatedTreatmentUnresectable or Metastatic Melanoma1
1WithdrawnTreatmentChronic Myeloid Leukemia (CML)1
1WithdrawnTreatmentMalignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)1
1WithdrawnTreatmentMelanoma1
1WithdrawnTreatmentMelanoma / Sarcomas1
1WithdrawnTreatmentMetastatic Colorectal Cancer (MCRC)1
1, 2Active Not RecruitingTreatmentAdvanced Solid Tumors1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1, 2Active Not RecruitingTreatmentAdvanced or Metastatic Solid Tumors / Tumors, Solid1
1, 2Active Not RecruitingTreatmentCancer, Advanced1
1, 2Active Not RecruitingTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
1, 2Active Not RecruitingTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Metastatic Breast Cancer / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma1
1, 2Active Not RecruitingTreatmentExtensive-Stage Small Cell Lung Cancer / Small Cell Lung Cancer (SCLC)1
1, 2Active Not RecruitingTreatmentHepatocellular,Carcinoma1
1, 2Active Not RecruitingTreatmentLiver Cancer / Lung Cancers1
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Active Not RecruitingTreatmentLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1, 2Active Not RecruitingTreatmentMSS / RAS-mutant Colorectal Cancer1
1, 2Active Not RecruitingTreatmentMalignancies3
1, 2Active Not RecruitingTreatmentMalignancies / Neoplasms / Tumors1
1, 2Active Not RecruitingTreatmentMalignant Lymphomas / Tumors, Solid1
1, 2Active Not RecruitingTreatmentMelanoma1
1, 2Active Not RecruitingTreatmentMelanoma, Malignant1
1, 2Active Not RecruitingTreatmentMelanoma / Renal Cell Adenocarcinoma1
1, 2Active Not RecruitingTreatmentMetastatic Melanoma1
1, 2Active Not RecruitingTreatmentMetastatic Melanoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Refractory Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Melanoma / Refractory Neuroblastoma / Refractory Non-Hodgkin's lymphoma / Refractory Osteosarcoma / Refractory Rhabdomyosarcoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Melanoma1
1, 2Active Not RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic1
1, 2Active Not RecruitingTreatmentOvarian Cancer Metastatic1
1, 2Active Not RecruitingTreatmentProstate Cancer1
1, 2Active Not RecruitingTreatmentVarious Advanced Cancer1
1, 2CompletedPreventionStage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2CompletedTreatmentAdvanced Malignancies / Advanced or Metastatic Malignancies1
1, 2CompletedTreatmentCancer,NOS1
1, 2CompletedTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma1
1, 2CompletedTreatmentIntraocular Melanoma / Malignant Melanoma of Skin / Melanoma (Skin)1
1, 2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2CompletedTreatmentMelanoma1
1, 2CompletedTreatmentMelanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma1
1, 2CompletedTreatmentMetastatic Melanoma2
1, 2CompletedTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2CompletedTreatmentNeoplasms Metastasis / Prostate Cancer1
1, 2CompletedTreatmentRecurrent Melanoma / Stage IV Melanoma1
1, 2CompletedTreatmentSmall Cell Lung Cancer (SCLC)1
1, 2CompletedTreatmentUnresectable Stage III or IV Malignant Melanoma1
1, 2Not Yet RecruitingTreatmentCarcinoma, Non-small Cell Lung Cancer1
1, 2Not Yet RecruitingTreatmentColon Cancer With MSI-H or dMMR / Metastatic Melanoma / Renal Cell Adenocarcinoma1
1, 2RecruitingOtherMalignant Melanoma of Skin / Melanoma (Skin)1
1, 2RecruitingTreatmentAdenocarcinoma of the Pancreas1
1, 2RecruitingTreatmentAdvanced Malignancies / Metastatic Cancers / Metastatic Malignancy1
1, 2RecruitingTreatmentAdvanced Malignant Solid Neoplasm / Metastatic Carcinoma in the Liver / Metastatic Carcinoma in the Lung / Metastatic Malignant Neoplasm in the Thoracic Cavity / Metastatic Malignant Solid Neoplasm1
1, 2RecruitingTreatmentAdvanced Malignant Solid Neoplasm / Metastatic Malignant Solid Neoplasm / Unresectable Malignant Solid Neoplasm1
1, 2RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
1, 2RecruitingTreatmentAdvanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma1
1, 2RecruitingTreatmentCancer, Advanced3
1, 2RecruitingTreatmentCancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
