You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameIpilimumab
Accession NumberDB06186
TypeBiotech
GroupsApproved
DescriptionIpilimumab, a recombinant human monoclonal antibody (IgG1 kappa immunoglobin), is an antineoplastic agent developed by Bristol-Myers Squibb and Medarex for the treatment of unresectable or metastatic melanoma in adults. Ipilimumab received FDA approved on March 25, 2011. In October 2015, the FDA approved expanded the indications for Ipilimumab, allowing it to be used to reduce the risk of the deadly skin cancer returning after surgery.
Protein structureDb06186
Related Articles
Protein chemical formulaC6572H10126N1734O2080S40
Protein average weight148000.0 Da
Sequences
>Ipilimumab heavy chain (patent appl. US20150283234) 
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
>Ipilimumab light chain 
EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
MDX-010
MDX-101
MDX-CTLA-4
MOAB-CTLA-4
External IDs Not Available
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
YervoyLiquid5 mgIntravenousBristol Myers Squibb2012-03-08Not applicableCanada
YervoyInjection5 mg/mLIntravenousE.R. Squibb & Sons, L.L.C.2011-03-25Not applicableUs
YervoyInjection5 mg/mLIntravenousE.R. Squibb & Sons, L.L.C.2011-03-25Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNII6T8C155666
CAS number477202-00-9
Pharmacology
IndicationIpilimumab is indicated for the treatment of unresectable or metastatic melanoma in adults. It is also used to reduce the risk of the deadly skin cancer returning after surgery.
Structured Indications
PharmacodynamicsThe pharmacodynamics of Ipilimumab are not completely understood. In melanoma patients receiving Ipilimumab, the mean peripheral blood absolute lymphocyte counts (ALC) increased throughout the induction dosing period. This increase occurred in a dose-dependent fashion in Phase 2 studies. Ipilimumab given with or without gp100 at 3 mg/kg increased ALC throughout the induction dosing period, but no meaningful change in ALC occurred in the control group who received an investigational peptide vaccine alone. Furthermore, ipilimumab binds to CTLA-4 with high affinity (Kd = 5.24 ± 3.62 nM). As a result, ligands CD80 and CD86 are blocked from binding to CTLA-4 with a minimum EC50 value of 0.2 μg/mL.
Mechanism of actionIpilimumab is a fully human IgG1κ antibody that binds to CTLA-4 (cytotoxic T lymphocyte-associated antigen 4), a molecule on T-cells that is indicated for unresectable or metastatic melanoma. The absence or presence of CTLA-4 can augment or suppress the immune system's T-cell response in fighting disease. Ipilimumab is designed to block the activity of CTLA-4, thereby sustaining an active immune response in its attack on cancer cells. The proposed mechanism of action is indirect, and may be through T-cell - mediated anti-tumor immune responses.
TargetKindPharmacological actionActionsOrganismUniProt ID
Cytotoxic T-lymphocyte protein 4ProteinyesNot AvailableHumanP16410 details
Related Articles
AbsorptionIn one pharmacokinetic study of patients with unresectable or metastatic melanoma peak concentrations, trough concentrations, and area under the curve (AUC) were found to be dose proportional in the dosage range examined (0.3, 3, or 10mg/kg every 3 weeks for four doses).
Volume of distribution

Volume of distribution at steady state = 7.21 L

Protein bindingNot Available
Metabolism

The metabolism of ipilimumab does not involve the cytochrome P450 enzyme system. Because ipilimumab is a protein it is expected to be degraded into small peptides and amino acids by proteolytic enzymes.

Route of eliminationNot Available
Half lifeTerminal Elimination Half-life: 14.7 -15.4 days
Clearance

Clearance was measured to be 15.3mL/hr-16.8 mL/hr.

In one pharmacokinetic study examining ipilimumab administered every 3 weeks, clearance was found to be time invariant. Minimal systemic accumulation was observed (accumulation index of 1.5 fold or less).
Steady state concentrations was reached by the third dose.

Clearance will increase with increasing body weight; however, no dose adjustment is needed if administration occurs on a mg/kg basis. The following had no clinically meaningful influence on clearance: Age (range 26-86 years), gender, creatinine clearance (if ≥29ml/min), baseline AST, total bilirubin, ALT levels, concomitant use of budesonide, performance status, HLA-A2*0201 status, positive anti-ipilimumab antibody status, prior use of systemic anticancer therapy, baseline lactate dehydrogenase levels.

