Ipilimumab is a monoclonal antibody, more specifically a fully humanized IgG1 antibody produced in mammalian cell culture, to the cytotoxic T lymphocyte antigen-4 (CTLA-4) which activates antitumor immunity by inhibiting this major checkpoint.^{[2, 3]} This antineoplastic agent was developed by Bristol-Myers Squibb and Medarex and FDA approved on March 25, 2011, for the treatment of melanoma.^[8] On October 2015, the FDA approved expanded the indications for Ipilimumab, allowing it to be used to reduce the risk of relapsed skin cancer after surgery.^[9] On July 11, 2018, the FDA approved an additional indication for the combination of low dose ipilimumab and Nivolumab for the treatment of previously treated microsatellite instability-high/deficient mismatch repair (MSI-H/dMMR) metastatic colorectal cancer.^[10]

Protein structure

Protein chemical formula

C₆₅₇₂H₁₀₁₂₆N₁₇₃₄O₂₀₈₀S₄₀

Protein average weight

148000.0 Da

Sequences

>Ipilimumab heavy chain (patent appl. US20150283234) 
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK

>Ipilimumab light chain 
EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Download FASTA Format

Synonyms

MDX-010
MDX-101
MDX-CTLA-4
MOAB-CTLA-4

Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Yervoy	Liquid	5 mg	Intravenous	Bristol Myers Squibb	2012-03-08	Not applicable
Yervoy	Injection	5 mg/1mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2011-03-25	Not applicable
Yervoy	Injection	5 mg/1mL	Intravenous	E.R. Squibb & Sons, L.L.C.	2011-03-25	Not applicable

Categories

UNII

6T8C155666

CAS number

477202-00-9

Pharmacology

Indication

Ipilimumab is approved for different conditions such as:

Treatment of unresectable or metastatic melanoma in patients 12 years and older.
Adjuvant treatment of patients with cutaneous melanoma with the pathologic involvement of regional lymph nodes of more than 1 mm who have undergone complete resection, including total lymphadenectomy.^[Label]

In combination with Nivolumab, ipilimumab is approved for:

Treatment of patients with intermediate or poor risk, previously untreated advanced renal cell carcinoma
Treatment of 12 years and older patients with MSI-H/dMMR metastatic colorectal cancer with progression after treatment with fluoropyrimidine, oxaliplatin, and irinotecan.^[Label]

Associated Conditions

Pharmacodynamics

In preclinical trials, ipilimumab was shown to inhibit tumor growth in mice, eradicate primary and metastatic melanomas, it has also been shown that it decreases serum prostate-specific antigens in prostate cancer patients and it produces a dose-dependent increase in T-cell activation.^[4]

Ipilimumab has been shown to present an overall survival benefit in metastatic melanoma. The objective response rate of this gent has been studied to be in the range between 5-20% with disease control rates of 15-30%.^[3] In clinical trials, in prostate cancer patients produce a decrease of >50% in PSA levels with a dose-response relationship between ipilimumab and CD8 T-cell activation which derived in an increase in interferon-gamma as well as lytic activity.^[4]

The use of ipilimumab in combination with Nivolumab was based on the reports that indicated significant improvement in overall survival and objective response rate of 42%.^[10] This combination was also confirmed by trials with progression after therapy colorectal cancer which obtained an overall response rate of 46% and 89% of those has a response duration of over 6 months.^[11]

Mechanism of action

The cytotoxic T-lymphocyte antigen-4 (CTLA-4) is a cell surface molecule that plays an essential role in regulating the adaptative immune response. The activation of T-cells is tightly controlled by two main signals 1) initial binding of tumor-associated antigens on antigen presenting cells to T-cell receptors and 2) subsequent binding of B7 molecules on the antigen presenting cells to CD28 receptors on T cells. After T-cell activation, CTLA-4 will be upregulated and it will compete on the binding between CD28 and B7. The binding between CTLA-4 and B7 interrupts the stimulatory signal which in order blunts T-cell proliferation response.^[6]

The action of ipilimumab produces an exacerbated autoimmunity.^[3] This is explained as the absence or presence of CTLA-4 can augment or suppress the immune system's T-cell response in fighting disease. Ipilimumab is designed to block the activity of CTLA-4, thereby sustaining a potent T-cell response against tumor cells.^[4]

However, this mechanism of action presents a limited clinical benefit to a fraction of treated patients an thus, it is thought that there should be an unknown mechanism related to host-dependent factors.^[5]

Target	Actions	Organism
ACytotoxic T-lymphocyte protein 4	Not Available	Human

Absorption

When administered once every 3 weeks for 4 cycles, the peak serum concentration and the AUC of ipilimumab are dose proportional within the dose range. The steady-state concentration is reached by the third dose and the accumulation rate was less or equal to 1.5.^[6] In steady-state, the mean Cmin ranges from 19.4 mcg/ml to 58.1 mcg/ml when given in a dosage from 3-10 mg/kg.^[Label] Once absorbed it is thought to be confined in the extracellular fluid due to its large molecular weight and it is not thought to be able to cross the blood-brain barrier.^[12]

The combination of Nivolumab and ipilimumab are based on the fact that PD-1 and CTLA-4 checkpoints have nonredundant roles on T-cell modulation.[A35187]

Volume of distribution

The volume of distribution at steady-state is determined to be of 7.21L.^[6]

Protein binding

No information regarding the plasma protein binding is available.

Metabolism

The metabolism of ipilimumab does not involve the cytochrome P450 enzyme system. Because ipilimumab is a protein it is expected to be degraded into small peptides and amino acids by proteolytic enzymes.^[7]

Route of elimination

The main excretion is thought to be done in the urine. It is suggested that the systemic clearance increases proportionally with body weight.^[12]

Half life

It has been determined that the terminal half-life of ipilimumab is of 14.7 days.^[6]

Clearance

Clearance of ipilimumab was determined to be 15.3 mL/hr.^[6]

Toxicity

The toxicity effect of ipilimumab differs from other cytotoxic chemotherapies. The adverse reactions related to ipilimumab are only related to the immune response due to the mechanism of action of this agent. These adverse reactions are mainly related to certain organs such as skin, gastrointestinal tract and endocrine glands.^[3]

The carcinogenic, genotoxic and fertility effect of ipilimumab has not been evaluated.^[Label]

Affected organisms

Humans and other mammals

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

Drug	Interaction
Abacavir	Abacavir may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Abciximab	The risk or severity of adverse effects can be increased when Abciximab is combined with Ipilimumab.
Abituzumab	The risk or severity of adverse effects can be increased when Ipilimumab is combined with Abituzumab.
Acarbose	Acarbose may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Aceclofenac	Aceclofenac may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Acemetacin	Acemetacin may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Acetaminophen	Acetaminophen may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Acetylsalicylic acid	Acetylsalicylic acid may decrease the excretion rate of Ipilimumab which could result in a higher serum level.
Aclidinium	Ipilimumab may decrease the excretion rate of Aclidinium which could result in a higher serum level.
Acrivastine	Ipilimumab may decrease the excretion rate of Acrivastine which could result in a higher serum level.