1, 2RecruitingTreatmentClinical Stage 0 Gastric Cancer AJCC v8 / Clinical Stage 0 Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage I Gastric Cancer AJCC v8 / Clinical Stage I Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastric Cancer AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IVA Gastric Cancer AJCC v8 / Clinical Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Gastric Adenocarcinoma / Localized Gastric Carcinoma / Localized Gastroesophageal Junction Adenocarcinoma / Pathologic Stage 0 Gastric Cancer AJCC v8 / Pathologic Stage 0 Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage I Gastric Cancer AJCC v8 / Pathologic Stage IA Gastric Cancer AJCC v8 / Pathologic Stage IA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IB Gastric Cancer AJCC v8 / Pathologic Stage IB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastric Cancer AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastric Cancer AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Gastric Cancer AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v81
1, 2RecruitingTreatmentColorectal Cancers / Gastroesophageal Adenocarcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Transitional Cell Carcinoma / Tumors, Solid1
1, 2RecruitingTreatmentColorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Shared Neoantigen-Positive Solid Tumors / Tumors, Solid1
1, 2RecruitingTreatmentGrade II Meningioma / Grade III Meningioma / Recurrent Meningiomas1
1, 2RecruitingTreatmentHepatic Metastases / Melanoma, Uveal1
1, 2RecruitingTreatmentHepatocellular,Carcinoma1
1, 2RecruitingTreatmentImmunotherapy / Neoplasms, Head and Neck1
1, 2RecruitingTreatmentInvasive Bladder Cancer / Urinary Bladder Cancer1
1, 2RecruitingTreatmentLarynx / LIP / Oral Cavity Cancer / Pharynx Cancer1
1, 2RecruitingTreatmentLocally Advanced Pancreatic Cancer (LAPC)1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic1
1, 2RecruitingTreatmentLung Cancers / Small Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentMalignancies1
1, 2RecruitingTreatmentMalignant Lymphomas / Multiple Myeloma (MM)1
1, 2RecruitingTreatmentMalignant Melanoma Stage III1
1, 2RecruitingTreatmentMelanoma2
1, 2RecruitingTreatmentMelanoma / Melanoma Stage Iii / Melanoma Stage Iv1
1, 2RecruitingTreatmentMelanoma / Renal Cell Adenocarcinoma / Tumors, Solid1
1, 2RecruitingTreatmentMesothelioma1
1, 2RecruitingTreatmentMetastatic Malignant Neoplasm in the Brain / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Tumors Metastatic to Brain1
1, 2RecruitingTreatmentMetastatic Melanoma1
1, 2RecruitingTreatmentPancreatic Adenocarcinoma Metastatic / Recurrent Pancreatic Adenocarcinoma / Stage II Pancreatic Cancer AJCC v8 / Stage IIA Pancreatic Cancer AJCC v8 / Stage IIB Pancreatic Cancer AJCC v8 / Stage III Pancreatic Cancer AJCC v8 / Stage IV Pancreatic Cancer AJCC v8 / Unresectable Pancreatic Carcinoma1
1, 2RecruitingTreatmentRecurrent Classic Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma1
1, 2RecruitingTreatmentRefractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma1
1, 2RecruitingTreatmentStage III/IV Melanoma1
1, 2RecruitingTreatmentTumors1
1, 2RecruitingTreatmentUveal Melanoma, Metastatic1
1, 2SuspendedTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Anaplastic Large-Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Colon Cancer / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Melanoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Rectal Cancer / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentAdult Grade III Lymphomatoid Granulomatosis / B-Cell Chronic Lymphocytic Leukemia / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentMelanoma3
1, 2TerminatedTreatmentMelanoma / Metastatic Melanoma1
1, 2TerminatedTreatmentMetastatic Cancers1
1, 2TerminatedTreatmentUnresectable Stage III or Stage IV Melanoma1
1, 2WithdrawnTreatmentAdvanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage III Uveal Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm1
1, 2WithdrawnTreatmentHepatic Metastases / Lung Cancer Metastatic / Metastatic Melanoma / Tumors Metastatic to Brain1
1, 2WithdrawnTreatmentMelanoma2
1, 2WithdrawnTreatmentMetastatic Melanoma1
2Active Not RecruitingTreatmentAcral lentiginous melanoma / Mucosal Melanoma1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Human Papillomavirus Infections / Recurrent Cervical Carcinoma / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer AJCC v6 and v71
2Active Not RecruitingTreatmentAdenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer1
2Active Not RecruitingTreatmentAdenocarcinoma of the Stomach / Gastroesophageal Cancer (GC)1
