Ipilimumab

Identification

Name

Ipilimumab

Accession Number

DB06186

Type

Biotech

Groups

Approved

Biologic Classification

Protein Based Therapies
Monoclonal antibody (mAb)

Description

Ipilimumab is a fully humanized IgG1 monoclonal antibody that blocks cytotoxic T lymphocyte antigen-4 (CTLA-4).⁵ Blocking CTLA-4 removes an inhibitory signal from reducing the activity of T lymphocytes.^1,2,5 Ipilimumab was developed by Bristol-Myers Squibb and Medarex.⁵

Ipilimumab was granted FDA approval on 25 March 2011.⁵

Protein structure

Protein chemical formula

C₆₅₇₂H₁₀₁₂₆N₁₇₃₄O₂₀₈₀S₄₀

Protein average weight

148000.0 Da

Sequences

>Ipilimumab heavy chain (patent appl. US20150283234) 
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK

>Ipilimumab light chain 
EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Download FASTA Format

Synonyms

• Ipilimumab

External IDs

BMS-734016 / MDX-010 / MDX-101 / MDX-CTLA-4 / MOAB-CTLA-4

Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Unlock Additional Data
Yervoy	Injection	5 mg/1mL	Intravenous	Baxter Pharmaceutical Solutions, LLC	2011-03-25	2016-04-11
Yervoy	Injection	5 mg/1mL	Intravenous	Baxter Pharmaceutical Solutions, LLC	2011-03-25	2016-04-11
Yervoy	Liquid	5 mg	Intravenous	Bristol Myers Squibb	2012-03-08	Not applicable
Yervoy	Injection	5 mg/1mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2011-03-25	Not applicable
Yervoy	Injection	5 mg/1mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2011-03-25	Not applicable

Additional Data Available

Application Number
Application Number
A unique ID assigned by the FDA when a product is submitted for approval by the labeller.
Learn more
Product Code
Product Code
A governmentally-recognized ID which uniquely identifies the product within its regulatory market.
Learn more

International/Other Brands

Yervoy

Categories

• Adjuvants, Immunologic
• Amino Acids, Peptides, and Proteins
• Antibodies
• Antibodies, Monoclonal
• Antibodies, Monoclonal, Humanized
• Antineoplastic Agents
• Antineoplastic Agents, Immunological
• Antineoplastic and Immunomodulating Agents
• Blood Proteins
• CTLA-4-directed Antibody Interactions
• CTLA-4-directed Blocking Antibody
• Drugs that are Mainly Renally Excreted
• Globulins
• Immunoglobulin G
• Immunoglobulins
• Immunoproteins
• Increased T Lymphocyte Activation
• Narrow Therapeutic Index Drugs
• Proteins
• Serum Globulins

UNII

6T8C155666

CAS number

477202-00-9

Pharmacology

Indication

Ipilimumab is indicated to treat unresectable or metastatic melanoma, as an adjuvant in the treatment of cutaneous melanoma, to treat microsatellite-high or mismatch repair deficient metastatic colorectal cancer, or to treat hepatocellular carcinoma.⁵ Ipilimumab with nivolumab is indicated to treat advanced renal cell carcinoma.⁵

Associated Conditions

• Advanced Renal Cell Carcinoma
• Cutaneous Melanoma
• Hepatocellular,Carcinoma
• Metastatic Melanoma
• Unresectable Melanoma
• Metastatic MSI-H/dMMR colorectal cancer

Pharmacodynamics

Ipilimumab is a human IgG1 that binds CTLA-4, preventing 1 T-cell inhibition signal pathway.³ It has a long duration of action as it is given every 3 to 4 weeks.⁵ Patients should be counselled regarding the risk of immune-mediated adverse effects, infusion related reactions, and embryo-fetal toxicity.⁵

Mechanism of action

Cytotoxic T-lymphocyte antigen-4 (CTLA-4) is an inhibitory molecule that competes with the stimulatory CD28 for binding to B7 on antigen presenting cells.³ CTLA-4 and CD28 are both presented on the surface of T-cells.³ Ipilimumab is a human IgG1 that binds CTLA-4, preventing the inhibition of T-cell mediated immune responses to tumors.³

Target	Actions	Organism
ACytotoxic T-lymphocyte protein 4	inhibitor	Humans

Unlock Additional Data

Additional Data Available

Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more

Additional Data Available

Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more

Additional Data Available

Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more

Absorption

C_max was 65.8µg/mL for 2-6 year olds, 70.1µg/mL for 6-<12 year olds, and 73.3µg/mL in patients 12 years and older.⁵ Data regarding the AUC and T_max of ipilumumab are not readily available.^3,5

Volume of distribution

The volume of distribution at steady-state of ipilimumab is 7.21L.³

Protein binding

Data regarding the protein binding of ipilimumab is not readily available.⁵

Metabolism

The metabolism of ipilimumab does not involve the cytochrome P450 enzyme system.^5,6 Because ipilimumab is a protein, it is expected to be degraded into small peptides and amino acids by proteolytic enzymes.⁴

Route of elimination

Data regarding the route of elimination of ipilimumab is not readily available.⁵

Half life

Ipilimumab has a half life of 14.7 days.³

Clearance

Ipilimumab has a clearance of 15.3 mL/hr.³ Systemic clearance increases proportionally with body weight.⁶

Toxicity

Data regarding ipilumumab overdose is not readily available.⁵ However, the most common adverse reactions to ipilumumab are fatigue, diarrhea, pruritus, rash, and colitis.⁵

Affected organisms

• Humans and other mammals

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.

• All Drugs
• Approved
• Vet approved
• Nutraceutical
• Illicit
• Withdrawn
• Investigational
• Experimental

Drug	Interaction
Unlock Additional Data
Abacavir	Abacavir may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Abciximab	The risk or severity of adverse effects can be increased when Abciximab is combined with Ipilimumab.
Abituzumab	The risk or severity of adverse effects can be increased when Ipilimumab is combined with Abituzumab.
Abrilumab	The risk or severity of adverse effects can be increased when Ipilimumab is combined with Abrilumab.
Acarbose	Acarbose may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Aceclofenac	Aceclofenac may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Acemetacin	Acemetacin may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Acetaminophen	Acetaminophen may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Acetazolamide	Acetazolamide may increase the excretion rate of Ipilimumab which could result in a lower serum level and potentially a reduction in efficacy.
Acetylsalicylic acid	Acetylsalicylic acid may decrease the excretion rate of Ipilimumab which could result in a higher serum level.

Additional Data Available

Extended Description
Extended Description
Extended description of the mechanism of action and particular properties of each drug interaction.
Learn more
Severity
Severity
A severity rating for each drug interaction, from minor to major.
Learn more
Evidence Level
Evidence Level
A rating for the strength of the evidence supporting each drug interaction.
Learn more
Action
Action
An effect category for each drug interaction. Know how this interaction affects the subject drug.
Learn more

Food Interactions

No interactions found.

References

General References

1. Johnson DB, Peng C, Abramson RG, Ye F, Zhao S, Wolchok JD, Sosman JA, Carvajal RD, Ariyan CE: Clinical Activity of Ipilimumab in Acral Melanoma: A Retrospective Review. Oncologist. 2015 Jun;20(6):648-52. doi: 10.1634/theoncologist.2014-0468. Epub 2015 May 11. [PubMed:25964307]
2. Thumar JR, Kluger HM: Ipilimumab: a promising immunotherapy for melanoma. Oncology (Williston Park). 2010 Dec;24(14):1280-8. [PubMed:21294471]
3. Trinh VA, Hagen B: Ipilimumab for advanced melanoma: a pharmacologic perspective. J Oncol Pharm Pract. 2013 Sep;19(3):195-201. doi: 10.1177/1078155212459100. Epub 2012 Oct 9. [PubMed:23047236]
4. Fellner C: Ipilimumab (yervoy) prolongs survival in advanced melanoma: serious side effects and a hefty price tag may limit its use. P T. 2012 Sep;37(9):503-30. [PubMed:23066344]
5. FDA Approved Drug Products: Yervoy Ipilimumab Intravenous Injection [Link]
6. BC Cancer Agency: Yervoy Monograph [Link]

External Links

KEGG Drug

D04603

PubChem Substance

347910341

RxNav

1094833

ChEMBL

CHEMBL1789844

RxList

RxList Drug Page

Drugs.com

Drugs.com Drug Page

Wikipedia

Ipilimumab

ATC Codes

L01XC11 — Ipilimumab

• L01XC — Monoclonal antibodies
• L01X — OTHER ANTINEOPLASTIC AGENTS
• L01 — ANTINEOPLASTIC AGENTS
• L — ANTINEOPLASTIC AND IMMUNOMODULATING AGENTS

AHFS Codes

• 10:00.00 — Antineoplastic Agents

FDA label

Download (1.13 MB)