ToxicityTherapy with Ipilimumab can result in severe and fatal immune reactions due to T-cell proliferation and activation. These reactions may occur in multiple organ systems, but common reactions include enterecolitis, dermatitis (including toxic necrolysis), neuropathy, and endocrinopathy. Patients should be assessed for signs and symptoms of enterocolitis (diarrhea, abdominal pain, mucus/blood in stool), bowel perforation (petitoneal signs and ileus), hepatitis, dermatitis (rash and pruritus), motor or sensory neuropathy (unilateral/bilateral weakness, sensory alterations, or paresthesia) , hypophysitis/adrenal insufficiency including adrenal crisis/hyper- or hypothyroidism (fatigue, mental status change, abdominal pain, unusual bowel habits, hypotension) and should have liver function tests and thyroid function tests performed at baseline and prior to each dose. Typically immune mediated adverse reactions manifest during therapy, however, a minority of reactions occurred after discontinuation of ipilimumab. In one study of neuropathies, one case of fatal Guillain-Barré syndrome occurred, and once case of severe peripheral neuropathy (Grade 3) was reported. During clinical development of ipilimumab additional cases of Guillain-Barré and myasthenia gravis have been reported. In severe neuropathy, permanently discontinue ipilimumab, and initiate 1-2mg/kd/day of prednisone or equivalent. In one study, severe or potentially fatal dermatitis (eg, Steven-Johnsons syndrome (SJS) or toxic epidermal necrolysis (TEN)) occured in 2.5% (n=13). The median time of onset of moderate to potentially fatal dermatitis was 3.1 weeks (up to 17.3 weeks). Treatment of 54% of severe dermatitis cases (n=7) involved high dose topical corticosteriods. 6 patients had complete resolution in up to 15.6 weeks. Permanently discontinue ipilimumab in patients with SJS or TEN, and withhold the dose in patients with moderate to severe signs and symptoms. Mild- moderate dermatitis (localized rash and pruritus) may be treated symptomatically. If no improvement is seen in 1 week administer topical or systemic corticosteroids. In one study of endocrinopathies, severe to life threatening endocrinopathies occurred in 1.8% (n=9) of patients, with all 9 patients having hyopituitarism and some having adrenal insufficiency, hypogonadism, and hypothyroidism. Six of the 9 patients were hospitalized. Moderate endocrinopathies occurred in 2.3% of patients (n=12) and required hormone replacement or medical intervention. The median time of onset was 11 weeks. In symptomatic patients, withhold ipilimumab, and initiate 1-2mg/kd/day of prednisone or equivalent and appropriate hormone replacement therapy. In one study of enterocolitis in 511 patients, diarrhea of ≥7 stools above baseline, fever, ileus and peritoneal signs (Grade 3-5, severe, potentially fatal enterocolitis) occured in 7% (n=34) of patients treated with ipilimumab. Diarrhea of up to 6 stools above baseline, abdominal pain, mucus or blood in stool (Grade 2, moderate enterocolitis) occurred in 5% of patients (n=28). Intestinal perforation occurred in 1% (n=5). Death as a result of complications occurred in 0.8% (n=4). Hospitalization for severe enterocolitis occurred in 5% (n=26). Grade 3-5 enterocolitis had a median time of onset of 7.4 weeks (with a range of 1.6-13.4 weeks). Grade 2 entercolitis had a median time of onset of 6.3 weeks (with a range of 0.3- 18.9 weeks). Treatment of 85% (n=29) of patients with Grade 3-5 enterocolitis (n=34) included high dose corticosteroids (≥40mg/day prednisone equivalent). Median dose used was 80mg/day of prednisone/equivalent for a median duration of 2.3 weeks (up to 13.9 weeks). Of the 34 patients, 74% experienced complete resolution, 3% progressed to Grade 2 severity, and 24% exhibited no improvement. In treatment of 28 patients with a Grade 2 enterocolitis: 25% received high dose corticosteroids for a median of 10 days; 29% of patients received a non-high dose of corticosteroids (<40mg/day of prednisone/equivalent) for a median duration of 5.1 weeks; 46% did not receive