Food Interactions

Not Available

References

General References

Ribas A: Tumor immunotherapy directed at PD-1. N Engl J Med. 2012 Jun 28;366(26):2517-9. doi: 10.1056/NEJMe1205943. Epub 2012 Jun 2. [PubMed:22658126]
Johnson DB, Peng C, Abramson RG, Ye F, Zhao S, Wolchok JD, Sosman JA, Carvajal RD, Ariyan CE: Clinical Activity of Ipilimumab in Acral Melanoma: A Retrospective Review. Oncologist. 2015 Jun;20(6):648-52. doi: 10.1634/theoncologist.2014-0468. Epub 2015 May 11. [PubMed:25964307]
Thumar JR, Kluger HM: Ipilimumab: a promising immunotherapy for melanoma. Oncology (Williston Park). 2010 Dec;24(14):1280-8. [PubMed:21294471]
Authors unspecified: Ipilimumab. Drugs R D. 2010;10(2):97-110. doi: 10.2165/11584510-000000000-00000. [PubMed:20698719]
Romano E, Kusio-Kobialka M, Foukas PG, Baumgaertner P, Meyer C, Ballabeni P, Michielin O, Weide B, Romero P, Speiser DE: Ipilimumab-dependent cell-mediated cytotoxicity of regulatory T cells ex vivo by nonclassical monocytes in melanoma patients. Proc Natl Acad Sci U S A. 2015 May 12;112(19):6140-5. doi: 10.1073/pnas.1417320112. Epub 2015 Apr 27. [PubMed:25918390]
Trinh VA, Hagen B: Ipilimumab for advanced melanoma: a pharmacologic perspective. J Oncol Pharm Pract. 2013 Sep;19(3):195-201. doi: 10.1177/1078155212459100. Epub 2012 Oct 9. [PubMed:23047236]
Fellner C: Ipilimumab (yervoy) prolongs survival in advanced melanoma: serious side effects and a hefty price tag may limit its use. P T. 2012 Sep;37(9):503-30. [PubMed:23066344]
FDA approval [Link]
FDA letters [Link]
FDA news [Link]
FDA news [Link]
BCC Cancer [File]

External Links

KEGG Drug: D04603
PubChem Substance: 347910341
ChEMBL: CHEMBL1789844
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Ipilimumab

ATC Codes

L01XC11 — Ipilimumab

AHFS Codes

10:00.00 — Antineoplastic Agents

FDA label

Download (1.13 MB)