2Active Not RecruitingTreatmentAdvanced Melanoma / Metastatic Melanoma / Metastatic Melanoma Stratified by MHC-II Expression1
2Active Not RecruitingTreatmentAdvanced Melanoma / Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Melanoma1
2Active Not RecruitingTreatmentAdvanced Non-Small Cell Lung Carcinoma / Metastatic Non-Small Cell Lung Carcinoma1
2Active Not RecruitingTreatmentAdvanced Solid Tumors1
2Active Not RecruitingTreatmentBiliary Tract Neoplasms1
2Active Not RecruitingTreatmentBreast Cancer / Triple Negative Breast Neoplasms1
2Active Not RecruitingTreatmentCancer, Advanced1
2Active Not RecruitingTreatmentCancer, Bladder / Melanoma1
2Active Not RecruitingTreatmentCastration Levels of Testosterone / Castration-Resistant Prostate Carcinoma / Metastatic Hormone Refractory Prostate Cancer / Prostate Cancer / PSA Progression / Stage IV Prostate Adenocarcinoma AJCC v71
2Active Not RecruitingTreatmentChromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma1
2Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma1
2Active Not RecruitingTreatmentClinical Stage IV Cutaneous Melanoma / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Metastatic Malignant Neoplasm in the Brain / Metastatic Melanoma / Pathologic Stage IV Cutaneous Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v81
2Active Not RecruitingTreatmentGastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours1
2Active Not RecruitingTreatmentGastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Locally Advanced Bone Sarcoma / Locally Advanced Soft Tissue Sarcoma / Metastatic Bone Sarcomas / Metastatic Liposarcoma / Metastatic Soft Tissue Sarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Metastatic Unresectable Sarcoma / Pleomorphic liposarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Bone Sarcoma / Unresectable Liposarcoma / Unresectable Soft Tissue Sarcoma1
2Active Not RecruitingTreatmentHead and Neck Carcinoma2
2Active Not RecruitingTreatmentHepatic Metastases / Lung Cancer Metastatic / Recurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentLeptomeningeal Carcinomatosis / Melanoma1
2Active Not RecruitingTreatmentLimited Stage Small Cell Lung Cancer / Small Cell Lung Cancer (SCLC)1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2Active Not RecruitingTreatmentMicrosatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer1
2Active Not RecruitingTreatmentMajor Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma1
2Active Not RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2Active Not RecruitingTreatmentMelanoma5
2Active Not RecruitingTreatmentMelanoma, Malignant1
2Active Not RecruitingTreatmentMelanoma, Uveal1
2Active Not RecruitingTreatmentMelanoma / Melanoma Stage Iii1
2Active Not RecruitingTreatmentMelanoma / Melanoma, Uveal / Metastatic Uveal Melanoma / Stage IV Uveal Melanoma AJCC v71
2Active Not RecruitingTreatmentMelanoma / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentMesothelioma1
2Active Not RecruitingTreatmentMetastatic Cancer Colorectal1
2Active Not RecruitingTreatmentMetastatic Castration Sensitive Prostate Cancer1
2Active Not RecruitingTreatmentMetastatic Leiomyosarcoma / Unresectable Leiomyosarcoma / Uterine Corpus Leiomyosarcoma1
2Active Not RecruitingTreatmentMetastatic Lung Non-Squamous Non-Small Cell Carcinoma / Recurrent Lung Non-Squamous Non-Small Cell Carcinoma / Stage IV Lung Non-Small Cell Cancer AJCC v71
2Active Not RecruitingTreatmentMetastatic Melanoma2
2Active Not RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentMetastatic Melanoma / Unresectable Melanoma1
2Active Not RecruitingTreatmentProstate Cancer1
2Active Not RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentRecurrent Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
2Active Not RecruitingTreatmentRenal Cancers1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma2
2Active Not RecruitingTreatmentStage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Melanoma1
2Active Not RecruitingTreatmentTumors, Solid / Unresectable or Metastatic Melanoma1
2Active Not RecruitingTreatmentUntreated Stage III Melanoma or Stage IV Melanoma1
2Active Not RecruitingTreatmentVarious Advanced Cancer1
2CompletedTreatmentAdenocarcinomas / Breast Cancer1
2CompletedTreatmentAdvanced or Metastatic Melanoma1
2CompletedTreatmentBrain Metastasis / Melanoma1
2CompletedTreatmentExtensive Stage Small Cell Lung Cancer1
2CompletedTreatmentIn-transit Metastases Melanoma Stage IIIB and IIIC1