systemic corticosteroids. Of the 28 patients, 79% of patients experienced complete resolution, 11% improved in severity, 11% exhibited no improvement. In patients with severe enterocolitis, permanently discontinue ipilimumab, and initiate 1-2 mg/kd/day of prednisone or an equivalent. Once patient improvement to Grade 1 or less is seen, taper the corticosteroid over at least one month. In patients with moderate enterocolitis, hold dose of ipilimumab, and initiate 0.5 mg/kd/day of prednisone or an equivalent. In another study examining immune mediated hepatitis, AST or ALT elevation of ≥3 times the upper limit of normal (ULN) (severe and potentially fatal hepatotoxicity) was seen in 2% (n=8) of patients on ipilimumab. Fatal hepatic failure occurred in 0.2%. Hospitalization occurred in 0.4%. Additionally, moderate hepatotoxicity (2.5xULN >ALT or AST> 5xULN, or 1.5xULN>bilirubin>3xULN ) occurred in 2.5% (n=13). In Grade 3-5 hepatotoxicity, permanently discontinue ipilimumab, and initiate 1-2mg/kd/day of prednisone or equivalent. Once LFT show sustained improvement taper corticosteroid over 1 month. In Grade 2 hepatotoxicity, withhold ipilimumab. In pregnancy, use only if potential benefit justifies potential risk to fetus (Category C). In studies done in monkeys, severe toxicities were observed including abortion, stillbirth, low birth weight and infant mortality. Additionally, ipilimumab has the potential to cross the placental barrier, and it is unknown if secretion into breast milk occurs. No studies have been performed to study carcinogenesis, mutagenesis, and impairment of fertility.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Ipilimumab.Approved
BelimumabThe risk or severity of adverse effects can be increased when Ipilimumab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Ipilimumab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Ipilimumab.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Ipilimumab.Approved, Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Ipilimumab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Ipilimumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Ipilimumab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Ipilimumab.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Ipilimumab.Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Ipilimumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Ipilimumab.Investigational
OleandrinAnvirzel may decrease the cardiotoxic activities of Ipilimumab.Experimental
OuabainOuabain may decrease the cardiotoxic activities of Ipilimumab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Ipilimumab.Approved, Vet Approved
RindopepimutThe therapeutic efficacy of CDX-110 can be decreased when used in combination with Ipilimumab.Investigational
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Ipilimumab.Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Ipilimumab.Approved, Investigational
VemurafenibIpilimumab may increase the hepatotoxic activities of Vemurafenib.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Ribas A: Tumor immunotherapy directed at PD-1. N Engl J Med. 2012 Jun 28;366(26):2517-9. doi: 10.1056/NEJMe1205943. Epub 2012 Jun 2. [PubMed:22658126 ]
External Links
ATC CodesL01XC11
AHFS Codes
  • 10:00
PDB EntriesNot Available
FDA labelDownload (374 KB)
MSDSDownload (479 KB)
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentMelanoma1
0RecruitingTreatmentCarcinoma of the Prostate1
0RecruitingTreatmentKidney Cancer1
0TerminatedTreatmentCiliary Body and Choroid Melanoma, Medium/Large Size / Ciliary Body and Choroid Melanoma, Small Size / Extraocular Extension Melanoma / Iris Melanoma / Liver Metastases / Metastatic Intraocular Melanoma / Recurrent Intraocular Melanoma / Stage IV Intraocular Melanoma1
1Active Not RecruitingBasic ScienceAdvanced Melanoma / Metastatic Melanoma1
1Active Not RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Chronic Lymphocytic Leukaemia (CLL) / Lymphoma, B Cell1
1Active Not RecruitingTreatmentAcute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Chronic Myelomonocytic Leukemia / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes1