MSDS

Download (479 KB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Active Not Recruiting	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Cancer / Renal Cancers / Stage IV Renal Cell Cancer AJCC V7	1
0	Active Not Recruiting	Treatment	Prostate Cancer	1
0	Completed	Treatment	Melanoma	1
0	Recruiting	Treatment	Blood And Marrow Transplantation / Leukemias / Malignant Lymphomas	1
0	Recruiting	Treatment	Larynx / Lip, Oral Cavity and Pharynx	1
0	Recruiting	Treatment	Sarcomas	1
0	Terminated	Treatment	Ciliary Body and Choroid Melanoma, Medium/Large Size / Ciliary Body and Choroid Melanoma, Small Size / Extraocular Extension Melanoma / Hepatic Metastases / Iris Melanoma / Metastatic Intraocular Melanoma / Recurrent Intraocular Melanoma / Stage IV Intraocular Melanoma	1
1	Active Not Recruiting	Basic Science	Advanced Melanoma / Metastatic Melanoma	1
1	Active Not Recruiting	Treatment	Acute Lymphocytic Leukemia (ALL) / Chronic Lymphocytic Leukaemia (CLL) / Lymphoma, B Cell	1
1	Active Not Recruiting	Treatment	Adenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Positive Para-Aortic Lymph Node / Positive Pelvic Lymph Node / Stage IB Cervical Cancer / Stage IB2 Cervical Cancer / Stage IB2 Cervical Cancer AJCC v6 and v7 / Stage II Cervical Cancer / Stage II Cervical Cancer AJCC v7 / Stage IIA Cervical Cancer / Stage IIA Cervical Cancer AJCC v7 / Stage IIB Cervical Cancer / Stage IIB Cervical Cancer AJCC v6 and v7 / Stage IIIB Cervical Cancer / Stage IIIB Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7	1
1	Active Not Recruiting	Treatment	Advanced Cancers	1
1	Active Not Recruiting	Treatment	BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
1	Active Not Recruiting	Treatment	Cancer, Advanced	1
1	Active Not Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
1	Active Not Recruiting	Treatment	Duct Cell Adenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer	1
1	Active Not Recruiting	Treatment	Glioblastomas / Gliosarcoma / Supratentorial Glioblastoma	1
1	Active Not Recruiting	Treatment	Chronic, recurrent Lymphocytic Leukemia / Hematopoietic Cell Transplantation Recipient / Myelodysplastic Syndrome / Myeloproliferative Neoplasms / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Recurrent Hodgkin Lymphoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Plasma Cell Myeloma	1
1	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
1	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Tumors, Solid	1
1	Active Not Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC)	1
1	Active Not Recruiting	Treatment	Malignant Melanoma	1
1	Active Not Recruiting	Treatment	Melanoma	2
1	Active Not Recruiting	Treatment	Melanoma (Skin)	1
1	Active Not Recruiting	Treatment	Melanoma / Skin Cancers	1
1	Active Not Recruiting	Treatment	Recurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain	1
1	Active Not Recruiting	Treatment	Solid Cancers	1
1	Active Not Recruiting	Treatment	Stage III Hypopharyngeal Squamous Cell Carcinoma / Stage III Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage III Laryngeal Squamous Cell Carcinoma / Stage III Laryngeal Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Oropharyngeal Squamous Cell Carcinoma / Stage III Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Hypopharyngeal Squamous Cell Carcinoma / Stage IVA Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Hypopharyngeal Squamous Cell Carcinoma / Stage IVB Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v7	1
1	Completed	Treatment	Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Chronic Myelomonocytic Leukemia / Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes	1
1	Completed	Treatment	Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Childhood Myelodysplastic Syndromes / Chronic Lymphocytic Leukemia (CLL) - Refractory / Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Disseminated Neuroblastoma / Neoplasms, Malignant / Ovarian Choriocarcinoma / Ovarian Embryonal Carcinoma / Ovarian Immature Teratoma / Ovarian Mature Teratoma / Ovarian Mixed Germ Cell Tumor / Ovarian Monodermal and Highly Specialized Teratoma / Ovarian Polyembryoma / Ovarian Yolk Sac Tumor / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Mantle Cell Lymphoma / Recurrent Neuroblastoma / Recurrent Ovarian Epithelial Cancer / Recurrent Ovarian Germ Cell Tumor / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage II Ovarian Epithelial Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Multiple Myeloma / Stage III Ovarian Epithelial Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Stage IV Ovarian Epithelial Cancer / Testicular Choriocarcinoma / Testicular Choriocarcinoma and Embryonal Carcinoma / Testicular Choriocarcinoma and Seminoma / Testicular Choriocarcinoma and Teratoma / Testicular Choriocarcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma / Testicular Embryonal Carcinoma and Seminoma / Testicular Embryonal Carcinoma and Teratoma / Testicular Embryonal Carcinoma and Teratoma With Seminoma / Testicular Embryonal Carcinoma and Yolk Sac Tumor / Testicular Embryonal Carcinoma and Yolk Sac Tumor With Seminoma / Testicular Teratoma / Testicular Yolk Sac Tumor / Testicular Yolk Sac Tumor and Teratoma / Testicular Yolk Sac Tumor and Teratoma With Seminoma	1
1	Completed	Treatment	Advanced Melanoma	2
1	Completed	Treatment	Adverse Effect of Radiation Therapy / Effects of Immunotherapy / Melanoma	1
1	Completed	Treatment	CD20 Positive / Recurrent B-Cell Non-Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma	1
1	Completed	Treatment	Cancer, Breast / Head and Neck Carcinoma / Malignancies / Malignant Lymphomas / Melanoma / Triple-Negative Breast Cancer (TNBC)	1
1	Completed	Treatment	Cancer, Breast / Invasive Adenocarcinoma of the Breast	1
1	Completed	Treatment	Cancer,NOS	1
1	Completed	Treatment	Castrate Resistant Prostate Cancer (CRPC) / Prostate Cancer	1
1	Completed	Treatment	Gastrointestinal Stromal Tumors / Stage III Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma	1
1	Completed	Treatment	Human Immunodeficiency Virus (HIV)	1
1	Completed	Treatment	Intraocular Melanoma / Melanoma (Skin)	1
1	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1	Completed	Treatment	Malignant Lymphomas	1
1	Completed	Treatment	Malignant Lymphomas / Neuroblastomas / Sarcomas / Wilms' tumor	1
1	Completed	Treatment	Malignant Melanoma	2
1	Completed	Treatment	Malignant Neoplasm of Pancreas	1
1	Completed	Treatment	Melanoma	3
1	Completed	Treatment	Prostatic Neoplasms	1
1	Completed	Treatment	Recurrent Prostate Carcinoma / Stage IV Prostate Cancer / Stage IV Prostate Cancer AJCC v7	1
1	Completed	Treatment	Transitional Cell Carcinoma	1
1	Completed	Treatment	Tumors, Solid	1
1	Completed	Treatment	Unresectable Melanoma	1
1	Not Yet Recruiting	Treatment	Acute, recurrent Myeloid Leukemia / Allogeneic Hematopoietic Stem Cell Transplantation Recipient / Refractory Acute Myeloid Leukemia	1
1	Not Yet Recruiting	Treatment	Colorectal neoplasms malignant / Hepatic Metastases	1
1	Not Yet Recruiting	Treatment	Glioblastoma Multiforme (GBM) / Glioblastomas	1
1	Not Yet Recruiting	Treatment	Glioblastomas	1
1	Not Yet Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
1	Not Yet Recruiting	Treatment	Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v8	1
1	Not Yet Recruiting	Treatment	Renal Cancers	1
1	Not Yet Recruiting	Treatment	Solid Tumor, Adult	1
1	Recruiting	Basic Science	Melanoma	1
1	Recruiting	Basic Science	Soft Tissue Sarcoma Adult	1
1	Recruiting	Treatment	Acute Myeloid Leukemia and Myelodysplastic Syndrome	1
1	Recruiting	Treatment	Adenocarcinoma of the Pancreas / Colon Carcinoma Metastatic in the Liver / Colorectal Adenocarcinoma / Resectable Pancreatic Carcinoma / Stage I Pancreatic Cancer / Stage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage II Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer	1
1	Recruiting	Treatment	Adult Solid Neoplasm / Advanced Malignant Solid Neoplasm / Anal Carcinoma / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS) / Lung, Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Neoplasms, Advanced Solid / Recurrent Classic Hodgkin Lymphoma / Recurrent Classical Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Advanced Cancers / Advanced Malignant Solid Neoplasm / C-KIT Tyrosine Kinase Protein Overexpression / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Metastatic Gastrointestinal Stromal Tumor / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Unresectable Melanoma / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Advanced Cancers / Melanoma	1
1	Recruiting	Treatment	Advanced Malignancies	1