2CompletedTreatmentIntraocular Melanoma / Malignant Melanoma of Skin / Melanoma (Skin)2
2CompletedTreatmentLocally Advanced (Unresectable) or Metastatic Adenocarcinoma of the Gastric and Gastro-esophageal Junction1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Small Cell Lung Cancer (SCLC)1
2CompletedTreatmentLung Cancers1
2CompletedTreatmentMalignant Melanoma Stage III / Malignant Melanoma Stage IV1
2CompletedTreatmentMalignant Melanoma of Skin / Melanoma (Skin)1
2CompletedTreatmentMalignant Melanoma, Metastatic1
2CompletedTreatmentMalignant Neoplasm of Pancreas1
2CompletedTreatmentMelanoma11
2CompletedTreatmentMelanoma Stage Iii / Melanoma Stage Iv1
2CompletedTreatmentMelanoma, Malignant3
2CompletedTreatmentMelanoma / Tumors Metastatic to Brain1
2CompletedTreatmentMetastatic Malignant Melanoma1
2CompletedTreatmentMetastatic Melanoma2
2CompletedTreatmentMetastatic Melanoma / Mucosal Melanoma / Recurrent Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Unresectable Melanoma1
2CompletedTreatmentOcular Melanoma1
2CompletedTreatmentOvarian Cancer / Platinum-sensitive Ovarian Cancer, Second-line, Third-line, or Fourth-line1
2CompletedTreatmentPancreatic Adenocarcinoma Metastatic1
2CompletedTreatmentProstate Cancer3
2CompletedTreatmentProstatic Neoplasms1
2CompletedTreatmentRecurrent Melanoma / Stage IIIA Melanoma / Stage IIIB Melanoma / Stage IIIc Melanoma / Stage IV Melanoma1
2CompletedTreatmentRenal Cancers1
2CompletedTreatmentTransitional Cell Carcinoma1
2Enrolling by InvitationTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Cancer (SCLC)1
2Not Yet RecruitingTreatmentAdvanced Renal Cell Carcinoma1
2Not Yet RecruitingTreatmentBrain Metastases, Adult1
2Not Yet RecruitingTreatmentCancer of Unknown Primary Site1
2Not Yet RecruitingTreatmentCarcinosarcoma of Ovary / Carcinosarcoma of Uterus / Carcinosarcoma of Vagina1
2Not Yet RecruitingTreatmentChondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentChromophobe Renal Cell Carcinoma / Collecting Duct Renal Cell Carcinoma / Medullary Renal Cell Carcinoma / Metastatic Ncc Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Renal Cell Adenocarcinoma / Translocation Renal Cell Carcinoma / Unclassified Renal Cell Carcinoma / Unresectable advanced renal cell carcinoma1
2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2Not Yet RecruitingTreatmentHepatocellular Carcinoma (HCC)1
2Not Yet RecruitingTreatmentInoperable œsophageal Cancer1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
2Not Yet RecruitingTreatmentLung Cancers / Lung neoplasm malignant / Malignancies / Mesothelioma / Mesothelioma; Lung / Mesothelioma; Pleura / Mesotheliomas Pleural1
2Not Yet RecruitingTreatmentMalignancies / Neoplasms / Tumors1
2Not Yet RecruitingTreatmentMalignant Neoplasm of Pancreas / Pancreatic Cancer Metastatic1
2Not Yet RecruitingTreatmentMelanoma1
2Not Yet RecruitingTreatmentRecurrent Glioblastoma / Secondary Glioblastoma1
2Not Yet RecruitingTreatmentVarious Advanced Cancer1
2RecruitingDiagnosticMelanoma1
2RecruitingTreatmentAcinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Apocrine Neoplasm / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Basal Cell Carcinoma (BCC) / Bladder Adenocarcinoma / Carcinoma of Gallbladder / Carcinoma, Adenoid Cystic / Cervical Clear Cell Adenocarcinoma / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Desmoid-Type Fibromatosis / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Extramammary Paget Disease / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Gastric Undifferentiated Carcinoma / Gastrointestinal Stromal Tumors / Gestational Trophoblastic Disease / Giant Cell Carcinoma / Hemangiosarcoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Testicular Sex Cord-Stromal Tumor / Metaplastic breast carcinoma / Metastatic Malignant Neoplasm of Unknown Primary / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / PEComa / Peritoneal Mesotheliomas / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Rare Disorder / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Solid Neoplasms / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Somatic-type Malignancy / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Carcinoma1
2RecruitingTreatmentAcute Bilineal Leukemia / Acute Biphenotypic Leukemia (ABL) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute, recurrent Myeloid Leukemia / Chronic Myelomonocytic Leukemia / Leukemias / Myelodysplastic Syndrome / Refractory Acute Myelogenous Leukemia (AML) / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Therapy-Related Acute Myeloid Leukemia1