1Active Not RecruitingTreatmentAdvanced Cancers1
1Active Not RecruitingTreatmentCD20 Positive / Recurrent B-Cell Non-Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma1
1Active Not RecruitingTreatmentCarcinoma of the Prostate / Castrate Resistant Prostate Cancer (CRPC)1
1Active Not RecruitingTreatmentCervical Adenocarcinoma / Cervical Adenosquamous Carcinoma / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Positive Para-Aortic Lymph Node / Positive Pelvic Lymph Node / Stage IB Cervical Cancer / Stage IB2 Cervical Cancer / Stage II Cervical Cancer / Stage IIA Cervical Cancer / Stage IIB Cervical Cancer / Stage IIIB Cervical Cancer / Stage IVA Cervical Cancer1
1Active Not RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Carcinoma (RCC)1
1Active Not RecruitingTreatmentDuct Cell Adenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
1Active Not RecruitingTreatmentMalignant Melanoma1
1Active Not RecruitingTreatmentMelanoma2
1Active Not RecruitingTreatmentMelanoma (Skin)1
1Active Not RecruitingTreatmentMelanoma / Skin Cancers1
1Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)2
1Active Not RecruitingTreatmentRecurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain1
1Active Not RecruitingTreatmentRecurrent Prostate Carcinoma / Stage IV Prostate Cancer1
1Active Not RecruitingTreatmentStage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma1
1Active Not RecruitingTreatmentUnresectable Melanoma1
1CompletedTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Childhood Myelodysplastic Syndromes / Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Disseminated Neuroblastoma / Neoplasms, Malignant / Ovarian Choriocarcinoma / Ovarian Embryonal Carcinoma / Ovarian Immature Teratoma / Ovarian Mature Teratoma / Ovarian Mixed Germ Cell Tumor / Ovarian Monodermal and Highly Specialized Teratoma / Ovarian Polyembryoma / Ovarian Yolk Sac Tumor / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Mantle Cell Lymphoma / Recurrent Neuroblastoma / Recurrent Ovarian Epithelial Cancer / Recurrent Ovarian Germ Cell Tumor / Refractory Chronic Lymphocytic Leukemia / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage II Ovarian Epithelial Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Multiple Myeloma / Stage III Ovarian Epithelial Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Stage IV Ovarian Epithelial Cancer / Testicular Choriocarcinoma / Testicular Choriocarcinoma and Embryonal Carcinoma / Testicular Choriocarcinoma and Seminoma / Testicular Choriocarcinoma and Teratoma / Testicular Choriocarcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma / Testicular Embryonal Carcinoma and Seminoma / Testicular Embryonal Carcinoma and Teratoma / Testicular Embryonal Carcinoma and Teratoma With Seminoma / Testicular Embryonal Carcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma and Yolk Sac Tumor With Seminoma / Testicular Teratoma / Testicular Yolk Sac Tumor / Testicular Yolk Sac Tumor and Teratoma / Testicular Yolk Sac Tumor and Teratoma With Seminoma1
1CompletedTreatmentAdvanced Melanoma2
1CompletedTreatmentAdverse Effect of Radiation Therapy / Effects of Immunotherapy / Melanoma1
1CompletedTreatmentCANCER,NOS1
1CompletedTreatmentCancer, Breast / Invasive Adenocarcinoma of the Breast1
1CompletedTreatmentCarcinoma, Urothelial / Transitional Cell Carcinoma1
1CompletedTreatmentGastrointestinal Stromal Tumors / Stage III Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma1
1CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)1
1CompletedTreatmentLymphoma NOS1
1CompletedTreatmentLymphoma NOS / Neuroblastomas / Sarcomas / Wilms' tumor1
1CompletedTreatmentMalignant Melanoma1
1CompletedTreatmentMelanoma2
1CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1CompletedTreatmentPancreatic Cancers1
1CompletedTreatmentProstatic Neoplasms1
1CompletedTreatmentSolid Tumours1
1Not Yet RecruitingTreatmentAcute Myeloid Leukemia and Myelodysplastic Syndrome1
1Not Yet RecruitingTreatmentB Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL11