1	Recruiting	Treatment	Advanced Tumor / Metastatic Tumors	1
1	Recruiting	Treatment	Advanced/Metastatic Solid Tumors or Lymphomas	1
1	Recruiting	Treatment	B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / CD19-Positive Neoplastic Cells Present / Mixed Phenotype Acute Leukemia (MPAL) / Mixed Phenotype Acute Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Recurrent B Acute Lymphoblastic Leukemia / Refractory B Acute Lymphoblastic Leukemia	1
1	Recruiting	Treatment	Bladder Small Cell Neuroendocrine Carcinoma / Clear Cell Renal Cell Carcinoma / Infiltrating Bladder Urothelial Carcinoma Sarcomatoid Variant / Infiltrating Bladder Urothelial Carcinoma, Plasmacytoid Variant / Kidney Medullary Carcinoma / Malignant Reproductive System Neoplasm / Malignant Urinary System Neoplasm / Metastatic Malignant Neoplasm in the Bone / Metastatic Penile Carcinoma / Metastatic Renal Cell Carcinoma / Metastatic Urethral Neoplasm / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Progressive Neoplastic Disease / Recurrent Bladder Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Sarcomatoid Renal Cell Carcinoma / Solid Neoplasms / Squamous Cell Carcinoma of the Penis / Stage III Bladder Adenocarcinoma / Stage III Bladder Adenocarcinoma AJCC v6 and v7 / Stage III Bladder Squamous Cell Carcinoma / Stage III Bladder Squamous Cell Carcinoma AJCC v6 and v7 / Stage III Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Penile Cancer / Stage III Penile Cancer AJCC v7 / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer / Stage III Urethral Cancer AJCC v7 / Stage IIIa Penile Cancer / Stage IIIa Penile Cancer AJCC v7 / Stage IIIb Penile Cancer / Stage IIIb Penile Cancer AJCC v7 / Stage IV Bladder Adenocarcinoma / Stage IV Bladder Adenocarcinoma AJCC v7 / Stage IV Bladder Squamous Cell Carcinoma / Stage IV Bladder Squamous Cell Carcinoma AJCC v7 / Stage IV Bladder Urothelial Carcinoma / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Penile Cancer / Stage IV Penile Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer / Stage IV Urethral Cancer AJCC v7 / Ureter Urothelial Carcinoma / Urethral Urothelial Carcinoma	1
1	Recruiting	Treatment	Blasts 5 Percent or More of Bone Marrow Nucleated Cells / Chimerism / Hematopoietic Cell Transplantation Recipient / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Myelodysplastic Syndrome With Excess Blasts-1 / Myelodysplastic Syndrome With Excess Blasts-2 / Previously Treated Myelodysplastic Syndromes / Recurrent Acute Myeloid Leukemia With Myelodysplasia-Related Changes / Recurrent Adult Acute Myeloid Leukemia / Refractory Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Untreated Adult Acute Myeloid Leukemia	1
1	Recruiting	Treatment	Breast Adenocarcinoma / HER2/Neu Negative / Invasive Breast Carcinoma / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Recurrent Breast Carcinoma / Solid Neoplasms / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v7 / Unresectable Solid Neoplasm	1
1	Recruiting	Treatment	Cancer, Advanced	2
1	Recruiting	Treatment	Glioblastomas	1
1	Recruiting	Treatment	Hepatic Metastases / Uveal Melanoma	1
1	Recruiting	Treatment	Hepatocellular,Carcinoma	1
1	Recruiting	Treatment	Malignant Gliomas	1
1	Recruiting	Treatment	Malignant Neoplasm of Pancreas / Melanoma / Prostate Cancer / Squamous Cell Carcinoma of the Head and Neck (SCCHN)	1
1	Recruiting	Treatment	Malignant Peritoneal Neoplasm / Malignant Retroperitoneal Neoplasm / Peritoneal Carcinomatosis / Recurrent Cervical Carcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Recurrent Uterine Corpus Carcinoma / Stage IV Cervical Cancer AJCC v8 / Stage IV Fallopian Tube Cancer AJCC v8 / Stage IV Ovarian Cancer AJCC v8 / Stage IV Primary Peritoneal Cancer AJCC v8 / Stage IV Uterine Corpus Cancer AJCC v8 / Stage IVA Cervical Cancer AJCC v8 / Stage IVA Fallopian Tube Cancer AJCC v8 / Stage IVA Ovarian Cancer AJCC v8 / Stage IVA Primary Peritoneal Cancer AJCC v8 / Stage IVA Uterine Corpus Cancer AJCC v8 / Stage IVB Cervical Cancer AJCC v8 / Stage IVB Fallopian Tube Cancer AJCC v8 / Stage IVB Ovarian Cancer AJCC v8 / Stage IVB Primary Peritoneal Cancer AJCC v8 / Stage IVB Uterine Corpus Cancer AJCC v8	1
1	Recruiting	Treatment	Melanoma	1
1	Recruiting	Treatment	Melanoma and Other Malignant Neoplasms of Skin	1
1	Recruiting	Treatment	Metastatic Hormone-sensitive Prostate Cancer	1
1	Recruiting	Treatment	Metastatic Melanoma	3
1	Recruiting	Treatment	Metastatic Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
1	Recruiting	Treatment	Metastatic Solid Tumors / Treatment-Refractory Cancers	1
1	Recruiting	Treatment	Newly Diagnosed Glioblastoma	1
1	Recruiting	Treatment	Prostate Cancer	1
1	Recruiting	Treatment	Squamous Cell Carcinoma of the Head and Neck (SCCHN)	2
1	Recruiting	Treatment	Stage IV Small Cell Lung Cancer	1
1	Recruiting	Treatment	Transitional Cell Carcinoma	1
1	Recruiting	Treatment	Tumors, Solid	1
1	Terminated	Other	Melanoma	1
1	Terminated	Treatment	Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Non-Small Cell Lung Cancer Recurrent / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Recurrent Melanoma / Recurrent Ovarian Epithelial Cancer / Stage IV Melanoma / Stage IV Non-Small Cell Lung Cancer	1
1	Terminated	Treatment	Malignant Melanoma	1
1	Terminated	Treatment	Melanoma	1
1	Terminated	Treatment	Metastatic Melanoma	1
1	Terminated	Treatment	Newly Diagnosed Melanoma Metastases in the Brain and Spine	1
1	Terminated	Treatment	Prostate Cancer	1
1	Terminated	Treatment	Stage III or IV Melanoma	1
1	Terminated	Treatment	Unresectable or Metastatic Melanoma	1
1	Withdrawn	Treatment	Chronic Myeloid Leukemia (CML)	1
1	Withdrawn	Treatment	Malignant Neoplasms Stated as Primary Lymphoid Haematopoietic / Multiple Myeloma (MM)	1
1	Withdrawn	Treatment	Melanoma	1
1	Withdrawn	Treatment	Melanoma / Sarcomas	1
1, 2	Active Not Recruiting	Treatment	Advanced Malignancies / Advanced or Metastatic Malignancies	1
1, 2	Active Not Recruiting	Treatment	Advanced or Metastatic Solid Tumors	1
1, 2	Active Not Recruiting	Treatment	Advanced or Metastatic Solid Tumors / Tumors, Solid	1
1, 2	Active Not Recruiting	Treatment	Cancer,NOS	1
1, 2	Active Not Recruiting	Treatment	Extensive-Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)	1
1, 2	Active Not Recruiting	Treatment	Hepatocellular,Carcinoma	1
1, 2	Active Not Recruiting	Treatment	Liver Cancer / Lung Cancers	1
1, 2	Active Not Recruiting	Treatment	MSS / RAS-mutant Colorectal Cancer	1
1, 2	Active Not Recruiting	Treatment	Malignancies	1
1, 2	Active Not Recruiting	Treatment	Malignant Melanoma	1
1, 2	Active Not Recruiting	Treatment	Melanoma	1
1, 2	Active Not Recruiting	Treatment	Metastatic Melanoma	1
1, 2	Active Not Recruiting	Treatment	Metastatic Melanoma / Stage III Melanoma / Stage IV Melanoma	1
1, 2	Active Not Recruiting	Treatment	Non-Small Cell Lung Carcinoma (NSCLC)	1
1, 2	Active Not Recruiting	Treatment	Ovarian Cancer Metastatic	1
1, 2	Active Not Recruiting	Treatment	Prostate Cancer	1
1, 2	Completed	Treatment	Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma	1
1, 2	Completed	Treatment	Intraocular Melanoma / Melanoma (Skin)	1
1, 2	Completed	Treatment	Melanoma	1
1, 2	Completed	Treatment	Melanoma / Metastatic (Stage IV) Melanoma / Unresectable (Stage III) Melanoma	1
1, 2	Completed	Treatment	Metastatic Melanoma	1
1, 2	Completed	Treatment	Neoplasms Metastasis / Prostate Cancer	1
1, 2	Completed	Treatment	Recurrent Melanoma / Stage IV Melanoma	1
1, 2	Completed	Treatment	Unresectable Stage III or IV Malignant Melanoma	1
1, 2	Not Yet Recruiting	Treatment	Grade II Meningioma / Grade III Meningioma / Recurrent Meningiomas	1
1, 2	Not Yet Recruiting	Treatment	Hepatocellular,Carcinoma	1
1, 2	Not Yet Recruiting	Treatment	Larynx / LIP / Oral Cavity Cancer / Pharynx Cancer	1
1, 2	Recruiting	Prevention	Stage IIIC Skin Melanoma / Stage IV Skin Melanoma	1
1, 2	Recruiting	Treatment	Adenocarcinoma of the Pancreas	1
1, 2	Recruiting	Treatment	Advanced Malignancies / Metastatic Cancers / Metastatic Malignancy	1
1, 2	Recruiting	Treatment	Advanced Soft Tissue Sarcoma / Metastatic Soft Tissue Sarcoma	1
1, 2	Recruiting	Treatment	Advanced Solid Tumors	1
1, 2	Recruiting	Treatment	Cancer, Advanced	3
1, 2	Recruiting	Treatment	Cancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma	1
1, 2	Recruiting	Treatment	Carcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal	1
1, 2	Recruiting	Treatment	Carcinoma，Non-Small-Cell Lung / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)	1
