Lexatumumab

This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.

Identification

Name
Lexatumumab
Accession Number
DB06599
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Lexatumumab is a fully humanized, high-affinity immunoglobulin G(1 lambda) monoclonal antibody (mAb).

Protein structure
Db06599
Protein chemical formula
Not Available
Protein average weight
Not Available
Sequences
>8753_H|lexatumumab|Homo sapiens||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-234)+CH2(235-344)+CH3(345-451))|||||||451||||MW 49117.4|MW 49117.4|
EVQLVQSGGGVERPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGY
ADSVKGRVTISRDNAKNSLYLQMNSLRAEDTAVYYCAKILGAGRGWYFDLWGKGTTVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE
EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8753_L|lexatumumab|Homo sapiens||L-LAMBDA (V-LAMBDA(1-108)+C-LAMBDA(109-214))|||||||214||||MW 22699.0|MW 22699.0|
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDR
FSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLGQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Download FASTA Format
Synonyms
  • HGS-ETR2
  • TRAIL-R2
External IDs
ETR2-ST01 / HGS-1018 / HGS1018
Categories
UNII
967Q0SJD77
CAS number
845816-02-6

Pharmacology

Indication

Investigated for use/treatment in cancer/tumors (unspecified).

Pharmacodynamics
Not Available
Mechanism of action

Lexatumumab agonizes the tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor 2 (TRAIL-R2), triggering the extrinsic apoptotic pathway.

TargetActionsOrganism
UTumor necrosis factor receptor superfamily member 10BNot AvailableHuman
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Lexatumumab.
AbituzumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Abituzumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Lexatumumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Lexatumumab.
AducanumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Lexatumumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Lexatumumab.
AlirocumabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Alirocumab.
AmatuximabThe risk or severity of adverse effects can be increased when Lexatumumab is combined with Amatuximab.
AMG 108The risk or severity of adverse effects can be increased when AMG 108 is combined with Lexatumumab.
Food Interactions
Not Available

References

General References
  1. Maddipatla S, Hernandez-Ilizaliturri FJ, Knight J, Czuczman MS: Augmented antitumor activity against B-cell lymphoma by a combination of monoclonal antibodies targeting TRAIL-R1 and CD20. Clin Cancer Res. 2007 Aug 1;13(15 Pt 1):4556-64. [PubMed:17671142]
  2. Zhang X, Li W, Olumi AF: Low-dose 12-O-tetradecanoylphorbol-13-acetate enhances tumor necrosis factor related apoptosis-inducing ligand induced apoptosis in prostate cancer cells. Clin Cancer Res. 2007 Dec 1;13(23):7181-90. [PubMed:18056199]
External Links
Wikipedia
Lexatumumab

Clinical Trials

Clinical Trials
Not Available

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Tumor necrosis factor-activated receptor activity
Specific Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 pro...
Gene Name
TNFRSF10B
Uniprot ID
O14763
Uniprot Name
Tumor necrosis factor receptor superfamily member 10B
Molecular Weight
47877.885 Da
References
  1. Zhang X, Li W, Olumi AF: Low-dose 12-O-tetradecanoylphorbol-13-acetate enhances tumor necrosis factor related apoptosis-inducing ligand induced apoptosis in prostate cancer cells. Clin Cancer Res. 2007 Dec 1;13(23):7181-90. [PubMed:18056199]
  2. Maddipatla S, Hernandez-Ilizaliturri FJ, Knight J, Czuczman MS: Augmented antitumor activity against B-cell lymphoma by a combination of monoclonal antibodies targeting TRAIL-R1 and CD20. Clin Cancer Res. 2007 Aug 1;13(15 Pt 1):4556-64. [PubMed:17671142]

Drug created on March 19, 2008 10:39 / Updated on November 02, 2018 06:18