MSDS

Download (479 KB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Active Not Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Kidney Carcinoma / Metastatic Renal Cell Cancer / Renal Cancers / Stage IV Renal Cell Cancer AJCC V7	1
0	Active Not Recruiting	Treatment	Larynx / Lip, Oral Cavity and Pharynx	1
0	Completed	Treatment	Melanoma	1
0	Completed	Treatment	Prostate Cancer	1
0	Not Yet Recruiting	Basic Science	Melanoma, Malignant	1
0	Recruiting	Treatment	Metastatic Melanoma	1
0	Recruiting	Treatment	Sarcomas	1
0	Terminated	Treatment	Ciliary Body and Choroid Melanoma, Medium/Large Size / Ciliary Body and Choroid Melanoma, Small Size / Extraocular Extension Melanoma / Hepatic Metastases / Iris Melanoma / Metastatic Intraocular Melanoma / Recurrent Intraocular Melanoma / Stage IV Intraocular Melanoma	1
1	Active Not Recruiting	Treatment	ALK Gene Rearrangement / EGFR Gene Mutations / Locally Advanced Lung Non-Small Cell Carcinoma / Lung Non-Small Cell Carcinoma / Stage II Lung Cancer AJCC v8 / Stage IIA Lung Cancer AJCC v8 / Stage IIB Lung Cancer AJCC v8 / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Unresectable Lung Non-Small Cell Carcinoma	1
1	Active Not Recruiting	Treatment	Acute Lymphoblastic Leukaemia Recurrent / Acute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplant Recipient / Chronic, recurrent Lymphocytic Leukemia / Myeloproliferative Neoplasms / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hematologic Malignancy / Recurrent Hodgkin Lymphoma / Recurrent Myelodysplastic Syndrome / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma	1
1	Active Not Recruiting	Treatment	Acute Lymphocytic Leukemia (ALL) / Chronic Lymphocytic Leukaemia (CLL) / Lymphoma, B Cell / Lymphoma, B-Cell	1
1	Active Not Recruiting	Treatment	Adenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Stage IB2 Cervical Cancer AJCC v6 and v7 / Stage II Cervical Cancer AJCC v7 / Stage IIA Cervical Cancer AJCC v7 / Stage IIB Cervical Cancer AJCC v6 and v7 / Stage IIIB Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer AJCC v6 and v7	1
1	Active Not Recruiting	Treatment	Advanced/Metastatic Solid Tumors or Lymphomas	1
1	Active Not Recruiting	Treatment	BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
1	Active Not Recruiting	Treatment	Breast Adenocarcinoma / Invasive Breast Carcinoma / Metastatic Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm	1
1	Active Not Recruiting	Treatment	Cancer of Head and Neck	1
1	Active Not Recruiting	Treatment	Cancer, Advanced	1
1	Active Not Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Glioblastoma Multiforme (GBM) / Glioblastomas	1
1	Active Not Recruiting	Treatment	Glioblastomas	1
1	Active Not Recruiting	Treatment	Gliosarcoma / Supratentorial Glioblastoma	1
1	Active Not Recruiting	Treatment	Hepatocellular,Carcinoma	1
1	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
1	Active Not Recruiting	Treatment	Malignant Melanoma of Skin / Melanoma (Skin)	1
1	Active Not Recruiting	Treatment	Melanoma	3
1	Active Not Recruiting	Treatment	Melanoma, Uveal	1
1	Active Not Recruiting	Treatment	Melanoma / Novel Coronavirus Infectious Disease (COVID-19)	1
1	Active Not Recruiting	Treatment	Melanoma / Skin Cancers	1
1	Active Not Recruiting	Treatment	Metastatic Malignant Neoplasm in the Liver / Metastatic Uveal Melanoma	1
1	Active Not Recruiting	Treatment	Metastatic Melanoma	1
1	Active Not Recruiting	Treatment	Stage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v7	1
1	Active Not Recruiting	Treatment	Stages III Skin Melanoma	1
1	Completed	Basic Science	Advanced Melanoma / Metastatic Melanoma	1
1	Completed	Basic Science	Melanoma	1
1	Completed	Treatment	Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Chronic Myelomonocytic Leukemia / Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes	1
1	Completed	Treatment	Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Childhood Myelodysplastic Syndromes / Chronic Lymphocytic Leukemia (CLL) - Refractory / Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Disseminated Neuroblastoma / Neoplasms, Malignant / Ovarian Choriocarcinoma / Ovarian Embryonal Carcinoma / Ovarian Immature Teratoma / Ovarian Mature Teratoma / Ovarian Mixed Germ Cell Tumor / Ovarian Monodermal and Highly Specialized Teratoma / Ovarian Polyembryoma / Ovarian Yolk Sac Tumor / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Mantle Cell Lymphoma / Recurrent Neuroblastoma / Recurrent Ovarian Epithelial Cancer / Recurrent Ovarian Germ Cell Tumor / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage II Ovarian Epithelial Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Multiple Myeloma / Stage III Ovarian Epithelial Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Stage IV Ovarian Epithelial Cancer / Testicular Choriocarcinoma / Testicular Choriocarcinoma and Embryonal Carcinoma / Testicular Choriocarcinoma and Seminoma / Testicular Choriocarcinoma and Teratoma / Testicular Choriocarcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma / Testicular Embryonal Carcinoma and Seminoma / Testicular Embryonal Carcinoma and Teratoma / Testicular Embryonal Carcinoma and Teratoma With Seminoma / Testicular Embryonal Carcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma and Yolk Sac Tumor With Seminoma / Testicular Teratoma / Testicular Yolk Sac Tumor / Testicular Yolk Sac Tumor and Teratoma / Testicular Yolk Sac Tumor and Teratoma With Seminoma	1
1	Completed	Treatment	Advanced Cancers	1
1	Completed	Treatment	Advanced Melanoma	2
1	Completed	Treatment	Adverse Effect of Radiation Therapy / Effects of Immunotherapy / Melanoma	1
1	Completed	Treatment	Breast Cancer / Head and Neck Carcinoma / Malignancies / Malignant Lymphomas / Melanoma / Triple Negative Breast Cancer (TNBC) / Triple-Negative Breast Cancer (TNBC)	1
1	Completed	Treatment	Breast Cancer / Invasive Adenocarcinoma of the Breast	1
1	Completed	Treatment	CD20 Positive / Recurrent B-Cell Non-Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma	1
1	Completed	Treatment	Cancer,NOS	1
1	Completed	Treatment	Castrate Resistant Prostate Cancer (CRPC) / Prostate Cancer	1
1	Completed	Treatment	Clear Cell Renal Cell Carcinoma / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Colon / Malignant Neoplasm of Pancreas / Melanoma / Mesothelioma / Ovarian Cancer / Prostate Cancer / Soft Tissue Sarcoma (STS) / Thyroid Cancers / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)	1
1	Completed	Treatment	Duct Cell Adenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer	1
1	Completed	Treatment	Gastrointestinal Stromal Tumors / Stage III Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma	1
1	Completed	Treatment	Hepatic Metastases / Melanoma, Uveal	1
1	Completed	Treatment	Human Immunodeficiency Virus (HIV) Infections	1
1	Completed	Treatment	Intraocular Melanoma / Malignant Melanoma of Skin / Melanoma (Skin)	1
1	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Cancer (SCLC) / Tumors, Solid	1
1	Completed	Treatment	Malignant Lymphomas	1
1	Completed	Treatment	Malignant Lymphomas / Neuroblastomas / Sarcomas / Wilms' tumor	1
1	Completed	Treatment	Malignant Neoplasm of Pancreas	1
1	Completed	Treatment	Melanoma	6
1	Completed	Treatment	Melanoma, Malignant	3
1	Completed	Treatment	Metastatic Melanoma	1
1	Completed	Treatment	Prostate Cancer	1
1	Completed	Treatment	Prostatic Neoplasms	1
1	Completed	Treatment	Recurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain	1
1	Completed	Treatment	Recurrent Prostate Carcinoma / Stage IV Prostate Cancer / Stage IV Prostate Cancer AJCC v7	1
1	Completed	Treatment	Solid Cancers	1
1	Completed	Treatment	Transitional Cell Carcinoma	1
1	Completed	Treatment	Tumors, Solid	1
1	Completed	Treatment	Unresectable Melanoma	1
1	Not Yet Recruiting	Treatment	Aggressive Variant Prostate Carcinoma / Castration-Resistant Prostate Carcinoma / Metastatic Clear Cell Renal Cell Carcinoma / Metastatic Hormone Refractory Prostate Cancer / Metastatic Malignant Solid Neoplasm / Stage IV Prostate Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Stage IVA Prostate Cancer AJCC v8 / Stage IVB Prostate Cancer AJCC v8 / Urothelial carcinoma ureter metastatic	1
1	Not Yet Recruiting	Treatment	Cancer, Advanced	1
1	Not Yet Recruiting	Treatment	Fibrolamellar Hepatocellular Carcinoma (FLC)	1
1	Not Yet Recruiting	Treatment	Glioblastomas / Gliomas, Malignant / Grade III Glioma / Recurrent Glioblastoma / Recurrent Grade III Glioma / Recurrent Malignant Gliomas	1
1	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
1	Not Yet Recruiting	Treatment	Melanoma	1
1	Not Yet Recruiting	Treatment	Metastatic Adenocarcinoma	1
1	Not Yet Recruiting	Treatment	Non-Small Cell Lung Cancer With Mutation in Epidermal Growth Factor Receptor (Disorder)	1
1	Not Yet Recruiting	Treatment	Recurrent Head and Neck Squamous Cell Carcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1	Not Yet Recruiting	Treatment	Renal Cell Adenocarcinoma / Stage IV Renal Cell Carcinoma	1
1	Recruiting	Basic Science	Soft Tissue Sarcoma Adult	1
1	Recruiting	Treatment	Acute Myeloid Leukemia and Myelodysplastic Syndrome	1
1	Recruiting	Treatment	Adenocarcinoma of the Pancreas / Colon Carcinoma Metastatic in the Liver / Colorectal Adenocarcinoma / Resectable Pancreatic Carcinoma / Stage I Pancreatic Cancer / Stage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage II Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer	1