1, 2	Recruiting	Treatment	Childhood Solid Neoplasm / Metastatic Melanoma / Recurrent Childhood Hodgkin Lymphoma / Recurrent Childhood Non-Hodgkin Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Recurrent Hodgkin Lymphoma / Recurrent Malignant Solid Neoplasm / Recurrent Melanoma / Recurrent Neuroblastoma / Recurrent Non-Hodgkin Lymphoma / Recurrent Osteosarcoma / Recurrent Rhabdomyosarcoma / Recurrent Solid Neoplasm / Refractory Childhood Hodgkin Lymphoma / Refractory Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Refractory Hodgkin Lymphoma / Refractory Malignant Solid Neoplasm / Refractory Melanoma / Refractory Neuroblastoma / Refractory Non-Hodgkin's lymphoma / Refractory Osteosarcoma / Refractory Rhabdomyosarcoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
1, 2	Recruiting	Treatment	Classical Hodgkin Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Classic Hodgkin Lymphoma / Recurrent Classical Hodgkin Lymphoma / Recurrent Hodgkin Lymphoma / Refractory Classic Hodgkin Lymphoma / Refractory Classical Hodgkin Lymphoma / Refractory Hodgkin Lymphoma	1
1, 2	Recruiting	Treatment	Colorectal Cancers / Gastroesophageal Adenocarcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Transitional Cell Carcinoma / Tumors, Solid	1
1, 2	Recruiting	Treatment	Hepatic Metastases / Uveal Melanoma	1
1, 2	Recruiting	Treatment	Immunotherapy / Neoplasms, Head and Neck	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
1, 2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers	1
1, 2	Recruiting	Treatment	Lymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
1, 2	Recruiting	Treatment	Malignancies	2
1, 2	Recruiting	Treatment	Malignancies / Neoplasms / Tumors	1
1, 2	Recruiting	Treatment	Malignant Lymphomas / Multiple Myeloma (MM)	1
1, 2	Recruiting	Treatment	Malignant Lymphomas / Tumors, Solid	1
1, 2	Recruiting	Treatment	Melanoma	2
1, 2	Recruiting	Treatment	Melanoma / Melanoma Stage Iii / Melanoma Stage Iv	1
1, 2	Recruiting	Treatment	Melanoma / Renal Cell Adenocarcinoma	1
1, 2	Recruiting	Treatment	Metastatic Brain Tumors / Metastatic Malignant Neoplasm in the Brain / Stage IV Non-Small Cell Lung Cancer AJCC v7	1
1, 2	Recruiting	Treatment	Metastatic Melanoma	2
1, 2	Recruiting	Treatment	Non Small Cell Lung Cancer Metastatic	1
1, 2	Recruiting	Treatment	Refractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma	1
1, 2	Recruiting	Treatment	Stage III/IV Melanoma	1
1, 2	Recruiting	Treatment	Various Advanced Cancer	1
1, 2	Suspended	Treatment	Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Colon Cancer / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Melanoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Rectal Cancer / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)	1
1, 2	Terminated	Treatment	Adult Grade III Lymphomatoid Granulomatosis / B-Cell Chronic Lymphocytic Leukemia / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenström's Macroglobulinemia (WM)	1
1, 2	Terminated	Treatment	Melanoma	1
1, 2	Terminated	Treatment	Melanoma / Metastatic Melanoma	1
1, 2	Terminated	Treatment	Metastatic Cancers	1
1, 2	Terminated	Treatment	Unresectable Stage III or Stage IV Melanoma	1
1, 2	Withdrawn	Treatment	Advanced Malignant Solid Neoplasm / Estrogen Receptor Negative / GPNMB Positive / HER2/Neu Negative / Metastatic Malignant Solid Neoplasm / Metastatic Melanoma / Progesterone Receptor Negative / Stage III Breast Cancer AJCC V7 / Stage III Cutaneous Melanoma AJCC v7 / Stage III Uveal Melanoma / Stage III Uveal Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Triple-Negative Breast Carcinoma / Unresectable Solid Neoplasm	1
1, 2	Withdrawn	Treatment	Hepatic Metastases / Lung Cancer Metastatic / Metastatic Brain Tumors / Metastatic Melanoma	1
1, 2	Withdrawn	Treatment	Melanoma	2
1, 2	Withdrawn	Treatment	Metastatic Melanoma	1
2	Active Not Recruiting	Treatment	Adenocarcinoma of the Cervix / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Human Papillomavirus Infections / Recurrent Cervical Carcinoma / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v7	1
2	Active Not Recruiting	Treatment	Adenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer	1
2	Active Not Recruiting	Treatment	Advanced or Metastatic Melanoma	1
2	Active Not Recruiting	Treatment	Cancer of the Ovary / Platinum-sensitive Ovarian Cancer, Second-line, Third-line, or Fourth-line	1
2	Active Not Recruiting	Treatment	Head and Neck Carcinoma	1
2	Active Not Recruiting	Treatment	Hepatic Metastases / Lung Cancer Metastatic / Recurrent Melanoma / Stage IV Melanoma / Tumors Metastatic to Brain	1
2	Active Not Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Active Not Recruiting	Treatment	Microsatellite Stable Colorectal Cancer / Microsatellite Unstable Colorectal Cancer / Mismatch Repair Deficient Colorectal Cancer / Mismatch Repair Proficient Colorectal Cancer / MSI Negative Colorectal Cancer / MSI Positive Colorectal Cancer	1
2	Active Not Recruiting	Treatment	Malignant Pleural Mesothelioma (MPM)	1
2	Active Not Recruiting	Treatment	Melanoma	7
2	Active Not Recruiting	Treatment	Melanoma Stage Iii / Melanoma Stage Iv	1
2	Active Not Recruiting	Treatment	Melanoma / Metastatic Brain Tumors	2
2	Active Not Recruiting	Treatment	Melanoma / Metastatic Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Uveal Melanoma	1
2	Active Not Recruiting	Treatment	Mesothelioma	1
2	Active Not Recruiting	Treatment	Metastatic Brain Tumors / Metastatic Melanoma	1
2	Active Not Recruiting	Treatment	Metastatic Castration Sensitive Prostate Cancer	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Mucosal Melanoma / Recurrent Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IV Uveal Melanoma	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
2	Active Not Recruiting	Treatment	Metastatic Melanoma / Unresectable Melanoma	1
2	Active Not Recruiting	Treatment	Prostate Cancer	1
2	Active Not Recruiting	Treatment	Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma	1
2	Active Not Recruiting	Treatment	Recurrent Melanoma / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma	1
2	Active Not Recruiting	Treatment	Recurrent Melanoma / Stage IIIA Melanoma / Stage IIIB Melanoma / Stage IIIc Melanoma / Stage IV Melanoma	1
2	Active Not Recruiting	Treatment	Recurrent Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Unresectable Melanoma	1
2	Active Not Recruiting	Treatment	Recurrent Melanoma / Stage IV Skin Melanoma	1
2	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	1
2	Active Not Recruiting	Treatment	Transitional Cell Carcinoma	1
2	Active Not Recruiting	Treatment	Untreated Stage III Melanoma or Stage IV Melanoma	1
2	Active Not Recruiting	Treatment	Uveal Melanoma	1
2	Completed	Treatment	Adenocarcinomas / Cancer, Breast	1
2	Completed	Treatment	Brain Metastasis / Melanoma	1
2	Completed	Treatment	Extensive Stage Small Cell Lung Cancer	1
2	Completed	Treatment	In-transit Metastases Melanoma Stage IIIB and IIIC	1
2	Completed	Treatment	Intraocular Melanoma / Melanoma (Skin)	2
2	Completed	Treatment	Locally Advanced (Unresectable) or Metastatic Adenocarcinoma of the Gastric and Gastro-esophageal Junction	1
2	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	2
2	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers	1
2	Completed	Treatment	Malignant Melanoma	3
2	Completed	Treatment	Malignant Melanoma Stage III / Malignant Melanoma Stage IV	1
2	Completed	Treatment	Malignant Neoplasm of Pancreas	1
2	Completed	Treatment	Melanoma	9
2	Completed	Treatment	Melanoma (Skin)	1
2	Completed	Treatment	Metastatic Leiomyosarcoma / Unresectable Leiomyosarcoma / Uterine Corpus Leiomyosarcoma	1
2	Completed	Treatment	Metastatic Malignant Melanoma	1
2	Completed	Treatment	Metastatic Melanoma	2
2	Completed	Treatment	Ocular Melanoma	1
2	Completed	Treatment	Prostate Cancer	3
2	Completed	Treatment	Prostatic Neoplasms	1
2	Completed	Treatment	Renal Cancers	1
2	Enrolling by Invitation	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Small Cell Lung Carcinoma	1
2	Not Yet Recruiting	Treatment	Adenocarcinoma Of Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Clinical Stage I Esophageal Adenocarcinoma AJCC v8 / Clinical Stage I Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v8	1
2	Not Yet Recruiting	Treatment	Advanced Melanoma / Metastatic Melanoma / Metastatic Melanoma Stratified by MHC-II Expression	1
2	Not Yet Recruiting	Treatment	Appendiceal Tumor / Colorectal Tumors / Mucinous Neoplasm	1
2	Not Yet Recruiting	Treatment	Basal Cell Nevus Syndrome	1
2	Not Yet Recruiting	Treatment	Breast Neoplasm Female / Cancer, Breast / Carcinoma, Breast / Tumors, Breast	1
2	Not Yet Recruiting	Treatment	Cancer, Breast	1