2RecruitingTreatmentAdenocarcinoma of the Stomach / Esophageal Cancers / Gastroesophageal Cancer (GC) / HER2 Positive Gastric Cancer / Malignant Neoplasm of Stomach / Metastatic Gastric Cancers1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2RecruitingTreatmentAdrenocortical Carcinoma / Genitourinary Cancers / High Grade Neuroendocrine Carcinoma/Small Cell Carcinoma / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell1
2RecruitingTreatmentAdvanced Gastric Cancer1
2RecruitingTreatmentAdvanced Melanoma / Melanoma of Unknown Primary / Mucosal Melanoma / Refractory Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma / Unresectable Melanoma1
2RecruitingTreatmentAdvanced Metastatic Cancer1
2RecruitingTreatmentAdvanced Renal Cell Carcinoma1
2RecruitingTreatmentAdvanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)2
2RecruitingTreatmentAnal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Stage IV Anal Canal Cancer AJCC v6 and v71
2RecruitingTreatmentAppendiceal Tumor / Colorectal Tumors / Mucinous Neoplasm1
2RecruitingTreatmentAtypical Teratoid/Rhabdoid Tumor / Chordoma (Poorly Differentiated or De-differentiated) / Epithelioid Sarcoma / Malignant Rhabdoid Tumors (MRT) / Other INI1 Negative Malignant Tumors (With PI Approval) / Rhabdoid Tumors of the Kidney (RTK)1
2RecruitingTreatmentB-Cell Non-Hodgkin Lymphomas(NHL) / Blood And Marrow Transplantation / Hematopoietic and Lymphoid Cell Neoplasm / Leukemias / Malignant Lymphomas / Plasma Cell Myeloma / T-Cell Non-Hodgkin Lymphoma1
2RecruitingTreatmentBasal Cell Carcinoma (BCC)1
2RecruitingTreatmentBladder Adenocarcinoma / Bladder Mixed Adenocarcinoma / Bladder Small Cell Carcinoma / Bladder Squamous Cell Carcinoma / Chromophobe Renal Cell Carcinoma / Infiltrating Bladder Lymphoepithelioma-Like Carcinoma / Infiltrating Bladder Urothelial Carcinoma / Infiltrating Bladder Urothelial Carcinoma With Giant Cells / Infiltrating Bladder Urothelial Carcinoma, Nested Variant / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Kidney Medullary Carcinoma / Large Cell Neuroendocrine Carcinoma / Metastatic Bladder carcinoma / Metastatic Bladder Large Cell Neuroendocrine Carcinoma / Metastatic Bladder Small Cell Carcinoma / Metastatic Bladder Squamous Cell Carcinoma / Metastatic Infiltrating Bladder Urothelial Carcinoma, Clear Cell Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Lipid-Rich Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Micropapillary Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Metastatic Kidney Medullary Carcinoma / Metastatic Malignant Genitourinary System Neoplasm / Metastatic Penile Carcinoma / Metastatic Prostate Small Cell Carcinoma / Metastatic Sarcomatoid Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Sarcomatoid Renal Cell Carcinoma / Stage IV Bladder Cancer AJCC v8 / Stage IV Penile Cancer AJCC v8 / Stage IV Prostate Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Stage IVA Bladder Cancer AJCC v8 / Stage IVA Prostate Cancer AJCC v8 / Stage IVB Bladder Cancer AJCC v8 / Stage IVB Prostate Cancer AJCC v8 / Testicular Leydig Cell Tumor / Testicular Sertoli Cell Tumor1
2RecruitingTreatmentBreast Cancer2
2RecruitingTreatmentBreast Cancer / Breast Neoplasm Female / Carcinoma, Breast / Tumors, Breast1
2RecruitingTreatmentBreast Cancer / Hormone Receptor Positive Tumor / Luminal B / Metastatic Breast Cancer1
2RecruitingTreatmentCancer, Advanced1
2RecruitingTreatmentCancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma1
2RecruitingTreatmentCancer, Bladder1
2RecruitingTreatmentCancer, Bladder / Head/Neck Cancers / Lung Cancers / Melanoma Cancers / Metastatic Cancers / Renal Cancers1
2RecruitingTreatmentCarcinoid Tumors / Neuroendocrine Tumors1
2RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck1
2RecruitingTreatmentClassic Kaposi Sarcoma1
2RecruitingTreatmentClear Cell Adenocarcinoma / Extra Renal Origin / Fallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Carcinoma1
2RecruitingTreatmentClear Cell Metastatic Renal Cell Carcinoma1