1	Recruiting	Treatment	Advanced Cancers / Advanced Malignant Solid Neoplasm / C-KIT Tyrosine Kinase Protein Overexpression / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Metastatic Gastrointestinal Stromal Tumor / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Unresectable Melanoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Advanced Cancers / Melanoma	1
1	Recruiting	Treatment	Advanced Clear Cell Renal Cell Carcinoma / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Kidney Small Cell Carcinoma / Metastatic Bladder Small Cell Carcinoma / Metastatic Bladder Squamous Cell Carcinoma / Metastatic Bladder Urothelial Carcinoma / Metastatic Kidney Medullary Carcinoma / Metastatic Malignant Genitourinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Renal Cell Carcinoma / Metastatic Renal Pelvis Urothelial Carcinoma / Metastatic Sarcomatoid Renal Cell Carcinoma / Metastatic Ureter Urothelial Carcinoma / Metastatic Urethral Urothelial Carcinoma / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma AJCC v6 and v7 / Stage III Bladder Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Penile Cancer AJCC v7 / Stage III Renal Cell Cancer AJCC v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer AJCC v7 / Stage IIIa Penile Cancer AJCC v7 / Stage IIIb Penile Cancer AJCC v7 / Stage IV Bladder Adenocarcinoma AJCC v7 / Stage IV Bladder Squamous Cell Carcinoma AJCC v7 / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Penile Cancer AJCC v7 / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer AJCC v7	1
1	Recruiting	Treatment	Advanced Colon Adenocarcinoma / Metastatic Colon Adenocarcinoma / Metastatic Colorectal Adenocarcinoma / Metastatic Colorectal Carcinoma / Metastatic Rectal Adenocarcinoma / Stage III Colon Cancer AJCC v8 / Stage III Rectal Cancer AJCC v8 / Stage IIIA Colon Cancer AJCC v8 / Stage IIIA Rectal Cancer AJCC v8 / Stage IIIB Colon Cancer AJCC v8 / Stage IIIB Rectal Cancer AJCC v8 / Stage IIIC Colon Cancer AJCC v8 / Stage IIIC Rectal Cancer AJCC v8 / Stage IV Colon Cancer AJCC v8 / Stage IV Colorectal Cancer AJCC v8 / Stage IV Rectal Cancer AJCC v8 / Stage IVA Colon Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVA Rectal Cancer AJCC v8 / Stage IVB Colon Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVB Rectal Cancer AJCC v8 / Stage IVC Colon Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v8 / Stage IVC Rectal Cancer AJCC v8	1
1	Recruiting	Treatment	Advanced Malignancies	1
1	Recruiting	Treatment	Advanced Renal Cell Carcinoma / Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma / Stage III Renal Cell Cancer AJCC v8 / Stage III Renal Cell Cancer American Joint Committee on Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer American Joint Committee on Cancer AJCC v8 / Unresectable Renal Cell Carcinoma	1
1	Recruiting	Treatment	Advanced Solid Cancers	1
1	Recruiting	Treatment	Advanced Tumor / Metastatic Tumors	1
1	Recruiting	Treatment	Agnogenic Myeloid Metaplasia / Chronic Myelomonocytic Leukemia / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes / Myeloproliferative Neoplasms	1
1	Recruiting	Treatment	Acute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / Myelodysplastic Syndrome / Refractory Acute Myelogenous Leukemia (AML)	1
1	Recruiting	Treatment	Anatomic Stage 0 Breast Cancer AJCC v8 / Anatomic Stage I Breast Cancer AJCC v8 / Anatomic Stage IA Breast Cancer AJCC v8 / Anatomic Stage IB Breast Cancer AJCC v8 / Anatomic Stage II Breast Cancer AJCC v8 / Anatomic Stage IIA Breast Cancer AJCC v8 / Anatomic Stage IIB Breast Cancer AJCC v8 / Anatomic Stage IIIA Breast Cancer AJCC v8 / Anatomic Stage IIIB Breast Cancer AJCC v8 / HER2/Neu Negative / Invasive Ductal Carcinoma, Not Otherwise Specified / Progesterone Receptor Negative / Prognostic Stage 0 Breast Cancer AJCC v8 / Prognostic Stage I Breast Cancer AJCC v8 / Prognostic Stage IA Breast Cancer AJCC v8 / Prognostic Stage IB Breast Cancer AJCC v8 / Prognostic Stage II Breast Cancer AJCC v8 / Prognostic Stage IIA Breast Cancer AJCC v8 / Prognostic Stage IIB Breast Cancer AJCC v8 / Prognostic Stage IIIA Breast Cancer AJCC v8 / Prognostic Stage IIIB Breast Cancer AJCC v8 / Triple-Negative Breast Carcinoma	1
1	Recruiting	Treatment	Breast Cancer	1
1	Recruiting	Treatment	Breast Cancer / Leukemia Acute Myeloid Leukemia (AML) / Malignant Neoplasm of Pancreas / Prostate Cancer	1
1	Recruiting	Treatment	Cancer, Advanced	2
1	Recruiting	Treatment	Cancer, Bladder / Cholangiocarcinomas / Malignant Neoplasm of Colon / Malignant Neoplasm of Stomach / Melanoma / Ovarian Cancer / Palpable Subcutaneous Malignant Lesions / Renal Cell Adenocarcinoma / Tumors, Solid	1
1	Recruiting	Treatment	Clinical Stage III Cutaneous Melanoma AJCC v8 / Clinical Stage III Merkel Cell Carcinoma AJCC v8 / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Clinical Stage IV Merkel Cell Carcinoma AJCC v8 / High-Frequency Microsatellite Instability / Metastatic Basal cell carcinoma / Metastatic Melanoma / Metastatic Merkel Cell Carcinoma / Metastatic Skin Squamous Cell Carcinoma / Pathologic Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage III Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIA Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIA Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIB Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v8 / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Pathologic Stage IV Merkel Cell Carcinoma AJCC v8 / Unresectable Basal Cell Carcinoma / Unresectable Melanoma / Unresectable Merkel Cell Carcinoma	1
1	Recruiting	Treatment	Colorectal Cancers / Malignant Neoplasm of Pancreas	1
1	Recruiting	Treatment	Colorectal neoplasms malignant / Hepatic Metastases	1
1	Recruiting	Treatment	Fallopian Tubes / High Grade Serous Ovarian / Primary Peritoneal Cancer	1
1	Recruiting	Treatment	Glioblastomas	1
1	Recruiting	Treatment	Gliomas, Malignant	1
1	Recruiting	Treatment	Malignant Neoplasm of Pancreas / Melanoma / Prostate Cancer / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1	Recruiting	Treatment	Malignant Neoplasm of Stomach	1
1	Recruiting	Treatment	Malignant Peritoneal Neoplasm / Malignant Retroperitoneal Neoplasm / Peritoneal Carcinomatosis / Platinum-Resistant Fallopian Tube Carcinoma / Platinum-Resistant Ovarian Carcinoma / Platinum-Resistant Primary Peritoneal Carcinoma / Recurrent Cervical Carcinoma / Recurrent Endometrial Carcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Stage IV Cervical Cancer AJCC v8 / Stage IV Fallopian Tube Cancer AJCC v8 / Stage IV Ovarian Cancer AJCC v8 / Stage IV Primary Peritoneal Cancer AJCC v8 / Stage IVA Cervical Cancer AJCC v8 / Stage IVA Fallopian Tube Cancer AJCC v8 / Stage IVA Ovarian Cancer AJCC v8 / Stage IVA Primary Peritoneal Cancer AJCC v8 / Stage IVB Cervical Cancer AJCC v8 / Stage IVB Fallopian Tube Cancer AJCC v8 / Stage IVB Ovarian Cancer AJCC v8 / Stage IVB Primary Peritoneal Cancer AJCC v8	1
1	Recruiting	Treatment	Melanoma	1
1	Recruiting	Treatment	Metastases to soft tissue / Tumors, Solid	1
1	Recruiting	Treatment	Metastatic Hormone-sensitive Prostate Cancer	1
1	Recruiting	Treatment	Metastatic Melanoma	1
1	Recruiting	Treatment	Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
1	Recruiting	Treatment	Metastatic Solid Tumors / Treatment-Refractory Cancers	1
1	Recruiting	Treatment	Neoplasms, Malignant	1
1	Recruiting	Treatment	Neuroblastomas / Pediatric Solid Tumors	1
1	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin / Pathologic Stage IIIA Merkel Cell Carcinoma AJCC v8 / Pathologic Stage IIIB Merkel Cell Carcinoma AJCC v8	1
1	Recruiting	Treatment	Newly Diagnosed Glioblastoma / Newly Diagnosed High Grade Glioma	1
1	Recruiting	Treatment	Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v8	1
1	Recruiting	Treatment	Acute, recurrent Myeloid Leukemia / Recurrent Acute Myeloid Leukemia With Myelodysplasia-Related Changes / Recurrent Myelodysplastic Syndrome / Refractory Acute Myelogenous Leukemia (AML) / Refractory Myelodysplastic Syndrome / Secondary Acute Myeloid Leukemia (Secondary AML, sAML)	1
1	Recruiting	Treatment	Recurrent B Acute Lymphoblastic Leukemia / Recurrent Mixed Phenotype Acute Leukemia / Refractory B Acute Lymphoblastic Leukemia / Refractory Mixed Phenotype Acute Leukemia	1
1	Recruiting	Treatment	Recurrent Glioblastoma / Refractory Glioblastoma	1
1	Recruiting	Treatment	Renal Cancers	1
1	Recruiting	Treatment	Solid Tumor, Adult	1
1	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	2
1	Recruiting	Treatment	Stage III Prostate Cancer / Stage IIIA Prostate Cancer / Stage IIIB Prostate Cancer / Stage IIIC Prostate Cancer / Stage IV Prostate Cancer / Stage IVA Prostate Cancer / Stage IVB Prostate Cancer	1
1	Recruiting	Treatment	Stage IV Small Cell Lung Cancer	1
1	Recruiting	Treatment	Transitional Cell Carcinoma	1
1	Recruiting	Treatment	Tumors, Solid	1
1	Suspended	Treatment	Advanced Malignant Solid Neoplasm / Cancer, Anal / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Recurrent Classic Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Unresectable Solid Neoplasm	1
1	Terminated	Other	Melanoma	1