2	Not Yet Recruiting	Treatment	Chondrosarcomas / Desmoplastic Small Round Cell Tumor (DSRCT) / Ewing's Tumor Metastatic / Ewing's Tumor Recurrent / Gastrointestinal Stromal Sarcoma / Sarcoma, Bone / Sarcoma, Osteogenic / Soft Tissue Sarcoma (STS)	1
2	Not Yet Recruiting	Treatment	Classic Kaposi Sarcoma	1
2	Not Yet Recruiting	Treatment	Cutaneous Melanoma, Stage III / Cutaneous Melanoma, Stage IV / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Unresectable Melanoma	1
2	Not Yet Recruiting	Treatment	Gastric and Esophagogastric Junction Adenocarcinoma	1
2	Not Yet Recruiting	Treatment	Head and Neck Squamous Cell Carcinoma (HNSCC)	1
2	Not Yet Recruiting	Treatment	Hepatocellular Carcinoma (HCC)	1
2	Not Yet Recruiting	Treatment	Inoperable œsophageal Cancer	1
2	Not Yet Recruiting	Treatment	Melanoma	1
2	Not Yet Recruiting	Treatment	Melanoma Stage Iv	1
2	Not Yet Recruiting	Treatment	Neuroendocrine Carcinomas	1
2	Not Yet Recruiting	Treatment	Various Advanced Cancer	1
2	Recruiting	Treatment	Acinar Cell Carcinoma / Adenocarcinoma of the Cervix / Adenocarcinoma of the Ovaries / Adenocarcinoma, Mucinous / Adrenal Cortex Carcinoma / Adrenal Gland Pheochromocytoma / Anal Canal Neuroendocrine Carcinoma / Anal Canal Undifferentiated Carcinoma / Appendix Mucinous Adenocarcinoma / Bartholin Gland Transitional Cell Carcinoma / Bladder Adenocarcinoma / Bronchioloalveolar Carcinoma / Carcinoma, Adenoid Cystic / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Cholangiocarcinomas / Chordomas / Colorectal Squamous Cell Carcinoma / Desmoid-Type Fibromatosis / Endometrial Adenocarcinomas / Endometrial Transitional Cell Carcinoma / Endometrioid Adenocarcinoma / Epidermal Cyst / Esophageal Neuroendocrine Carcinoma / Esophageal Undifferentiated Carcinoma / Extrahepatic Bile Duct Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fibromyxoid Tumor / Gastric Neuroendocrine Carcinoma / Gastric Squamous Cell Carcinoma / Gastric Undifferentiated Carcinoma / Gastrointestinal Stromal Tumors / Giant Cell Carcinoma / Intestinal Neuroendocrine Carcinoma / Intrahepatic Cholangiocarcinoma / Lung Carcinoid Tumor / Lung Sarcomatoid Carcinoma / Major Salivary Gland Carcinoma / Malignant Odontogenic Neoplasm / Malignant Peripheral Nerve Sheath Tumour (MPNST) / Malignant Skin Neoplasm / Malignant Testicular Sex Cord-Stromal Tumor / Metaplastic breast carcinoma / Metastatic Malignant Neoplasm of Unknown Primary Origin / Minimally Invasive Lung Adenocarcinoma / Mixed Mesodermal (Mullerian) Tumor / Mucinous Cystadenocarcinoma / Nasal Cavity Adenocarcinoma / Nasal Cavity Carcinoma / Nasopharyngeal Carcinoma / Nasopharyngeal Papillary Adenocarcinoma / Nasopharyngeal Undifferentiated Carcinoma / Oral Cavity Carcinoma / Oropharyngeal Undifferentiated Carcinoma / Ovarian germ cell tumour / Ovarian Mucinous Adenocarcinoma / Ovarian Squamous Cell Carcinoma / Ovarian Transitional Cell Carcinoma / Pancreatic Acinar Cell Carcinoma / Pancreatic Neuroendocrine Carcinoma / Paraganglioma / Paranasal Sinus Adenocarcinoma / Paranasal Sinus Carcinoma / Parathyroid Gland Carcinoma / Pituitary Gland Carcinoma / Placental Choriocarcinoma / Placental-Site Gestational Trophoblastic Tumor / Primary Peritoneal High Grade Serous Adenocarcinoma / Pseudomyxoma Peritonei / Rare Disorder / Scrotal Squamous Cell Carcinoma / Seminal Vesicle Adenocarcinoma / Seminoma / Serous Cystadenocarcinoma / Small Intestinal Adenocarcinoma / Small Intestinal Squamous Cell Carcinoma / Spindle Cell Neoplasm / Squamous Cell Carcinoma of the Penis / Teratoma With Malignant Transformation / Testicular Non-Seminomatous Germ Cell Tumor / Thyroid Gland Carcinoma / Tracheal Carcinoma / Transitional Cell Carcinoma / Undifferentiated Gastric Carcinoma / Ureter Adenocarcinoma / Ureter Squamous Cell Carcinoma / Urethral Adenocarcinoma / Urethral Squamous Cell Carcinoma / Vaginal Adenocarcinoma / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified / Vulvar Adenocarcinoma / Vulvar Carcinoma / Vulvar Squamous Cell Carcinoma	1
2	Recruiting	Treatment	Acute Bilineal Leukemia / Acute Biphenotypic Leukemia (ABL) / Acute Myeloid Leukemia Arising From Previous Myelodysplastic Syndrome / Acute, recurrent Myeloid Leukemia / Chronic Myelomonocytic Leukemia / Leukemias / Myelodysplastic Syndrome / Refractory Acute Myeloid Leukemia / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Therapy-Related Acute Myeloid Leukemia	1
2	Recruiting	Treatment	Adenocarcinoma of the Stomach / Esophageal Cancers / Gastrooesophageal Cancer / HER2 Positive Gastric Cancer / Malignant Neoplasm of Stomach / Metastatic Gastric Cancers	1
2	Recruiting	Treatment	Adenocarcinoma of the Stomach / Gastrooesophageal Cancer	1
2	Recruiting	Treatment	Adrenocortical Carcinoma / Genitourinary Cancers / Non-adenocarcinoma Prostate Cancer / Non-urothelial Bladder / Non-urothelial Upper Tract / Penile Cancer / Refractory Germ-cell	1
2	Recruiting	Treatment	Advanced Gastric Cancer	1
2	Recruiting	Treatment	Advanced Metastatic Cancer	1
2	Recruiting	Treatment	Advanced Non-Small Cell Lung Carcinoma / Metastatic Non-Small Cell Lung Carcinoma	1
2	Recruiting	Treatment	Advanced Renal Cell Carcinoma	1
2	Recruiting	Treatment	Advanced Solid Tumors	1
2	Recruiting	Treatment	Advanced Solid Tumors / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
2	Recruiting	Treatment	Anal Canal Squamous Cell Carcinoma / Metastatic Anal Canal Carcinoma / Recurrent Anal Canal Carcinoma / Stage IV Anal Canal Cancer / Stage IV Anal Canal Cancer AJCC v6 and v7	1
2	Recruiting	Treatment	Basal Cell Carcinoma (BCC)	1
2	Recruiting	Treatment	Biliary Tract Neoplasms	1
2	Recruiting	Treatment	Bladder Cancers	1
2	Recruiting	Treatment	Cancer of the Ovary / Clear Cell Adenocarcinoma / Extra Renal Origin / Fallopian Tube Cancer / Primary Peritoneal Carcinoma	1
2	Recruiting	Treatment	Cancer of the Ovary / Malignant Neoplasm of Female Breast / Malignant Neoplasm of Stomach	1
2	Recruiting	Treatment	Cancer, Advanced	2
2	Recruiting	Treatment	Cancer, Advanced / Metastatic Cancers / Transitional Cell Carcinoma	1
2	Recruiting	Treatment	Cancer, Breast / Luminal B	1
2	Recruiting	Treatment	Carcinoid Tumors / Neuroendocrine Tumors	1
2	Recruiting	Treatment	Carcinoma, Squamous Cell of Head and Neck / Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck	1
2	Recruiting	Treatment	Chromophobe Renal Cell Carcinoma / Papillary Renal Cell Carcinoma Type 1 / Papillary Renal Cell Carcinoma Type 2 / Renal Cell Adenocarcinoma / Sarcomatoid Renal Cell Carcinoma / Xp11 Translocation Carcinoma	1
2	Recruiting	Treatment	Clear Cell Metastatic Renal Cell Carcinoma	1
2	Recruiting	Treatment	Clear-cell Metastatic Renal Cell Carcinoma / Renal Cell Adenocarcinoma	1
2	Recruiting	Treatment	Colon Carcinoma	1
2	Recruiting	Treatment	Cutaneous Melanoma / Melanoma / Mucosal Melanoma / Ocular Melanoma / Oligometastatic Melanoma / Stage III Acral Lentiginous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Uveal Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Uveal Melanoma AJCC v7 / Stage IV Acral Lentiginous Melanoma AJCC v6 and v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Uveal Melanoma AJCC v7	1
2	Recruiting	Treatment	Esophageal Cancers / Gastrooesophageal Cancer / Malignant Neoplasm of Esophagus / Metastatic Esophageal Cancer / Metastatic Oesophageal Cancer / Oesophageal Cancer Nos	1
2	Recruiting	Treatment	Eye and Orbit	1
2	Recruiting	Treatment	GBM / MGMT-unmethylated Glioblastoma (GBM)	1
2	Recruiting	Treatment	Gastrointestinal Cancers / Malignant Female Reproductive System Neoplasm / Neuroendocrine Tumours	1
2	Recruiting	Treatment	Gastrointestinal Stromal Tumors	1
2	Recruiting	Treatment	HER2/Neu Negative / Recurrent Inflammatory Breast Carcinoma / Stage IV Breast Cancer / Stage IV Inflammatory Breast Carcinoma	1
2	Recruiting	Treatment	Head and Neck Carcinoma	1
2	Recruiting	Treatment	Hepatocellular,Carcinoma / Malignant Neoplasms of Digestive Organs	1
2	Recruiting	Treatment	Kidney Cancer Metastatic / Kidney Cancer, Stage IV / Renal Cancers	1
2	Recruiting	Treatment	Leptomeningeal Carcinomatosis / Melanoma	1
2	Recruiting	Treatment	Leukemias / Myelodysplastic Syndrome	1
2	Recruiting	Treatment	Limited Stage Small Cell Lung Cancer / Lung Cancer Small Cell Lung Cancer (SCLC)	1
2	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	8
2	Recruiting	Treatment	Lung Cancer Small Cell Lung Cancer (SCLC) / Lung Cancers / Relapsed Small cell lung cancer	1
2	Recruiting	Treatment	Lung Cancers	1
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas / Microsatellite Stable Colorectal Cancer / MSI High Colorectal Cancer	1