2RecruitingTreatmentClinical Stage I HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Clinical Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Human Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Oropharyngeal Basaloid Carcinoma / Pathologic Stage I HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Pathologic Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Posterior Tongue Squamous Cell Carcinoma / Soft Palate Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Tonsillar Squamous Cell Carcinoma1
2RecruitingTreatmentColon Carcinoma1
2RecruitingTreatmentCutaneous Melanoma, Stage III / Cutaneous Melanoma, Stage IV / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Unresectable Melanoma1
2RecruitingTreatmentCutaneous Melanoma / Melanoma / Mucosal Melanoma / Ocular Melanoma / Oligometastatic Melanoma / Stage III Acral Lentiginous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Uveal Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Uveal Melanoma AJCC v7 / Stage IV Acral Lentiginous Melanoma AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma AJCC v71
2RecruitingTreatmentDifferentiated Thyroid Gland Carcinoma / Follicular Variant Thyroid Gland Papillary Carcinoma / Poorly Differentiated Thyroid Gland Carcinoma / Refractory Differentiated Thyroid Gland Carcinoma / Refractory Thyroid Gland Carcinoma / Tall Cell Variant Thyroid Gland Papillary Carcinoma / Thyroid Gland Follicular Carcinoma / Thyroid Gland Hurthle Cell Carcinoma / Thyroid Gland Papillary Carcinoma1
2RecruitingTreatmentEsophageal Cancers / Gastroesophageal Cancer (GC) / Malignant Neoplasm of Esophagus / Metastatic Esophageal Cancer / Metastatic Oesophageal Cancer / Oesophageal Cancer Nos1
2RecruitingTreatmentEye and Orbit1
2RecruitingTreatmentGBM / MGMT-unmethylated Glioblastoma (GBM)1
2RecruitingTreatmentGastric and Esophagogastric Junction Adenocarcinoma1
2RecruitingTreatmentGastrointestinal Stromal Tumors1
2RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
2RecruitingTreatmentHepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs / Resectable Hepatocellular Carcinoma1
2RecruitingTreatmentKidney Cancer Metastatic / Kidney Cancer Stage Iv / Kidney Cancer, Stage IV / Renal Cancers1
2RecruitingTreatmentKidney Medullary Carcinoma / Loss of INI 1 Protein Expression / Stage III Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v81
2RecruitingTreatmentLeukemias / Myelodysplastic Syndrome / Recurrent Myelodysplastic Syndrome1
2RecruitingTreatmentLiposarcomas, Dedifferentiated / Recurrent Dedifferentiated Liposarcoma / Recurrent Undifferentiated Pleomorphic Sarcoma / Resectable Dedifferentiated Liposarcoma / Resectable Undifferentiated Pleomorphic Sarcoma / Systemic Connective Tissue Disorders / Undifferentiated Pleomorphic Sarcoma1
2RecruitingTreatmentLocalized Oesogastric Adenocarcimona / MSI and or dMMR1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)5
2RecruitingTreatmentLung Cancers / Relapsed Small cell lung cancer / Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentMalignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer1
2RecruitingTreatmentMalignancies1
2RecruitingTreatmentMalignant Melanoma Stage III1
2RecruitingTreatmentMalignant Neoplasm of Colon1
2RecruitingTreatmentMalignant Neoplasm of Pancreas2
2RecruitingTreatmentMelanoma5
2RecruitingTreatmentMelanoma Stage Iv1
2RecruitingTreatmentMelanoma With Brain Metastasis1
2RecruitingTreatmentMelanoma, Malignant2
2RecruitingTreatmentMelanoma, Uveal1
2RecruitingTreatmentMelanoma / Ocular Melanoma1
2RecruitingTreatmentMeningiomas1
2RecruitingTreatmentMetastatic Biliary Tract Cancer / Pancreatic Cancer Metastatic1
2RecruitingTreatmentMetastatic Cancers / Metastatic Castration Resistant Prostate Cancer1
2RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
2RecruitingTreatmentMetastatic Large Cell Neuroendocrine Carcinoma / Metastatic Neuroendocrine Carcinoma / Metastatic Neuroendocrine Neoplasm / Metastatic Small Cell Carcinoma1
2RecruitingTreatmentMetastatic Melanoma2
2RecruitingTreatmentMetastatic Melanoma / Tumors Metastatic to Brain1
2RecruitingTreatmentMetastatic Prostatic Adenocarcinoma1
2RecruitingTreatmentMetastatic Renal Cell Carcinoma3
2RecruitingTreatmentMucosal Melanoma1
2RecruitingTreatmentNasopharyngeal Carcinoma1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Skin Cancers1
2RecruitingTreatmentNeuroendocrine Carcinomas1
2RecruitingTreatmentPan Tumor1
2RecruitingTreatmentPituitary / Pituitary Cancer / Pituitary Carcinoma / Pituitary Neoplasms1
2RecruitingTreatmentProstate Cancer2
2RecruitingTreatmentProstate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma1