1	Terminated	Treatment	Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Non-Small Cell Lung Cancer Recurrent / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Recurrent Melanoma / Recurrent Ovarian Epithelial Cancer / Stage IV Melanoma / Stage IV Non-Small Cell Lung Cancer	1
1	Terminated	Treatment	Melanoma	3
1	Terminated	Treatment	Melanoma, Malignant	1
1	Terminated	Treatment	Metastatic Melanoma	1
1	Terminated	Treatment	Newly Diagnosed Melanoma Metastases in the Brain and Spine	1
1	Terminated	Treatment	Prostate Cancer	1
1	Terminated	Treatment	Stage III or IV Melanoma	1
1	Terminated	Treatment	Unresectable or Metastatic Melanoma	1
1	Withdrawn	Treatment	Chronic Myeloid Leukemia (CML)	1
1	Withdrawn	Treatment	Malignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)	1
1	Withdrawn	Treatment	Melanoma	1
1	Withdrawn	Treatment	Melanoma / Sarcomas	1
1	Withdrawn	Treatment	Metastatic Colorectal Cancer (MCRC)	1
1, 2	Active Not Recruiting	Treatment	Advanced Solid Tumors	1
1, 2	Active Not Recruiting	Treatment	Advanced or Metastatic Solid Tumors	1
1, 2	Active Not Recruiting	Treatment	Advanced or Metastatic Solid Tumors / Tumors, Solid	1
1, 2	Active Not Recruiting	Treatment	Cancer, Advanced	1
1, 2	Active Not Recruiting	Treatment	Carcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal	1
1, 2	Active Not Recruiting	Treatment	Colorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Metastatic Breast Cancer / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma	1
1, 2	Active Not Recruiting	Treatment	Extensive-Stage Small Cell Lung Cancer / Small Cell Lung Cancer (SCLC)	1
1, 2	Active Not Recruiting	Treatment	Hepatocellular,Carcinoma	1
1, 2	Active Not Recruiting	Treatment	Liver Cancer / Lung Cancers	1
1, 2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1, 2	Active Not Recruiting	Treatment	Lymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
1, 2	Active Not Recruiting	Treatment	MSS / RAS-mutant Colorectal Cancer	1
1, 2	Active Not Recruiting	Treatment	Malignancies	3
1, 2	Active Not Recruiting	Treatment	Malignancies / Neoplasms / Tumors	1
1, 2	Active Not Recruiting	Treatment	Malignant Lymphomas / Tumors, Solid	1
1, 2	Active Not Recruiting	Treatment	Melanoma	1
1, 2	Active Not Recruiting	Treatment	Melanoma, Malignant	1
1, 2	Active Not Recruiting	Treatment	Melanoma / Renal Cell Adenocarcinoma	1
1, 2	Active Not Recruiting	Treatment	Metastatic Melanoma	1
1, 2	Active Not Recruiting	Treatment	Metastatic Melanoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Refractory Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Melanoma / Refractory Neuroblastoma / Refractory Non-Hodgkin's lymphoma / Refractory Osteosarcoma / Refractory Rhabdomyosarcoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Melanoma	1
1, 2	Active Not Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic	1
1, 2	Active Not Recruiting	Treatment	Ovarian Cancer Metastatic	1
1, 2	Active Not Recruiting	Treatment	Prostate Cancer	1
1, 2	Active Not Recruiting	Treatment	Various Advanced Cancer	1
1, 2	Completed	Prevention	Stage IIIC Skin Melanoma / Stage IV Skin Melanoma	1
1, 2	Completed	Treatment	Advanced Malignancies / Advanced or Metastatic Malignancies	1
1, 2	Completed	Treatment	Cancer,NOS	1
1, 2	Completed	Treatment	Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma	1
1, 2	Completed	Treatment	Intraocular Melanoma / Malignant Melanoma of Skin / Melanoma (Skin)	1
1, 2	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1, 2	Completed	Treatment	Melanoma	1
1, 2	Completed	Treatment	Melanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma	1
1, 2	Completed	Treatment	Metastatic Melanoma	2
1, 2	Completed	Treatment	Metastatic Melanoma / Stage III Melanoma / Stage IV Melanoma	1
1, 2	Completed	Treatment	Neoplasms Metastasis / Prostate Cancer	1
1, 2	Completed	Treatment	Recurrent Melanoma / Stage IV Melanoma	1
1, 2	Completed	Treatment	Small Cell Lung Cancer (SCLC)	1
1, 2	Completed	Treatment	Unresectable Stage III or IV Malignant Melanoma	1
1, 2	Not Yet Recruiting	Treatment	Carcinoma, Non-small Cell Lung Cancer	1
1, 2	Not Yet Recruiting	Treatment	Colon Cancer With MSI-H or dMMR / Metastatic Melanoma / Renal Cell Adenocarcinoma	1
1, 2	Recruiting	Other	Malignant Melanoma of Skin / Melanoma (Skin)	1
1, 2	Recruiting	Treatment	Adenocarcinoma of the Pancreas	1
1, 2	Recruiting	Treatment	Advanced Malignancies / Metastatic Cancers / Metastatic Malignancy	1
1, 2	Recruiting	Treatment	Advanced Malignant Solid Neoplasm / Metastatic Carcinoma in the Liver / Metastatic Carcinoma in the Lung / Metastatic Malignant Neoplasm in the Thoracic Cavity / Metastatic Malignant Solid Neoplasm	1
1, 2	Recruiting	Treatment	Advanced Malignant Solid Neoplasm / Metastatic Malignant Solid Neoplasm / Unresectable Malignant Solid Neoplasm	1
1, 2	Recruiting	Treatment	Advanced Non Small Cell Lung Cancer	1
1, 2	Recruiting	Treatment	Advanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma	1
1, 2	Recruiting	Treatment	Cancer, Advanced	3
1, 2	Recruiting	Treatment	Cancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma	1
1, 2	Recruiting	Treatment	Clinical Stage 0 Gastric Cancer AJCC v8 / Clinical Stage 0 Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage I Gastric Cancer AJCC v8 / Clinical Stage I Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastric Cancer AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IVA Gastric Cancer AJCC v8 / Clinical Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Gastric Adenocarcinoma / Localized Gastric Carcinoma / Localized Gastroesophageal Junction Adenocarcinoma / Pathologic Stage 0 Gastric Cancer AJCC v8 / Pathologic Stage 0 Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage I Gastric Cancer AJCC v8 / Pathologic Stage IA Gastric Cancer AJCC v8 / Pathologic Stage IA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IB Gastric Cancer AJCC v8 / Pathologic Stage IB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastric Cancer AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastric Cancer AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Gastric Cancer AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8	1
1, 2	Recruiting	Treatment	Colorectal Cancers / Gastroesophageal Adenocarcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Transitional Cell Carcinoma / Tumors, Solid	1
1, 2	Recruiting	Treatment	Colorectal Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Shared Neoantigen-Positive Solid Tumors / Tumors, Solid	1
1, 2	Recruiting	Treatment	Grade II Meningioma / Grade III Meningioma / Recurrent Meningiomas	1
1, 2	Recruiting	Treatment	Hepatic Metastases / Melanoma, Uveal	1
1, 2	Recruiting	Treatment	Hepatocellular,Carcinoma	1
1, 2	Recruiting	Treatment	Immunotherapy / Neoplasms, Head and Neck	1
1, 2	Recruiting	Treatment	Invasive Bladder Cancer / Urinary Bladder Cancer	1
1, 2	Recruiting	Treatment	Larynx / LIP / Oral Cavity Cancer / Pharynx Cancer	1
1, 2	Recruiting	Treatment	Locally Advanced Pancreatic Cancer (LAPC)	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Lung Cancers / Small Cell Lung Cancer (SCLC)	1
1, 2	Recruiting	Treatment	Malignancies	1
1, 2	Recruiting	Treatment	Malignant Lymphomas / Multiple Myeloma (MM)	1
1, 2	Recruiting	Treatment	Malignant Melanoma Stage III	1
1, 2	Recruiting	Treatment	Melanoma	2
1, 2	Recruiting	Treatment	Melanoma / Melanoma Stage Iii / Melanoma Stage Iv	1
1, 2	Recruiting	Treatment	Melanoma / Renal Cell Adenocarcinoma / Tumors, Solid	1
1, 2	Recruiting	Treatment	Mesothelioma	1
1, 2	Recruiting	Treatment	Metastatic Malignant Neoplasm in the Brain / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Tumors Metastatic to Brain	1
1, 2	Recruiting	Treatment	Metastatic Melanoma	1
1, 2	Recruiting	Treatment	Pancreatic Adenocarcinoma Metastatic / Recurrent Pancreatic Adenocarcinoma / Stage II Pancreatic Cancer AJCC v8 / Stage IIA Pancreatic Cancer AJCC v8 / Stage IIB Pancreatic Cancer AJCC v8 / Stage III Pancreatic Cancer AJCC v8 / Stage IV Pancreatic Cancer AJCC v8 / Unresectable Pancreatic Carcinoma	1
1, 2	Recruiting	Treatment	Recurrent Classic Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma	1
1, 2	Recruiting	Treatment	Refractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma	1
1, 2	Recruiting	Treatment	Stage III/IV Melanoma	1
1, 2	Recruiting	Treatment	Tumors	1
1, 2	Recruiting	Treatment	Uveal Melanoma, Metastatic	1
1, 2	Suspended	Treatment	Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Anaplastic Large-Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Colon Cancer / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Melanoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Rectal Cancer / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)	1
1, 2	Terminated	Treatment	Adult Grade III Lymphomatoid Granulomatosis / B-Cell Chronic Lymphocytic Leukemia / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)	1
1, 2	Terminated	Treatment	Melanoma	3
1, 2	Terminated	Treatment	Melanoma / Metastatic Melanoma	1
1, 2	Terminated	Treatment	Metastatic Cancers	1
1, 2	Terminated	Treatment	Unresectable Stage III or Stage IV Melanoma	1
1, 2	Withdrawn	Treatment	Advanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage III Uveal Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm	1
1, 2	Withdrawn	Treatment	Hepatic Metastases / Lung Cancer Metastatic / Metastatic Melanoma / Tumors Metastatic to Brain	1
1, 2	Withdrawn	Treatment	Melanoma	2
1, 2	Withdrawn	Treatment	Metastatic Melanoma	1
2	Active Not Recruiting	Treatment	Acral lentiginous melanoma / Mucosal Melanoma	1
2	Active Not Recruiting	Treatment	Adenocarcinoma of the Cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Human Papillomavirus Infections / Recurrent Cervical Carcinoma / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer AJCC v6 and v7	1
2	Active Not Recruiting	Treatment	Adenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer	1
2	Active Not Recruiting	Treatment	Adenocarcinoma of the Stomach / Gastroesophageal Cancer (GC)	1
2	Active Not Recruiting	Treatment	Advanced Melanoma / Metastatic Melanoma / Metastatic Melanoma Stratified by MHC-II Expression	1
2	Active Not Recruiting	Treatment	Advanced Melanoma / Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Melanoma	1
2	Active Not Recruiting	Treatment	Advanced Non-Small Cell Lung Carcinoma / Metastatic Non-Small Cell Lung Carcinoma	1
2	Active Not Recruiting	Treatment	Advanced Solid Tumors	1
2	Active Not Recruiting	Treatment	Biliary Tract Neoplasms	1
2	Active Not Recruiting	Treatment	Breast Cancer / Triple Negative Breast Neoplasms	1
2	Active Not Recruiting	Treatment	Cancer, Advanced	1
2	Active Not Recruiting	Treatment	Cancer, Bladder / Melanoma	1
2	Active Not Recruiting	Treatment	Castration Levels of Testosterone / Castration-Resistant Prostate Carcinoma / Metastatic Hormone Refractory Prostate Cancer / Prostate Cancer / PSA Progression / Stage IV Prostate Adenocarcinoma AJCC v7	1
2	Active Not Recruiting	Treatment	Chromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma	1
2	Active Not Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
2	Active Not Recruiting	Treatment	Clinical Stage IV Cutaneous Melanoma / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Metastatic Malignant Neoplasm in the Brain / Metastatic Melanoma / Pathologic Stage IV Cutaneous Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v8	1
2	Active Not Recruiting	Treatment	Gastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours	1
2	Active Not Recruiting	Treatment	Gastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Locally Advanced Bone Sarcoma / Locally Advanced Soft Tissue Sarcoma / Metastatic Bone Sarcomas / Metastatic Liposarcoma / Metastatic Soft Tissue Sarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Metastatic Unresectable Sarcoma / Pleomorphic liposarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Bone Sarcoma / Unresectable Liposarcoma / Unresectable Soft Tissue Sarcoma	1
2	Active Not Recruiting	Treatment	Head and Neck Carcinoma	2
2	Active Not Recruiting	Treatment	Hepatic Metastases / Lung Cancer Metastatic / Recurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain	1
2	Active Not Recruiting	Treatment	Leptomeningeal Carcinomatosis / Melanoma	1
2	Active Not Recruiting	Treatment	Limited Stage Small Cell Lung Cancer / Small Cell Lung Cancer (SCLC)	1
2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Active Not Recruiting	Treatment	Microsatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer	1
2	Active Not Recruiting	Treatment	Major Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma	1
2	Active Not Recruiting	Treatment	Malignant Pleural Mesothelioma (MPM)	1
2	Active Not Recruiting	Treatment	Melanoma	5
2	Active Not Recruiting	Treatment	Melanoma, Malignant	1
2	Active Not Recruiting	Treatment	Melanoma, Uveal	1
2	Active Not Recruiting	Treatment	Melanoma / Melanoma Stage Iii	1
2	Active Not Recruiting	Treatment	Melanoma / Melanoma, Uveal / Metastatic Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7	1
2	Active Not Recruiting	Treatment	Melanoma / Tumors Metastatic to Brain	1
2	Active Not Recruiting	Treatment	Mesothelioma	1
2	Active Not Recruiting	Treatment	Metastatic Cancer Colorectal	1
2	Active Not Recruiting	Treatment	Metastatic Castration Sensitive Prostate Cancer	1
2	Active Not Recruiting	Treatment	Metastatic Leiomyosarcoma / Unresectable Leiomyosarcoma / Uterine Corpus Leiomyosarcoma	1
2	Active Not Recruiting	Treatment	Metastatic Lung Non-Squamous Non-Small Cell Carcinoma / Recurrent Lung Non-Squamous Non-Small Cell Carcinoma / Stage IV Lung Non-Small Cell Cancer AJCC v7	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma	2
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Stage IV Melanoma	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Tumors Metastatic to Brain	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Unresectable Melanoma	1
2	Active Not Recruiting	Treatment	Prostate Cancer	1
2	Active Not Recruiting	Treatment	Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma	1
2	Active Not Recruiting	Treatment	Recurrent Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
2	Active Not Recruiting	Treatment	Renal Cancers	1
2	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	2
2	Active Not Recruiting	Treatment	Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Melanoma	1
2	Active Not Recruiting	Treatment	Tumors, Solid / Unresectable or Metastatic Melanoma	1
2	Active Not Recruiting	Treatment	Untreated Stage III Melanoma or Stage IV Melanoma	1
2	Active Not Recruiting	Treatment	Various Advanced Cancer	1
2	Completed	Treatment	Adenocarcinomas / Breast Cancer	1
2	Completed	Treatment	Advanced or Metastatic Melanoma	1
2	Completed	Treatment	Brain Metastasis / Melanoma	1
2	Completed	Treatment	Extensive Stage Small Cell Lung Cancer	1
2	Completed	Treatment	In-transit Metastases Melanoma Stage IIIB and IIIC	1
2	Completed	Treatment	Intraocular Melanoma / Malignant Melanoma of Skin / Melanoma (Skin)	2
2	Completed	Treatment	Locally Advanced (Unresectable) or Metastatic Adenocarcinoma of the Gastric and Gastro-esophageal Junction	1
2	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers / Small Cell Lung Cancer (SCLC)	1
2	Completed	Treatment	Lung Cancers	1
2	Completed	Treatment	Malignant Melanoma Stage III / Malignant Melanoma Stage IV	1
2	Completed	Treatment	Malignant Melanoma of Skin / Melanoma (Skin)	1
2	Completed	Treatment	Malignant Melanoma, Metastatic	1
2	Completed	Treatment	Malignant Neoplasm of Pancreas	1
2	Completed	Treatment	Melanoma	11
2	Completed	Treatment	Melanoma Stage Iii / Melanoma Stage Iv	1
2	Completed	Treatment	Melanoma, Malignant	3
2	Completed	Treatment	Melanoma / Tumors Metastatic to Brain	1
2	Completed	Treatment	Metastatic Malignant Melanoma	1
2	Completed	Treatment	Metastatic Melanoma	2
2	Completed	Treatment	Metastatic Melanoma / Mucosal Melanoma / Recurrent Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Unresectable Melanoma	1
2	Completed	Treatment	Ocular Melanoma	1
2	Completed	Treatment	Ovarian Cancer / Platinum-sensitive Ovarian Cancer, Second-line, Third-line, or Fourth-line	1
2	Completed	Treatment	Pancreatic Adenocarcinoma Metastatic	1
2	Completed	Treatment	Prostate Cancer	3
2	Completed	Treatment	Prostatic Neoplasms	1
2	Completed	Treatment	Recurrent Melanoma / Stage IIIA Melanoma / Stage IIIB Melanoma / Stage IIIc Melanoma / Stage IV Melanoma	1
2	Completed	Treatment	Renal Cancers	1
2	Completed	Treatment	Transitional Cell Carcinoma	1
2	Enrolling by Invitation	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Cancer (SCLC)	1
2	Not Yet Recruiting	Treatment	Advanced Renal Cell Carcinoma	1
2	Not Yet Recruiting	Treatment	Brain Metastases, Adult	1
2	Not Yet Recruiting	Treatment	Cancer of Unknown Primary Site	1
2	Not Yet Recruiting	Treatment	Carcinosarcoma of Ovary / Carcinosarcoma of Uterus / Carcinosarcoma of Vagina	1
2	Not Yet Recruiting	Treatment	Chondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)	1
2	Not Yet Recruiting	Treatment	Chromophobe Renal Cell Carcinoma / Collecting Duct Renal Cell Carcinoma / Medullary Renal Cell Carcinoma / Metastatic Ncc Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Renal Cell Adenocarcinoma / Translocation Renal Cell Carcinoma / Unclassified Renal Cell Carcinoma / Unresectable advanced renal cell carcinoma	1
2	Not Yet Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
2	Not Yet Recruiting	Treatment	Hepatocellular Carcinoma (HCC)	1
2	Not Yet Recruiting	Treatment	Inoperable œsophageal Cancer	1
2	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma	1
2	Not Yet Recruiting	Treatment	Lung Cancers / Lung neoplasm malignant / Malignancies / Mesothelioma / Mesothelioma; Lung / Mesothelioma; Pleura / Mesotheliomas Pleural	1
2	Not Yet Recruiting	Treatment	Malignancies / Neoplasms / Tumors	1
2	Not Yet Recruiting	Treatment	Malignant Neoplasm of Pancreas / Pancreatic Cancer Metastatic	1
2	Not Yet Recruiting	Treatment	Melanoma	1
2	Not Yet Recruiting	Treatment	Recurrent Glioblastoma / Secondary Glioblastoma	1
2	Not Yet Recruiting	Treatment	Various Advanced Cancer	1
2	Recruiting	Diagnostic	Melanoma	1
2	Recruiting	Treatment	Acinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Apocrine Neoplasm / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Basal Cell Carcinoma (BCC) / Bladder Adenocarcinoma / Carcinoma of Gallbladder / Carcinoma, Adenoid Cystic / Cervical Clear Cell Adenocarcinoma / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Desmoid-Type Fibromatosis / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Extramammary Paget Disease / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Gastric Undifferentiated Carcinoma / Gastrointestinal Stromal Tumors / Gestational Trophoblastic Disease / Giant Cell Carcinoma / Hemangiosarcoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Testicular Sex Cord-Stromal Tumor / Metaplastic breast carcinoma / Metastatic Malignant Neoplasm of Unknown Primary / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / PEComa / Peritoneal Mesotheliomas / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Rare Disorder / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Solid Neoplasms / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Somatic-type Malignancy / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Carcinoma	1
2	Recruiting	Treatment	Acute Bilineal Leukemia / Acute Biphenotypic Leukemia (ABL) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute, recurrent Myeloid Leukemia / Chronic Myelomonocytic Leukemia / Leukemias / Myelodysplastic Syndrome / Refractory Acute Myelogenous Leukemia (AML) / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Therapy-Related Acute Myeloid Leukemia	1
2	Recruiting	Treatment	Adenocarcinoma of the Stomach / Esophageal Cancers / Gastroesophageal Cancer (GC) / HER2 Positive Gastric Cancer / Malignant Neoplasm of Stomach / Metastatic Gastric Cancers	1
2	Recruiting	Treatment	Adenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach	1
2	Recruiting	Treatment	Adrenocortical Carcinoma / Genitourinary Cancers / High Grade Neuroendocrine Carcinoma/Small Cell Carcinoma / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell	1
2	Recruiting	Treatment	Advanced Gastric Cancer	1
2	Recruiting	Treatment	Advanced Melanoma / Melanoma of Unknown Primary / Mucosal Melanoma / Refractory Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma / Unresectable Melanoma	1
2	Recruiting	Treatment	Advanced Metastatic Cancer	1
2	Recruiting	Treatment	Advanced Renal Cell Carcinoma	1
2	Recruiting	Treatment	Advanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	2
2	Recruiting	Treatment	Anal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Stage IV Anal Canal Cancer AJCC v6 and v7	1
2	Recruiting	Treatment	Appendiceal Tumor / Colorectal Tumors / Mucinous Neoplasm	1
2	Recruiting	Treatment	Atypical Teratoid/Rhabdoid Tumor / Chordoma (Poorly Differentiated or De-differentiated) / Epithelioid Sarcoma / Malignant Rhabdoid Tumors (MRT) / Other INI1 Negative Malignant Tumors (With PI Approval) / Rhabdoid Tumors of the Kidney (RTK)	1
2	Recruiting	Treatment	B-Cell Non-Hodgkin Lymphomas(NHL) / Blood And Marrow Transplantation / Hematopoietic and Lymphoid Cell Neoplasm / Leukemias / Malignant Lymphomas / Plasma Cell Myeloma / T-Cell Non-Hodgkin Lymphoma	1
2	Recruiting	Treatment	Basal Cell Carcinoma (BCC)	1
2	Recruiting	Treatment	Bladder Adenocarcinoma / Bladder Mixed Adenocarcinoma / Bladder Small Cell Carcinoma / Bladder Squamous Cell Carcinoma / Chromophobe Renal Cell Carcinoma / Infiltrating Bladder Lymphoepithelioma-Like Carcinoma / Infiltrating Bladder Urothelial Carcinoma / Infiltrating Bladder Urothelial Carcinoma With Giant Cells / Infiltrating Bladder Urothelial Carcinoma, Nested Variant / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Kidney Medullary Carcinoma / Large Cell Neuroendocrine Carcinoma / Metastatic Bladder carcinoma / Metastatic Bladder Large Cell Neuroendocrine Carcinoma / Metastatic Bladder Small Cell Carcinoma / Metastatic Bladder Squamous Cell Carcinoma / Metastatic Infiltrating Bladder Urothelial Carcinoma, Clear Cell Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Lipid-Rich Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Micropapillary Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Metastatic Infiltrating Bladder Urothelial Carcinoma, Sarcomatoid Variant / Metastatic Kidney Medullary Carcinoma / Metastatic Malignant Genitourinary System Neoplasm / Metastatic Penile Carcinoma / Metastatic Prostate Small Cell Carcinoma / Metastatic Sarcomatoid Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Sarcomatoid Renal Cell Carcinoma / Stage IV Bladder Cancer AJCC v8 / Stage IV Penile Cancer AJCC v8 / Stage IV Prostate Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8 / Stage IVA Bladder Cancer AJCC v8 / Stage IVA Prostate Cancer AJCC v8 / Stage IVB Bladder Cancer AJCC v8 / Stage IVB Prostate Cancer AJCC v8 / Testicular Leydig Cell Tumor / Testicular Sertoli Cell Tumor	1
2	Recruiting	Treatment	Breast Cancer	2
2	Recruiting	Treatment	Breast Cancer / Breast Neoplasm Female / Carcinoma, Breast / Tumors, Breast	1
2	Recruiting	Treatment	Breast Cancer / Hormone Receptor Positive Tumor / Luminal B / Metastatic Breast Cancer	1
2	Recruiting	Treatment	Cancer, Advanced	1
2	Recruiting	Treatment	Cancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma	1
2	Recruiting	Treatment	Cancer, Bladder	1
2	Recruiting	Treatment	Cancer, Bladder / Head/Neck Cancers / Lung Cancers / Melanoma Cancers / Metastatic Cancers / Renal Cancers	1
2	Recruiting	Treatment	Carcinoid Tumors / Neuroendocrine Tumors	1
2	Recruiting	Treatment	Carcinoma, Squamous Cell of Head and Neck / Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck	1
2	Recruiting	Treatment	Classic Kaposi Sarcoma	1
2	Recruiting	Treatment	Clear Cell Adenocarcinoma / Extra Renal Origin / Fallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Carcinoma	1
2	Recruiting	Treatment	Clear Cell Metastatic Renal Cell Carcinoma	1
2	Recruiting	Treatment	Clinical Stage I HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Clinical Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Human Papillomavirus Positive Oropharyngeal Squamous Cell Carcinoma / Oropharyngeal Basaloid Carcinoma / Pathologic Stage I HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Pathologic Stage II HPV-Mediated (p16-Positive) Oropharyngeal Carcinoma AJCC v8 / Posterior Tongue Squamous Cell Carcinoma / Soft Palate Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Tonsillar Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Colon Carcinoma	1
2	Recruiting	Treatment	Cutaneous Melanoma, Stage III / Cutaneous Melanoma, Stage IV / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Unresectable Melanoma	1
2	Recruiting	Treatment	Cutaneous Melanoma / Melanoma / Mucosal Melanoma / Ocular Melanoma / Oligometastatic Melanoma / Stage III Acral Lentiginous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Uveal Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Uveal Melanoma AJCC v7 / Stage IV Acral Lentiginous Melanoma AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma AJCC v7	1
2	Recruiting	Treatment	Differentiated Thyroid Gland Carcinoma / Follicular Variant Thyroid Gland Papillary Carcinoma / Poorly Differentiated Thyroid Gland Carcinoma / Refractory Differentiated Thyroid Gland Carcinoma / Refractory Thyroid Gland Carcinoma / Tall Cell Variant Thyroid Gland Papillary Carcinoma / Thyroid Gland Follicular Carcinoma / Thyroid Gland Hurthle Cell Carcinoma / Thyroid Gland Papillary Carcinoma	1
2	Recruiting	Treatment	Esophageal Cancers / Gastroesophageal Cancer (GC) / Malignant Neoplasm of Esophagus / Metastatic Esophageal Cancer / Metastatic Oesophageal Cancer / Oesophageal Cancer Nos	1
2	Recruiting	Treatment	Eye and Orbit	1
2	Recruiting	Treatment	GBM / MGMT-unmethylated Glioblastoma (GBM)	1
2	Recruiting	Treatment	Gastric and Esophagogastric Junction Adenocarcinoma	1
2	Recruiting	Treatment	Gastrointestinal Stromal Tumors	1
2	Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
2	Recruiting	Treatment	Hepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs / Resectable Hepatocellular Carcinoma	1
2	Recruiting	Treatment	Kidney Cancer Metastatic / Kidney Cancer Stage Iv / Kidney Cancer, Stage IV / Renal Cancers	1
2	Recruiting	Treatment	Kidney Medullary Carcinoma / Loss of INI 1 Protein Expression / Stage III Renal Cell Cancer AJCC v8 / Stage IV Renal Cell Cancer AJCC v8	1
2	Recruiting	Treatment	Leukemias / Myelodysplastic Syndrome / Recurrent Myelodysplastic Syndrome	1
2	Recruiting	Treatment	Liposarcomas, Dedifferentiated / Recurrent Dedifferentiated Liposarcoma / Recurrent Undifferentiated Pleomorphic Sarcoma / Resectable Dedifferentiated Liposarcoma / Resectable Undifferentiated Pleomorphic Sarcoma / Systemic Connective Tissue Disorders / Undifferentiated Pleomorphic Sarcoma	1
2	Recruiting	Treatment	Localized Oesogastric Adenocarcimona / MSI and or dMMR	1
2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	5
2	Recruiting	Treatment	Lung Cancers / Relapsed Small cell lung cancer / Small Cell Lung Cancer (SCLC)	1
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer	1
2	Recruiting	Treatment	Malignancies	1
2	Recruiting	Treatment	Malignant Melanoma Stage III	1
2	Recruiting	Treatment	Malignant Neoplasm of Colon	1
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas	2
2	Recruiting	Treatment	Melanoma	5
2	Recruiting	Treatment	Melanoma Stage Iv	1
2	Recruiting	Treatment	Melanoma With Brain Metastasis	1
2	Recruiting	Treatment	Melanoma, Malignant	2
2	Recruiting	Treatment	Melanoma, Uveal	1
2	Recruiting	Treatment	Melanoma / Ocular Melanoma	1
2	Recruiting	Treatment	Meningiomas	1
2	Recruiting	Treatment	Metastatic Biliary Tract Cancer / Pancreatic Cancer Metastatic	1
2	Recruiting	Treatment	Metastatic Cancers / Metastatic Castration Resistant Prostate Cancer	1
2	Recruiting	Treatment	Metastatic Colorectal Cancer (MCRC)	1
2	Recruiting	Treatment	Metastatic Large Cell Neuroendocrine Carcinoma / Metastatic Neuroendocrine Carcinoma / Metastatic Neuroendocrine Neoplasm / Metastatic Small Cell Carcinoma	1
2	Recruiting	Treatment	Metastatic Melanoma	2
2	Recruiting	Treatment	Metastatic Melanoma / Tumors Metastatic to Brain	1
2	Recruiting	Treatment	Metastatic Prostatic Adenocarcinoma	1
2	Recruiting	Treatment	Metastatic Renal Cell Carcinoma	3
2	Recruiting	Treatment	Mucosal Melanoma	1
2	Recruiting	Treatment	Nasopharyngeal Carcinoma	1
2	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin / Skin Cancers	1
2	Recruiting	Treatment	Neuroendocrine Carcinomas	1
2	Recruiting	Treatment	Pan Tumor	1
2	Recruiting	Treatment	Pituitary / Pituitary Cancer / Pituitary Carcinoma / Pituitary Neoplasms	1
2	Recruiting	Treatment	Prostate Cancer	2
2	Recruiting	Treatment	Prostate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma	1
2	Recruiting	Treatment	Rectal Carcinoma	1
2	Recruiting	Treatment	Recurrent Glioblastoma	1
2	Recruiting	Treatment	Renal Cell Adenocarcinoma	3
2	Recruiting	Treatment	Salivary Gland Cancers	1
2	Recruiting	Treatment	Soft Tissue Sarcoma (STS)	1
2	Recruiting	Treatment	Squamous Cell Carcinoma of Lung / Squamous-Cell Lung Cancer	1
2	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
2	Recruiting	Treatment	Stage I Non-Small Cell Lung Cancer AJCC v7 / Stage IA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage II Non-Small Cell Lung Cancer AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer AJCC v7	1
2	Recruiting	Treatment	Stage III Cutaneous Melanoma / Stage IIIA Cutaneous Melanoma / Stage IIIB Cutaneous Melanoma / Stage IIIC Cutaneous Melanoma / Stage IV Cutaneous Melanoma	1
2	Recruiting	Treatment	Stage IV Melanoma / Unresectable Stage III Melanoma	1
2	Recruiting	Treatment	Thyroid Cancers	1
2	Recruiting	Treatment	Tumors, Solid	1
2	Suspended	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Suspended	Treatment	Small Cell Lung Cancer (SCLC)	1
2	Terminated	Treatment	A Combination of Adoptive T Cell Therapy and Ipilimumab Could Increase the Proportion of CR Patients, and Durability of Response	1
2	Terminated	Treatment	HER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma	1
2	Terminated	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Terminated	Treatment	Malignant Neoplasm of Female Breast / Malignant Neoplasm of Stomach / Ovarian Cancer	1
2	Terminated	Treatment	Melanoma	2
2	Terminated	Treatment	Melanoma, Malignant	1
2	Terminated	Treatment	Metastatic Melanoma	2
2	Terminated	Treatment	Prostate Cancer	1
2	Terminated	Treatment	Prostatic Neoplasms	1
2	Terminated	Treatment	Recurrent Melanoma / Stage IV Skin Melanoma	1
2	Terminated	Treatment	Synovial Sarcoma	1
2	Withdrawn	Treatment	Basal Cell Nevus Syndrome	1
2	Withdrawn	Treatment	Cervical Carcinoma / Esophageal Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma	1
2	Withdrawn	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
2	Withdrawn	Treatment	Malignant Melanoma of Skin / Melanoma (Skin)	1
2	Withdrawn	Treatment	Melanoma Stage Iii / Melanoma Stage Iv	1
2	Withdrawn	Treatment	Melanoma / Metastatic Melanoma	1
2	Withdrawn	Treatment	Neuroendocrine Carcinoma of the Skin	1
2	Withdrawn	Treatment	Prostate Cancer	1
2, 3	Active Not Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v7	1
2, 3	Not Yet Recruiting	Treatment	Gliosarcoma / MGMT-unmethylated Glioblastoma	1
2, 3	Recruiting	Treatment	Adenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Clinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IVA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IVA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IVA Gastroesophageal Junction Adenocarcinoma AJCC v8	1
2, 3	Recruiting	Treatment	Metastatic Hormone-sensitive Prostate Cancer	1
2, 3	Suspended	Treatment	Metastatic Cutaneous Melanoma / Recurrent Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma	1
3	Active Not Recruiting	Treatment	Advanced Non Small Cell Lung Cancer	1
3	Active Not Recruiting	Treatment	Advanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
3	Active Not Recruiting	Treatment	Gastroesophageal Junction Cancer / Malignant Neoplasm of Stomach	1
3	Active Not Recruiting	Treatment	Head and Neck Carcinoma	1
3	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	3
3	Active Not Recruiting	Treatment	Lung Cancers	1
3	Active Not Recruiting	Treatment	Melanoma	4
3	Active Not Recruiting	Treatment	Melanoma of Unknown Primary / Recurrent Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
3	Active Not Recruiting	Treatment	Mesothelioma	1
3	Active Not Recruiting	Treatment	Metastatic Cutaneous Melanoma / Metastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Cutaneous Melanoma / Recurrent Non-Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IVA Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVB Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVC Mucosal Melanoma of the Head and Neck AJCC v7	1
3	Active Not Recruiting	Treatment	Metastatic Melanoma	1
3	Active Not Recruiting	Treatment	Recurrent Glioblastoma	1
3	Active Not Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v7	1
3	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	1
3	Active Not Recruiting	Treatment	Unresectable or Metastatic Melanoma	1
3	Active Not Recruiting	Treatment	Various Advanced Cancer	1
3	Completed	Treatment	High Risk Stage III Melanoma	1
3	Completed	Treatment	Lung Cancer - Non Small Cell Squamous	1
3	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
3	Completed	Treatment	Melanoma	5
3	Completed	Treatment	Melanoma / Metastases	1
3	Completed	Treatment	Prostate Cancer	2
3	Completed	Treatment	Small Cell Lung Cancer (SCLC)	1
3	Not Yet Recruiting	Treatment	Liver Cancer	1
3	Not Yet Recruiting	Treatment	Renal Cancers / Renal Cell Carcinoma Metastatic / Synchronous Neoplasm	1
3	Recruiting	Treatment	Adenocarcinoma of the Lung / ALK wt Allele / EGFR wt Allele / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Non-Small Cell Carcinoma / Malignant Neoplasms of Respiratory and Intrathoracic Organs / RET gene mutation / ROS1 Gene Mutation / Stage IV Lung Cancer AJCC v8	1
3	Recruiting	Treatment	Advanced Solid Tumors / Cancer, Anal / Cancer, Bladder / Cholangiocarcinomas / Colorectal Cancers / Hepatocellular,Carcinoma / HNSCC / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Melanoma / Renal Cancers	1
3	Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Malignant Neoplasm in Lymph Node / Metastatic Malignant Neoplasm in the Bone / Metastatic Malignant Neoplasm in the Soft Tissues / Metastatic Malignant Neoplasm in the Viscera / Sarcomatoid Renal Cell Carcinoma / Stage IV Renal Cell Cancer AJCC v8	1
3	Recruiting	Treatment	Head and Neck Carcinoma	1
3	Recruiting	Treatment	Hepatocellular,Carcinoma	1
3	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	3
3	Recruiting	Treatment	Metastatic Colorectal Cancer (MCRC)	1
3	Recruiting	Treatment	Metastatic Melanoma	1
3	Recruiting	Treatment	Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Cutaneous Melanoma	1
3	Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
3	Recruiting	Treatment	Renal Cell Adenocarcinoma	3
3	Recruiting	Treatment	Tumors Metastatic to Brain	1
3	Recruiting	Treatment	Urothelial Cancer	1
3	Withdrawn	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
4	Active Not Recruiting	Treatment	Lung Cancers	1
4	Active Not Recruiting	Treatment	Melanoma, Malignant	1
4	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	1
4	Terminated	Treatment	Metastatic Melanoma	1
Not Available	Active Not Recruiting	Not Available	Adenocarcinomas	1
Not Available	Active Not Recruiting	Not Available	Melanoma	1
Not Available	Active Not Recruiting	Treatment	Breast Cancer	1
Not Available	Active Not Recruiting	Treatment	Metastatic Melanoma	1
Not Available	Completed	Not Available	Advanced Melanoma	1
Not Available	Completed	Not Available	Melanoma	3
Not Available	Completed	Treatment	Previously Untreated and Histologically Confirmed Stage III (Unresectable) or Stage IV Melanoma	1
Not Available	No Longer Available	Not Available	Glioblastomas / Glioma of Brain	1
Not Available	No Longer Available	Not Available	Melanoma	1
Not Available	No Longer Available	Not Available	Melanoma, Malignant	1
Not Available	Not Yet Recruiting	Not Available	Lung Cancers / Melanoma / Renal Cancers	1
Not Available	Not Yet Recruiting	Other	Cervix Cancer	1
Not Available	Recruiting	Not Available	Carcinoma, Colorectal / Lung Cancer Non-Small Cell Cancer (NSCLC)	1
Not Available	Recruiting	Not Available	Healthy Volunteers / Immunotherapy / Melanoma / Metagenome / Microbiome	1
Not Available	Recruiting	Not Available	Immunotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Metagenome / Microbiome	1
Not Available	Recruiting	Not Available	Immunotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoantigens / Neoepitopes / Next Generation Sequencing (NGS) / Personalized Neoantigen Cancer Vaccine	1
Not Available	Recruiting	Not Available	Melanoma	2
Not Available	Recruiting	Not Available	Metastatic Cancers	1
Not Available	Recruiting	Not Available	Tumors Metastatic to Brain	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage forms

Form	Route	Strength
Injection	Intravenous	5 mg/1mL
Liquid	Intravenous	5 mg

Prices

Not Available

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
Unlock Additional Data
CA2381770	No	2007-08-07	2020-08-08

Additional Data Available

Filed On
Filed On
The date on which a patent was filed with the relevant government.
Learn more

Properties

State

Liquid

Experimental Properties

Property	Value	Source
melting point (°C)	80-90 ºC (based on IgG properties)	McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282
boiling point (°C)	Fab and Fc domains denaturates at 60 and 70 ºC respectively	Arnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility	50 mg/ml	Human IgG purified. Product Information
isoelectric point	6.1-8.5	Agrisera Information about IgG antibodies.

Taxonomy

Description

Not Available

Kingdom

Organic Compounds

Super Class

Organic Acids

Class

Carboxylic Acids and Derivatives

Sub Class

Amino Acids, Peptides, and Analogues

Direct Parent

Peptides

Alternative Parents

Not Available

Substituents

Not Available

Molecular Framework

Not Available

External Descriptors

Not Available

×

Unlock Data

There is additional data available for commercial users including Adverse Effects, Contraindications, and Blackbox Warnings. Contact us to learn more about these and other features.

Learn more

Drug created on March 19, 2008 10:16 / Updated on July 03, 2020 08:33