2	Recruiting	Treatment	Major Salivary Gland Carcinoma / Minor Salivary Gland Carcinoma / Recurrent Salivary Gland Carcinoma / Stage IV Major Salivary Gland Carcinoma / Stage IVA Major Salivary Gland Carcinoma / Stage IVB Major Salivary Gland Carcinoma / Stage IVC Major Salivary Gland Carcinoma	1
2	Recruiting	Treatment	Malignant Melanoma	2
2	Recruiting	Treatment	Malignant Melanoma Stage III	1
2	Recruiting	Treatment	Malignant Neoplasm of Colon	1
2	Recruiting	Treatment	Malignant Neoplasm of Pancreas	1
2	Recruiting	Treatment	Melanoma	3
2	Recruiting	Treatment	Metastatic Biliary Tract Cancer / Pancreatic Cancer Metastatic	1
2	Recruiting	Treatment	Metastatic Brain Tumors / Metastatic Melanoma	1
2	Recruiting	Treatment	Metastatic Cancers / Metastatic Castration Resistant Prostate Cancer	1
2	Recruiting	Treatment	Metastatic Melanoma	3
2	Recruiting	Treatment	Metastatic Melanoma / Stage IV Melanoma	1
2	Recruiting	Treatment	Mucosal Melanoma	1
2	Recruiting	Treatment	Nasopharyngeal Carcinoma	1
2	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin	1
2	Recruiting	Treatment	Neuroendocrine Carcinoma of the Skin / Skin Cancers	1
2	Recruiting	Treatment	Other Disorders of Kidney and Ureter / Renal Medullary Carcinoma	1
2	Recruiting	Treatment	Pan Tumor	1
2	Recruiting	Treatment	Prostate Cancer	3
2	Recruiting	Treatment	Prostate Cancer / Recurrent Prostate Carcinoma / Stage IV Prostate Adenocarcinoma	1
2	Recruiting	Treatment	Prostatic Neoplasms	1
2	Recruiting	Treatment	Recurrent Glioblastoma	1
2	Recruiting	Treatment	Renal Cancers	1
2	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
2	Recruiting	Treatment	Salivary Gland Cancers	1
2	Recruiting	Treatment	Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
2	Recruiting	Treatment	Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7	1
2	Recruiting	Treatment	Stage IV Melanoma / Unresectable Stage III Melanoma	1
2	Recruiting	Treatment	Systemic Connective Tissue Disorders	1
2	Recruiting	Treatment	Thyroid Cancers	1
2	Recruiting	Treatment	Uveal Melanoma	1
2	Recruiting	Treatment	Various Advanced Cancer	1
2	Suspended	Treatment	Gastrointestinal Stromal Tumors / Liposarcomas, Dedifferentiated / Metastatic Liposarcoma / Metastatic Undifferentiated Pleomorphic Sarcoma / Pleomorphic liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma / Stage III Bone Sarcoma / Stage III Bone Sarcoma AJCC v7 / Stage III Soft Tissue Sarcoma / Stage III Soft Tissue Sarcoma AJCC v7 / Stage IV Adult Soft Tissue Sarcoma / Stage IV Bone Sarcoma / Stage IV Bone Sarcoma AJCC v7 / Stage IV Soft Tissue Sarcoma / Stage IV Soft Tissue Sarcoma AJCC v7 / Stage IVA Bone Sarcoma / Stage IVA Bone Sarcoma AJCC v7 / Stage IVB Bone Sarcoma / Stage IVB Bone Sarcoma AJCC v7 / Unresectable Liposarcoma	1
2	Suspended	Treatment	C-MET Gene Amplification / MET Exon 14 Mutation / Metastatic Lung Non-Squamous Non-Small Cell Carcinoma / Metastatic Non-Squamous Non-Small Cell Lung Carcinoma / Recurrent Non-Squamous Non-Small Cell Lung Carcinoma / RET/PTC Rearrangement / ROS1 Gene Rearrangement / Stage IV Non-Small Cell Lung Cancer AJCC v7	1
2	Suspended	Treatment	Pancreatic Adenocarcinoma Metastatic	1
2	Terminated	Treatment	A Combination of Adoptive T Cell Therapy and Ipilimumab Could Increase the Proportion of CR Patients, and Durability of Response	1
2	Terminated	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
2	Terminated	Treatment	Malignant Melanoma	1
2	Terminated	Treatment	Melanoma	2
2	Terminated	Treatment	Metastatic Melanoma	2
2	Terminated	Treatment	Prostate Cancer	1
2	Unknown Status	Treatment	Malignant Melanoma, Metastatic	1
2	Withdrawn	Treatment	Cervical Carcinoma / Mucosal Melanoma / Mucosal Melanoma of the Head and Neck / Oesophageal Carcinoma / Oral Cavity Mucosal Melanoma / Recurrent Melanoma / Stage II Vulvar Cancer / Stage II Vulvar Cancer AJCC v7 / Stage III Vulvar Cancer / Stage III Vulvar Cancer AJCC v7 / Stage IIIA Vulvar Cancer / Stage IIIA Vulvar Cancer AJCC v7 / Stage IIIB Vulvar Cancer / Stage IIIB Vulvar Cancer AJCC v7 / Stage IIIC Vulvar Cancer / Stage IIIC Vulvar Cancer AJCC v7 / Stage IV Oral Cavity Cancer AJCC v6 and v7 / Stage IV Vulvar Cancer / Stage IV Vulvar Cancer AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Vaginal Carcinoma	1
2	Withdrawn	Treatment	Clear Cell Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
2	Withdrawn	Treatment	Melanoma (Skin)	1
2	Withdrawn	Treatment	Melanoma / Metastatic Melanoma	1
2	Withdrawn	Treatment	Neuroendocrine Carcinoma of the Skin	1
2	Withdrawn	Treatment	Prostate Cancer	1
2, 3	Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v7	1
2, 3	Suspended	Treatment	Recurrent Melanoma of the Skin / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
3	Active Not Recruiting	Treatment	Advanced Renal Cell Carcinoma / Metastatic Renal Cell Carcinoma	1
3	Active Not Recruiting	Treatment	High Risk Stage III Melanoma	1
3	Active Not Recruiting	Treatment	Lung Cancers	1
3	Active Not Recruiting	Treatment	Melanoma	7
3	Active Not Recruiting	Treatment	Melanoma of Unknown Primary / Recurrent Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma	1
3	Active Not Recruiting	Treatment	Mesothelioma	1
3	Active Not Recruiting	Treatment	Metastatic Non-Cutaneous Melanoma / Non-Cutaneous Melanoma / Recurrent Melanoma of the Skin / Recurrent Non-Cutaneous Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage III Mucosal Melanoma of the Head and Neck / Stage III Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IVA Mucosal Melanoma of the Head and Neck / Stage IVA Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVB Mucosal Melanoma of the Head and Neck / Stage IVB Mucosal Melanoma of the Head and Neck AJCC v7 / Stage IVC Mucosal Melanoma of the Head and Neck / Stage IVC Mucosal Melanoma of the Head and Neck AJCC v7 / Stages III Skin Melanoma	1
3	Active Not Recruiting	Treatment	Recurrent Glioblastoma	1
3	Active Not Recruiting	Treatment	Unresectable or Metastatic Melanoma	1
3	Completed	Treatment	Lung Cancer - Non Small Cell (Squamous) / Lung Cancer - Non Small Cell Squamous / Lung Cancer Non-Small Cell Cancer (NSCLC)	1
3	Completed	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
3	Completed	Treatment	Melanoma	2
3	Completed	Treatment	Melanoma / Metastases	1
3	Completed	Treatment	Prostate Cancer	2
3	Completed	Treatment	Small Cell Lung Carcinoma	1
3	Not Yet Recruiting	Treatment	Advanced Non Small Cell Lung Cancer	1
3	Not Yet Recruiting	Treatment	Metastatic Non-Small Cell Lung Cancer	1
3	Recruiting	Treatment	BRAF NP_004324.2:p.V600X / BRAF V600E Mutation Present / BRAF V600K Mutation Present / Metastatic Melanoma / Recurrent Melanoma / Stage III Cutaneous Melanoma AJCC v7 / Stage IIIA Cutaneous Melanoma AJCC v7 / Stage IIIA Skin Melanoma / Stage IIIB Cutaneous Melanoma AJCC v7 / Stage IIIB Skin Melanoma / Stage IIIC Cutaneous Melanoma AJCC v7 / Stage IIIC Skin Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stages III Skin Melanoma	1
3	Recruiting	Treatment	Gastroesophageal Junction Cancer / Malignant Neoplasm of Stomach	1
3	Recruiting	Treatment	Head and Neck Carcinoma	2
3	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	5
3	Recruiting	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasms of Respiratory and Intrathoracic Organs	1
3	Recruiting	Treatment	Metastatic Brain Tumors	1
3	Recruiting	Treatment	Metastatic Melanoma	2
3	Recruiting	Treatment	Recurrent Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma AJCC v7	1
3	Recruiting	Treatment	Renal Cell Adenocarcinoma	2
3	Recruiting	Treatment	Urothelial Cancer	1
3	Recruiting	Treatment	Various Advanced Cancer	1
3	Withdrawn	Treatment	Lung Cancer Non-Small Cell Cancer (NSCLC)	1
4	Active Not Recruiting	Treatment	Malignant Melanoma	1
4	Active Not Recruiting	Treatment	Renal Cell Adenocarcinoma	1
4	Recruiting	Treatment	Lung Cancers	1
4	Terminated	Treatment	Metastatic Melanoma	1
Not Available	Active Not Recruiting	Not Available	Adenocarcinomas	1
Not Available	Active Not Recruiting	Treatment	Cancer, Breast	1
Not Available	Active Not Recruiting	Treatment	Metastatic Melanoma	1
Not Available	Completed	Not Available	Advanced Melanoma	1
Not Available	Completed	Not Available	Melanoma	3
Not Available	Completed	Treatment	Previously Untreated and Histologically Confirmed Stage III (Unresectable) or Stage IV Melanoma	1
Not Available	No Longer Available	Not Available	Malignant Melanoma	1
Not Available	No Longer Available	Not Available	Melanoma	1
Not Available	Recruiting	Not Available	Acral lentiginous melanoma / Mucosal Melanoma	1
Not Available	Recruiting	Not Available	Melanoma	2
Not Available	Temporarily Not Available	Not Available	Glioblastomas / Glioma of Brain	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Not Available