2RecruitingTreatmentRectal Carcinoma1
2RecruitingTreatmentRecurrent Glioblastoma1
2RecruitingTreatmentRenal Cell Adenocarcinoma3
2RecruitingTreatmentSalivary Gland Cancers1
2RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2RecruitingTreatmentSquamous Cell Carcinoma of Lung / Squamous-Cell Lung Cancer1
2RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2RecruitingTreatmentStage I Non-Small Cell Lung Cancer AJCC v7 / Stage IA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer AJCC v71
2RecruitingTreatmentStage III Cutaneous Melanoma / Stage IIIA Cutaneous Melanoma / Stage IIIB Cutaneous Melanoma / Stage IIIC Cutaneous Melanoma / Stage IV Cutaneous Melanoma1
2RecruitingTreatmentStage IV Melanoma / Unresectable Stage III Melanoma1
2RecruitingTreatmentThyroid Cancers1
2RecruitingTreatmentTumors, Solid1
2SuspendedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2SuspendedTreatmentSmall Cell Lung Cancer (SCLC)1
2TerminatedTreatmentA Combination of Adoptive T Cell Therapy and Ipilimumab Could Increase the Proportion of CR Patients, and Durability of Response1
2TerminatedTreatmentHER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2TerminatedTreatmentMalignant Neoplasm of Female Breast / Malignant Neoplasm of Stomach / Ovarian Cancer1
2TerminatedTreatmentMelanoma2
2TerminatedTreatmentMelanoma, Malignant1
2TerminatedTreatmentMetastatic Melanoma2
2TerminatedTreatmentProstate Cancer1
2TerminatedTreatmentProstatic Neoplasms1
2TerminatedTreatmentRecurrent Melanoma / Stage IV Skin Melanoma1
2TerminatedTreatmentSynovial Sarcoma1
2WithdrawnTreatmentBasal Cell Nevus Syndrome1
2WithdrawnTreatmentCervical Carcinoma / Esophageal Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma1
2WithdrawnTreatmentClear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
2WithdrawnTreatmentMalignant Melanoma of Skin / Melanoma (Skin)1
2WithdrawnTreatmentMelanoma Stage Iii / Melanoma Stage Iv1
2WithdrawnTreatmentMelanoma / Metastatic Melanoma1
2WithdrawnTreatmentNeuroendocrine Carcinoma of the Skin1
2WithdrawnTreatmentProstate Cancer1
2, 3Active Not RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v71
2, 3Not Yet RecruitingTreatmentGliosarcoma / MGMT-unmethylated Glioblastoma1
2, 3RecruitingTreatmentAdenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Clinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IVA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IVA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v81
2, 3RecruitingTreatmentMetastatic Hormone-sensitive Prostate Cancer1
2, 3SuspendedTreatmentMetastatic Cutaneous Melanoma / Recurrent Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma1
3Active Not RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
3Active Not RecruitingTreatmentAdvanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
3Active Not RecruitingTreatmentGastroesophageal Junction Cancer / Malignant Neoplasm of Stomach1
3Active Not RecruitingTreatmentHead and Neck Carcinoma1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
3Active Not RecruitingTreatmentLung Cancers1
3Active Not RecruitingTreatmentMelanoma4
3Active Not RecruitingTreatmentMelanoma of Unknown Primary / Recurrent Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v71
3Active Not RecruitingTreatmentMesothelioma1
3Active Not RecruitingTreatmentMetastatic Cutaneous Melanoma / Metastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Cutaneous Melanoma / Recurrent Non-Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IVA Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVB Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVC Mucosal Melanoma of the Head and Neck AJCC v71
3Active Not RecruitingTreatmentMetastatic Melanoma1
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v71
3Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentUnresectable or Metastatic Melanoma1
3Active Not RecruitingTreatmentVarious Advanced Cancer1
3CompletedTreatmentHigh Risk Stage III Melanoma1
3CompletedTreatmentLung Cancer - Non Small Cell Squamous1
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3CompletedTreatmentMelanoma5
3CompletedTreatmentMelanoma / Metastases1
3CompletedTreatmentProstate Cancer2
3CompletedTreatmentSmall Cell Lung Cancer (SCLC)1
3Not Yet RecruitingTreatmentLiver Cancer1
3Not Yet RecruitingTreatmentRenal Cancers / Renal Cell Carcinoma Metastatic / Synchronous Neoplasm1