1Not Yet RecruitingTreatmentCarcinoma of the Prostate / Melanoma / Pancreatic Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
1Not Yet RecruitingTreatmentChimerism / Hematopoietic Cell Transplantation Recipient / Myelodysplastic Syndrome With Excess Blasts-1 / Myelodysplastic Syndrome With Excess Blasts-2 / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia1
1Not Yet RecruitingTreatmentEsophageal Cancers / Gastric Cancers / GastroEsophageal Cancer1
1Not Yet RecruitingTreatmentKidney Cancer1
1Not Yet RecruitingTreatmentMelanoma and Other Malignant Neoplasms of Skin1
1Not Yet RecruitingTreatmentMelanoma / Sarcomas1
1Not Yet RecruitingTreatmentSmall Cell Lung Cancer (SCLC)1
1Not Yet RecruitingTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
1RecruitingBasic ScienceMelanoma1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingOtherMelanoma1
1RecruitingTreatmentAdult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Unresectable Solid Neoplasm1
1RecruitingTreatmentAdvanced Cancers1
1RecruitingTreatmentAdvanced Cancers / Melanoma1
1RecruitingTreatmentAdvanced Tumor / Metastatic Tumors1
1RecruitingTreatmentBreast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Unresectable Solid Neoplasm1
1RecruitingTreatmentCancer, Advanced1
1RecruitingTreatmentCancer, Breast / Cancers / Head and Neck Cancers / Lymphoma NOS / Melanoma / Triple-Negative Breast Cancer (TNBC)1
1RecruitingTreatmentCarcinoma of the Prostate1
1RecruitingTreatmentClassical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Hodgkin Lymphoma1
1RecruitingTreatmentClear Cell Renal Cell Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Solid Neoplasms / Stage III Bladder Adenocarcinoma / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Urothelial Carcinoma / Stage III Renal Cell Cancer / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Urethral Cancer / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Urothelial Carcinoma / Stage IV Renal Cell Cancer / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Urethral Cancer / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma1
1RecruitingTreatmentGlioblastomas / Gliosarcoma1
1RecruitingTreatmentLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
1RecruitingTreatmentMalignant Melanoma1
1RecruitingTreatmentMelanoma2
1RecruitingTreatmentMetastatic Melanoma2
1RecruitingTreatmentMyeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Lymphocytic Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma1
1RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC) / Small Cell Lung Cancer (SCLC) / Tumors, Solid1
1RecruitingTreatmentSolid Cancers1
1SuspendedTreatmentBRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1TerminatedTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Recurrent Melanoma / Recurrent Non-small Cell Lung Cancer / Recurrent Ovarian Epithelial Cancer / Stage IV Melanoma / Stage IV Non-Small Cell Lung Cancer1
1TerminatedTreatmentCarcinoma of the Prostate1
1TerminatedTreatmentMalignant Melanoma1
1TerminatedTreatmentMelanoma1
1TerminatedTreatmentMetastatic Melanoma1
1TerminatedTreatmentNewly Diagnosed Melanoma Metastases in the Brain and Spine1
1TerminatedTreatmentStage III or IV Melanoma1
1TerminatedTreatmentUnresectable or Metastatic Melanoma1
1WithdrawnTreatmentLeukemia,Myeloid, Chronic1
1WithdrawnTreatmentMelanoma1
1, 2Active Not RecruitingTreatmentCarcinoma of the Prostate1
1, 2Active Not RecruitingTreatmentMalignant Melanoma1
1, 2Active Not RecruitingTreatmentMelanoma1
1, 2Active Not RecruitingTreatmentMetastatic Melanoma2
1, 2Active Not RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
1, 2CompletedTreatmentCarcinoma of the Prostate / Neoplasms Metastasis1
1, 2CompletedTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma1
1, 2CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)1
1, 2CompletedTreatmentMelanoma1
1, 2CompletedTreatmentMetastatic Melanoma1
1, 2CompletedTreatmentRecurrent Melanoma / Stage IV Melanoma1
1, 2CompletedTreatmentUnresectable Stage III or IV Malignant Melanoma1
1, 2Not Yet RecruitingTreatmentCancer, Advanced1
1, 2Not Yet RecruitingTreatmentImmunotherapy / Neoplasms, Head and Neck1
1, 2Not Yet RecruitingTreatmentMetastatic Cancers1
1, 2Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingPreventionStage IIIC Skin Melanoma / Stage IV Skin Melanoma1
1, 2RecruitingTreatmentAdvanced or Metastatic Solid Tumors1
1, 2RecruitingTreatmentCANCER,NOS1
1, 2RecruitingTreatmentCancers1
1, 2RecruitingTreatmentCarcinoma of the Prostate1
1, 2RecruitingTreatmentChildhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Hodgkin Lymphoma / Refractory Non-Hodgkin's lymphoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
1, 2RecruitingTreatmentExtensive-Stage Small Cell Lung Cancer / Small Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentHepatic Metastases / Uveal Melanoma1
1, 2RecruitingTreatmentHepatocellular Carcinomas1
1, 2RecruitingTreatmentLiver Cancer / Lung Cancers1
1, 2RecruitingTreatmentLymphoma NOS / Multiple Myeloma (MM)1
1, 2RecruitingTreatmentLymphoma NOS / Tumors, Solid1
1, 2RecruitingTreatmentMelanoma1
1, 2RecruitingTreatmentMelanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma1
1, 2RecruitingTreatmentMelanoma / Renal Cell Carcinoma (RCC)1
1, 2RecruitingTreatmentMetastatic Brain Cancer1
1, 2RecruitingTreatmentMetastatic Melanoma2
1, 2RecruitingTreatmentMetastatic Melanoma / Stage III Melanoma / Stage IV Melanoma1
1, 2RecruitingTreatmentStage III/IV Melanoma1
1, 2RecruitingTreatmentVarious Advanced Cancer1
1, 2SuspendedTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Colon Cancer / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Melanoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Rectal Cancer / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentAdult Grade III Lymphomatoid Granulomatosis / B-Cell Chronic Lymphocytic Leukemia / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentMelanoma1
1, 2TerminatedTreatmentUnresectable Stage III or Stage IV Melanoma1
1, 2WithdrawnTreatmentMelanoma2
1, 2WithdrawnTreatmentMetastatic Melanoma1
2Active Not RecruitingTreatmentAdenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer1
2Active Not RecruitingTreatmentAdvanced or Metastatic Melanoma1
2Active Not RecruitingTreatmentCancer, Ovarian / Platinum-sensitive Ovarian Cancer, Second-line, Third-line, or Fourth-line1
2Active Not RecruitingTreatmentCarcinoma of the Prostate1
2Active Not RecruitingTreatmentCarcinoma of the Prostate / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma1
2Active Not RecruitingTreatmentCarcinoma, Urothelial1
2Active Not RecruitingTreatmentCervical Adenocarcinoma / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Human Papillomavirus Infections / Recurrent Cervical Carcinoma / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer1
2Active Not RecruitingTreatmentLeukemias / Myelodysplastic Syndrome1
2Active Not RecruitingTreatmentLiver Metastases / Lung Metastases / Recurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentMalignant Melanoma1
2Active Not RecruitingTreatmentMalignant Melanoma Stage III / Malignant Melanoma Stage IV1
2Active Not RecruitingTreatmentMelanoma2
2Active Not RecruitingTreatmentMelanoma / Metastases, Brain1
2Active Not RecruitingTreatmentMesothelioma1
2Active Not RecruitingTreatmentMetastases, Brain / Metastatic Melanoma1
2Active Not RecruitingTreatmentMetastatic Castration Sensitive Prostate Cancer1
2Active Not RecruitingTreatmentMetastatic Melanoma / Mucosal Melanoma / Recurrent Melanoma / Stage IV Skin Melanoma / Stage IV Uveal Melanoma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Recurrent Melanoma / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2Active Not RecruitingTreatmentMetastatic Melanoma / Unresectable Melanoma1
2Active Not RecruitingTreatmentNon Small Cell Lung Cancer (NSCLC)1
2Active Not RecruitingTreatmentRecurrent Melanoma / Stage IIIA Melanoma / Stage IIIB Melanoma / Stage IIIC Melanoma / Stage IV Melanoma1
2Active Not RecruitingTreatmentRecurrent Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma1
2Active Not RecruitingTreatmentUntreated Stage III Melanoma or Stage IV Melanoma1
2CompletedTreatmentAdenocarcinomas / Cancer, Breast1
2CompletedTreatmentBrain Metastasis / Melanoma1
2CompletedTreatmentCarcinoma of the Prostate3
2CompletedTreatmentExtensive Stage Small Cell Lung Cancer1
2CompletedTreatmentIn-transit Metastases Melanoma Stage IIIB and IIIC1
2CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)2
2CompletedTreatmentKidney Cancer1
2CompletedTreatmentLocally Advanced (Unresectable) or Metastatic Adenocarcinoma of the Gastric and Gastro-esophageal Junction1
2CompletedTreatmentLung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC) / Small Cell Lung Cancer (SCLC)1
2CompletedTreatmentMalignant Melanoma2
2CompletedTreatmentMelanoma9
2CompletedTreatmentMelanoma (Skin)1
2CompletedTreatmentMetastatic Malignant Melanoma1
2CompletedTreatmentMetastatic Melanoma2
2CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentOcular Melanoma1
2CompletedTreatmentPancreatic Cancers1
2CompletedTreatmentProstatic Neoplasms1
2Not Yet RecruitingTreatmentAcral lentiginous melanoma / Mucosal Melanoma1
2Not Yet RecruitingTreatmentCarcinoma of the Prostate1
2Not Yet RecruitingTreatmentChondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Osteosarcomas / Sarcoma, Bone / Soft Tissue Sarcoma (STS)1
2Not Yet RecruitingTreatmentClear Cell Metastatic Renal Cell Carcinoma1
2Not Yet RecruitingTreatmentGastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours1
2Not Yet RecruitingTreatmentHER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma1
2Not Yet RecruitingTreatmentMicrosatellite Stable Colorectal Cancer / MSI High Colorectal Cancer / Pancreatic Cancers1
2Not Yet RecruitingTreatmentMelanoma2
2Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC) / Small Cell Lung Carcinoma1
2Not Yet RecruitingTreatmentStage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2Not Yet RecruitingTreatmentUveal Melanoma1
2RecruitingTreatmentAcinar Cell Carcinoma / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Cervical Adenocarcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Endometrial Adenocarcinomas / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumors (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metastatic Malignant Neoplasm of Unknown Primary Origin / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Squamous Cell Carcinoma1
2RecruitingTreatmentCancer, Advanced2
2RecruitingTreatmentCarcinoma of the Prostate3
2RecruitingTreatmentClear-cell Metastatic Renal Cell Carcinoma / Renal Cell Carcinoma (RCC)1
2RecruitingTreatmentColon Carcinoma1
2RecruitingTreatmentGastric cancer stage IV1
2RecruitingTreatmentGastrointestinal Stromal Tumors1
2RecruitingTreatmentHead and Neck Cancers2
2RecruitingTreatmentKidney Cancer / Kidney Cancer Metastatic / Kidney Cancer, Stage IV1
2RecruitingTreatmentLeptomeningeal Carcinomatosis / Melanoma1
2RecruitingTreatmentLimited Stage Small Cell Lung Cancer / Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentMSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer1
2RecruitingTreatmentMalignant Melanoma1
2RecruitingTreatmentMalignant Melanoma Stage III1
2RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)1
2RecruitingTreatmentMelanoma5
2RecruitingTreatmentMelanoma / Metastases, Brain1
2RecruitingTreatmentMelanoma / Oligometastatic Melanoma1
2RecruitingTreatmentMelanoma / Uveal Melanoma1
2RecruitingTreatmentMetastatic Melanoma2
2RecruitingTreatmentMetastatic Melanoma / Stage IV Melanoma1
2RecruitingTreatmentNasopharyngeal Carcinoma1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin1
2RecruitingTreatmentNeuroendocrine Carcinoma of the Skin / Skin Cancers1
2RecruitingTreatmentNon-Small-Cell Lung Cancer (NSCLC)1
2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)2
2RecruitingTreatmentPancreatic Cancer Metastatic1
2RecruitingTreatmentProstatic Neoplasms1
2RecruitingTreatmentRecurrent Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma1
2RecruitingTreatmentRecurrent Melanoma / Stage IV Skin Melanoma1
2RecruitingTreatmentRenal Cell Carcinoma (RCC)1
2RecruitingTreatmentUveal Melanoma1
2SuspendedTreatmentMetastatic Pancreatic Adenocarcinoma1
2SuspendedTreatmentRecurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Soft Tissue Sarcoma / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Soft Tissue Sarcoma / Stage IVA Bone Sarcoma / Stage IVB Bone Sarcoma1
2SuspendedTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2SuspendedTreatmentUterine Corpus Leiomyosarcoma1
2TerminatedTreatmentLung Cancer - Non Small Cell1
2TerminatedTreatmentMalignant Melanoma1
2TerminatedTreatmentMelanoma1
2TerminatedTreatmentMetastatic Melanoma2
2Unknown StatusTreatmentMalignant Melanoma, Metastatic1
2WithdrawnTreatmentCarcinoma of the Prostate1
2WithdrawnTreatmentMelanoma (Skin)1
2WithdrawnTreatmentNeuroendocrine Carcinoma of the Skin1
2, 3RecruitingTreatmentRecurrent Melanoma of the Skin / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2, 3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma1
3Active Not RecruitingTreatmentAdvanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma1
3Active Not RecruitingTreatmentHigh Risk Stage III Melanoma1
3Active Not RecruitingTreatmentLung Cancer (NSCLC)1
3Active Not RecruitingTreatmentLung Cancer - Non Small Cell / Lung Cancer - Non Small Cell (Squamous)1
3Active Not RecruitingTreatmentMelanoma4
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentRecurrent Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma1
3Active Not RecruitingTreatmentSmall Cell Lung Carcinoma1
3Active Not RecruitingTreatmentUnresectable or Metastatic Melanoma1
3CompletedTreatmentCarcinoma of the Prostate2
3CompletedTreatmentMelanoma1
3CompletedTreatmentMelanoma / Metastases1
3RecruitingTreatmentBRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
3RecruitingTreatmentGastric Cancers / Gastroesophageal Junction Cancer1
3RecruitingTreatmentHead and Neck Cancers1
3RecruitingTreatmentLung Cancers2
3RecruitingTreatmentMelanoma4
3RecruitingTreatmentMesothelioma1
3RecruitingTreatmentMetastases, Brain1
3RecruitingTreatmentMetastatic Melanoma1
3RecruitingTreatmentMetastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Cutaneous Melanoma / Stage III Mucosal Melanoma of the Head and Neck / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck / Stages III Skin Melanoma1
3RecruitingTreatmentNon Small Cell Lung Cancer (NSCLC)1
3RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)2
3RecruitingTreatmentOcular Melanoma1
3RecruitingTreatmentRecurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma1
3RecruitingTreatmentUrothelial Cancer1
4Active Not RecruitingTreatmentMalignant Melanoma1
4RecruitingTreatmentRenal Cell Carcinoma (RCC)1
4TerminatedTreatmentMetastatic Melanoma1
Not AvailableActive Not RecruitingNot AvailableMelanoma1
Not AvailableActive Not RecruitingTreatmentMelanoma1
Not AvailableActive Not RecruitingTreatmentMetastatic Melanoma1
Not AvailableActive Not RecruitingTreatmentPreviously Untreated and Histologically Confirmed Stage III (Unresectable) or Stage IV Melanoma1
Not AvailableCompletedNot AvailableAdvanced Melanoma1
Not AvailableCompletedNot AvailableMelanoma1
Not AvailableNo Longer AvailableNot AvailableMalignant Melanoma1
Not AvailableNo Longer AvailableNot AvailableMelanoma1
Not AvailableRecruitingNot AvailableMelanoma2
Not AvailableRecruitingTreatmentBlood And Marrow Transplantation / Leukemias / Lymphoma NOS1
Not AvailableRecruitingTreatmentCancer, Breast1
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
InjectionIntravenous5 mg/mL
LiquidIntravenous5 mg
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2381770 No2007-08-072020-08-08Canada
Properties
StateSolid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Not Available
Specific Function:
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Gene Name:
CTLA4
Uniprot ID:
P16410
Molecular Weight:
24655.63 Da
References
  1. Yang JC, Hughes M, Kammula U, Royal R, Sherry RM, Topalian SL, Suri KB, Levy C, Allen T, Mavroukakis S, Lowy I, White DE, Rosenberg SA: Ipilimumab (anti-CTLA4 antibody) causes regression of metastatic renal cell cancer associated with enteritis and hypophysitis. J Immunother. 2007 Nov-Dec;30(8):825-30. [PubMed:18049334 ]
Comments
comments powered by Disqus
Drug created on March 19, 2008 10:16 / Updated on August 17, 2016 12:24