Dosage forms

Form	Route	Strength
Injection	Intravenous	5 mg/1mL
Liquid	Intravenous	5 mg

Prices

Not Available

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
CA2381770	No	2007-08-07	2020-08-08

Properties

State

Solid

Experimental Properties

Property	Value	Source
melting point (°C)	80-90 ºC (based on IgG properties)	McConnell A., et al. (2014). MAbs. Sep-Oct; 6 (5); 1274-1282
boiling point (°C)	Fab and Fc domains denaturates at 60 and 70 ºC respectively	Arnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility	50 mg/ml	Human IgG purified. Product Information
isoelectric point	6.1-8.5	Agrisera Information about IgG antibodies.

Taxonomy

Description: Not Available
Kingdom: Organic Compounds
Super Class: Organic Acids
Class: Carboxylic Acids and Derivatives
Sub Class: Amino Acids, Peptides, and Analogues
Direct Parent: Peptides
Alternative Parents: Not Available
Substituents: Not Available
Molecular Framework: Not Available
External Descriptors: Not Available

Targets

Details1. Cytotoxic T-lymphocyte protein 4

Kind: Protein
Organism: Human
Pharmacological action: Yes

General Function: Not Available
Specific Function: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of t...
Gene Name: CTLA4
Uniprot ID: P16410
Uniprot Name: Cytotoxic T-lymphocyte protein 4
Molecular Weight: 24655.63 Da

References

Yang JC, Hughes M, Kammula U, Royal R, Sherry RM, Topalian SL, Suri KB, Levy C, Allen T, Mavroukakis S, Lowy I, White DE, Rosenberg SA: Ipilimumab (anti-CTLA4 antibody) causes regression of metastatic renal cell cancer associated with enteritis and hypophysitis. J Immunother. 2007 Nov-Dec;30(8):825-30. [PubMed:18049334]

Drug created on March 19, 2008 10:16 / Updated on December 12, 2018 07:17