3RecruitingTreatmentAdenocarcinoma of the Lung / ALK wt Allele / EGFR wt Allele / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Non-Small Cell Carcinoma / Malignant Neoplasms of Respiratory and Intrathoracic Organs / RET gene mutation / ROS1 Gene Mutation / Stage IV Lung Cancer AJCC v81
3RecruitingTreatmentAdvanced Solid Tumors / Cancer, Anal / Cancer, Bladder / Cholangiocarcinomas / Colorectal Cancers / Hepatocellular,Carcinoma / HNSCC / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Melanoma / Renal Cancers1
3RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Malignant Neoplasm in Lymph Node / Metastatic Malignant Neoplasm in the Bone / Metastatic Malignant Neoplasm in the Soft Tissues / Metastatic Malignant Neoplasm in the Viscera / Sarcomatoid Renal Cell Carcinoma / Stage IV Renal Cell Cancer AJCC v81
3RecruitingTreatmentHead and Neck Carcinoma1
3RecruitingTreatmentHepatocellular,Carcinoma1
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
3RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
3RecruitingTreatmentMetastatic Melanoma1
3RecruitingTreatmentMetastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma1
3RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer1
3RecruitingTreatmentRenal Cell Adenocarcinoma3
3RecruitingTreatmentTumors Metastatic to Brain1
3RecruitingTreatmentUrothelial Cancer1
3WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
4Active Not RecruitingTreatmentLung Cancers1
4Active Not RecruitingTreatmentMelanoma, Malignant1
4Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
4TerminatedTreatmentMetastatic Melanoma1
Not AvailableActive Not RecruitingNot AvailableAdenocarcinomas1
Not AvailableActive Not RecruitingNot AvailableMelanoma1
Not AvailableActive Not RecruitingTreatmentBreast Cancer1
Not AvailableActive Not RecruitingTreatmentMetastatic Melanoma1
Not AvailableCompletedNot AvailableAdvanced Melanoma1
Not AvailableCompletedNot AvailableMelanoma3
Not AvailableCompletedTreatmentPreviously Untreated and Histologically Confirmed Stage III (Unresectable) or Stage IV Melanoma1
Not AvailableNo Longer AvailableNot AvailableGlioblastomas / Glioma of Brain1
Not AvailableNo Longer AvailableNot AvailableMelanoma1
Not AvailableNo Longer AvailableNot AvailableMelanoma, Malignant1
Not AvailableNot Yet RecruitingNot AvailableLung Cancers / Melanoma / Renal Cancers1
Not AvailableNot Yet RecruitingOtherCervix Cancer1
Not AvailableRecruitingNot AvailableCarcinoma, Colorectal / Lung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableRecruitingNot AvailableHealthy Volunteers / Immunotherapy / Melanoma / Metagenome / Microbiome1
Not AvailableRecruitingNot AvailableImmunotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Metagenome / Microbiome1
Not AvailableRecruitingNot AvailableImmunotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoantigens / Neoepitopes / Next Generation Sequencing (NGS) / Personalized Neoantigen Cancer Vaccine1
Not AvailableRecruitingNot AvailableMelanoma2
Not AvailableRecruitingNot AvailableMetastatic Cancers1
Not AvailableRecruitingNot AvailableTumors Metastatic to Brain1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
InjectionIntravenous5 mg/1mL
LiquidIntravenous5 mg
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2381770No2007-08-072020-08-08Canada
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)80-90 ºC (based on IgG properties)McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282
boiling point (°C)Fab and Fc domains denaturates at 60 and 70 ºC respectivelyArnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility50 mg/mlHuman IgG purified. Product Information
isoelectric point6.1-8.5 Agrisera Information about IgG antibodies.

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Inhibitor
General Function
Not Available
Specific Function
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of t...
Gene Name
CTLA4
Uniprot ID
P16410
Uniprot Name
Cytotoxic T-lymphocyte protein 4
Molecular Weight
24655.63 Da
References
  1. Yang JC, Hughes M, Kammula U, Royal R, Sherry RM, Topalian SL, Suri KB, Levy C, Allen T, Mavroukakis S, Lowy I, White DE, Rosenberg SA: Ipilimumab (anti-CTLA4 antibody) causes regression of metastatic renal cell cancer associated with enteritis and hypophysitis. J Immunother. 2007 Nov-Dec;30(8):825-30. [PubMed:18049334]

Drug created on March 19, 2008 10:16 / Updated on July 03, 2020 08:33

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates