You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameAflibercept
Accession NumberDB08885
TypeBiotech
GroupsApproved
DescriptionAflibercept is a recombinant fusion protein that comprises of two main components: the vascular endothelial growth factor (VEGF) binding portions from the extracellular domains of human VEGF receptors 1 and 2 which is then fused to the Fc portion of human IgG1. Structurally, Aflibercept is a dimeric glycoprotein with a protein molecular weight of 96.9 kilo Daltons (kDa). It contains approximately 15% glycosylation to give a total molecular weight of 115 kDa. All five putative N-glycosylation sites on each polypeptide chain predicted by the primary sequence can be occupied with carbohydrate and exhibit some degree of chain heterogeneity, including heterogeneity in terminal sialic acid residues, except at the single unsialylated site associated with the Fc domain. Aflibercept, as an ophthalmic agent, is used in the treatment of macular edema following Central Retinal Vein Occlusion (CRVO) and neovascular Age-Related Macular Degeneration (AMD). Ziv-aflibercept, under the brand name Zaltrap, was developed as an injection for treatment of metastatic colorectal cancer. FDA approved in November 18, 2011 and EMA approved in November 2012.
Protein structureNo structure small
Related Articles
Protein chemical formulaC4318H6788N1164O1304S32
Protein average weight115000.0 Da (with glycosylation)
Sequences
> Protein sequence for aflibercept
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDS
RKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKL
VLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQ
GLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN
GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH
YTQKSLSLSPG
Download FASTA Format
Synonyms
VEGF Trap
VEGF Trap-Eye
Ziv-Aflibercept
External Identifiers
  • AVE 0005
  • AVE 005
  • AVE-0005
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
EyleaInjection, solution40 mg/mlIntravitrealBayer Pharma Ag  2012-11-22Not applicableEu
EyleaInjection, solution40 mg/mLIntravitrealRegeneron Pharmaceuticals2011-11-21Not applicableUs
EyleaSolution40 mgIntravitrealBayer2013-12-23Not applicableCanada
EyleaInjection, solution40 mg/mlIntravitrealBayer Pharma Ag  2012-11-22Not applicableEu
ZaltrapInjection, solution, concentrate25 mg/mlIntravenousSanofi Aventis Groupe  2013-02-01Not applicableEu
ZaltrapSolution100 mgIntravenousSanofi Aventis2014-05-08Not applicableCanada
ZaltrapSolution200 mgIntravenousSanofi Aventis2014-05-08Not applicableCanada
ZaltrapInjection, solution, concentrate25 mg/mlIntravenousSanofi Aventis Groupe  2013-02-01Not applicableEu
ZaltrapInjection, solution, concentrate25 mg/mlIntravenousSanofi Aventis Groupe  2013-02-01Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII15C2VL427D
CAS number862111-32-8
Pharmacology
IndicationThe opthalmic agent is used for the treatment of neovascular (wet) age-related mascular degeneration (AMD) and macular edema following central retinal vein occulsion (CRVO). The systemic injection, known as ziv-aflibercept, in combination with 5-fluorouracil, leucovorin, irinotecan-(FOLFIRI), is for the treatment of metastatic colorectal cancer that is resistant to or progressed following treatment with oxaliplatin.
Structured Indications
Clinical Trials
PhaseStatusPurposeConditionsCount
1Active Not RecruitingTreatmentMacular Edema (ME) / Radiation Retinopathy1
1Active Not RecruitingTreatmentMetastatic Biliary Cancers / Metastatic Breast Cancer (MBC) / Metastatic Colorectal Cancers / Metastatic Gastric Cancers / Metastatic Oesophageal Cancers / Pancreatic Cancer Metastatic1
1Active Not RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
1CompletedBasic ScienceDiabetic Macular Edema (DME) / Neovascular Age-Related Macular Degeneration1
1CompletedTreatmentAdult Anaplastic Astrocytoma / Adult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Adult Mixed Glioma / Recurrent Adult Brain Tumor1
1CompletedTreatmentCancers1
1CompletedTreatmentDiabetic Macular Edema (DME)1
1CompletedTreatmentMacular Degeneration1
1CompletedTreatmentNeoplasms3
1CompletedTreatmentNeoplasms Malignant1
1CompletedTreatmentNeoplasms Metastasis / Neoplasms, Colorectal1
1CompletedTreatmentNeovascular Age Related Macular Degeneration1
1CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentTumors, Solid1
1RecruitingNot AvailableNeovascular Macular Degeneration1
1RecruitingTreatmentAge Related Macular Degeneration (ARMD) / Central Retinal Vein Occlusion (CRVO)1
1RecruitingTreatmentMacular Edema (ME) / Retinal Artery Macroaneurysm1
1TerminatedTreatmentCorneal Neovascularization1
1, 2Active Not RecruitingTreatmentMetastatic Colorectal Cancers1
1, 2CompletedBasic ScienceAge-Related Macular Degeneration (ARMD) / Diabetic Macular Edema (DME) / Retinal Vein Occlusion (RVO)1
1, 2CompletedTreatmentNeovascular Age-Related Macular Degeneration1
1, 2RecruitingPreventionRetinopathy, Diabetic1
1, 2RecruitingTreatmentHistoplasmosis retinitis1
2Active Not RecruitingTreatmentCarcinoid Tumors1
2Active Not RecruitingTreatmentCentral Serous Chorioretinopathy (CSC)1
2Active Not RecruitingTreatmentNeoplasms, Colorectal1
2Active Not RecruitingTreatmentVitreous Hemorrhage1
2CompletedTreatmentCancer of the Ovary / Neoplasms1
2CompletedTreatmentExudative Age-Related Macular Degeneration2
2CompletedTreatmentFallopian Tube Cancer / Female Reproductive Cancer / Ovarian Carcinosarcoma / Ovarian Sarcoma / Recurrent Ovarian Epithelial Cancer / Recurrent Uterine Sarcoma / Stage III Ovarian Epithelial Cancer / Stage III Uterine Sarcoma / Stage IV Ovarian Epithelial Cancer / Stage IV Uterine Sarcoma / Uterine Carcinosarcoma / Uterine Leiomyosarcoma1
2CompletedTreatmentNeoplasms Metastasis / Neoplasms, Colorectal1
2CompletedTreatmentNeoplasms, Lung / Pulmonary Diseases1
2CompletedTreatmentNeoplasms, Ovarian1
2CompletedTreatmentRectal Cancers1
2CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IV Colon Cancer / Stage IV Rectal Cancer1
2Not Yet RecruitingPreventionAge-Related Macular Degeneration (ARMD)1
2Not Yet RecruitingTreatmentAdverse Effect of Radiation Therapy1
2Not Yet RecruitingTreatmentChoroidal Neovascularization in Angioid Streaks1
2Not Yet RecruitingTreatmentInflammatory Choroidal Neovascularization1
2Not Yet RecruitingTreatmentProliferative Diabetic Retinopathy (PDR)1
2Not Yet RecruitingTreatmentPseudoxanthoma Elasticum1
2RecruitingTreatmentAge-Related Macular Degeneration (AMD) / AMD / Exudative Age-Related Macular Degeneration / Eye Diseases / Macular Degeneration / Macular Degeneration, Age-related, 10 / Retinal Degenerations / Retinal Diseases1
2RecruitingTreatmentAge-Related Macular Degeneration (ARMD)2
2RecruitingTreatmentDiabetic Macular Edema (DME)1
2RecruitingTreatmentEsophageal Cancers / Gastric Cancers1
2RecruitingTreatmentIdiopathic Choroidal Neovascularization1
2RecruitingTreatmentMacular Degeneration / Neovascularization / Retinal Neovascularization / Retinal Vein Occlusion (RVO) / Retinopathy, Diabetic / Subfoveal Choroidal Neovascularization1
2RecruitingTreatmentMacular Oedema / Retinitis Pigmentosa (RP)1
2RecruitingTreatmentMetastatic Colorectal Cancers4
2RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
2RecruitingTreatmentRectal Cancers1
2TerminatedTreatmentMetastatic Colorectal Cancers2
2WithdrawnTreatmentColorectal Cancers / Metastatic Colorectal Cancers1
2WithdrawnTreatmentMetastatic Colorectal Cancers1
2, 3CompletedTreatmentAscites / Neoplasms, Ovarian1
2, 3RecruitingBasic ScienceAge Related Macular Degeneration (ARMD)1
3Active Not RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO)1
3Active Not RecruitingTreatmentEye Diseases / Macular Degeneration / Retinal Degenerations / Retinal Diseases / Wet Macular Degeneration1
3CompletedTreatmentCarcinomas / Non Small Cell Lung1
3CompletedTreatmentGlaucoma / Rubeosis Iridis1
3CompletedTreatmentMetastatic Colorectal Cancers1
3CompletedTreatmentNeoplasms Metastasis / Neoplasms, Colorectal1
3CompletedTreatmentNeoplasms Metastasis / Prostatic Neoplasms1
3RecruitingPreventionDiabetic Macular Edema (DME) / Retinopathy, Diabetic1
3RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
3RecruitingTreatmentDiabetic Macular Edema (DME)1
3RecruitingTreatmentGlaucoma, Neovascular1
3RecruitingTreatmentMacular Degeneration1
3RecruitingTreatmentNeovascular Age-Related Macular Degeneration2
3TerminatedTreatmentNeoplasms, Pancreatic1
4Active Not RecruitingNot AvailableWet Macular Degeneration1
4Active Not RecruitingTreatmentAge Related Macular Degeneration (ARMD) / Pigment Epithelial Detachment1
4Active Not RecruitingTreatmentDiabetic Macular Edema (DME)1
4Active Not RecruitingTreatmentExudative Age-Related Macular Degeneration1
4Active Not RecruitingTreatmentExudative Age-Related Macular Degeneration / Polypoidal Choroidal Vasculopathy1
4Active Not RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
4Active Not RecruitingTreatmentNeovascular Macular Degeneration1
4Active Not RecruitingTreatmentRetinal Vein Occlusion (RVO)1
4CompletedBasic ScienceExudative Age-Related Macular Degeneration1
4CompletedTreatmentAge-Related Macular Degeneration (ARMD)1
4CompletedTreatmentFibrovascular Pigment Epithelial Detachment1
4CompletedTreatmentMacular Edema With Central Retinal Vein Occlusions1
4CompletedTreatmentPolypoidal Choroidal Vasculopathy1
4CompletedTreatmentRetinal Diseases1
4CompletedTreatmentSubmacular Vascularized Pigment Epithelial Detachments1
4Enrolling by InvitationPreventionDiabetic Macular Edema (DME)1
4Enrolling by InvitationTreatmentDiabetic Macular Edema (DME)1
4Not Yet RecruitingTreatmentCentral Serous Chorioretinopathy (CSC) / Idiopathic Poplypoidal Choroidal Vasculopathy / Macular Degeneration1
4Not Yet RecruitingTreatmentDiabetic Macular Edema (DME)1
4Not Yet RecruitingTreatmentRetinal Pigment Epithelial Detachment Secondary to Age-related Macular Degeneration1
4Not Yet RecruitingTreatmentWet Macular Degeneration1
4RecruitingNot AvailableWet Macular Degeneration1
4RecruitingTreatmentAge Related Macular Degeneration (ARMD)2
4RecruitingTreatmentAge-Related Macular Degeneration (ARMD)2
4RecruitingTreatmentBranch Retinal Vein Occlusion / Central Retinal Vein Occlusion (CRVO) / Diabetic Macular Edema (DME) / Retinal Vein Occlusion (RVO)1
4RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO)2
4RecruitingTreatmentDiabetic Macular Edema (DME)1
4RecruitingTreatmentMacular Degeneration1
4RecruitingTreatmentMacular Degeneration / Wet Macular Degeneration1
4RecruitingTreatmentMacular Diseases1
4RecruitingTreatmentMacular Edema (ME)1
4RecruitingTreatmentMacular Edema (ME) / Retinopathy, Diabetic1
4RecruitingTreatmentMacular Edema, Diabetic1
4RecruitingTreatmentPolypoidal Choroidal Vasculopathy Without Active Polyp1
4RecruitingTreatmentRetinopathy, Diabetic1
4RecruitingTreatmentType 3 Choroidal Neovascularization1
4RecruitingTreatmentVisual Impairment Due to Neovascular AMD1
4RecruitingTreatmentWet Macular Degeneration1
4SuspendedTreatmentVisual Impairment Due to Diabetic Macular Edema1
Not AvailableActive Not RecruitingNot AvailableAge Related Macular Degeneration (ARMD)1
Not AvailableActive Not RecruitingNot AvailableCentral Retinal Vein1
Not AvailableActive Not RecruitingNot AvailableMacular Degeneration2
Not AvailableActive Not RecruitingNot AvailableRetinal Vein Occlusion (RVO)1
Not AvailableActive Not RecruitingNot AvailableWet Age-Related Macular Degeneration1
Not AvailableActive Not RecruitingNot AvailableWet Macular Degeneration1
Not AvailableActive Not RecruitingTreatmentGlaucoma, Neovascular1
Not AvailableAvailableNot AvailableRetinal Hemangioma1
Not AvailableCompletedNot AvailableMacular Edema (ME) / Retinal Vein Occlusion (RVO)1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD) / Central Retinal Vein Occlusion (CRVO) / Diabetic Macular Edema (DME)1
Not AvailableNot Yet RecruitingNot AvailableAge-Related Macular Degeneration (AMD) / Central Retinal Vein Occlusion (CRVO) / Diabetic Macular Edema (DME)1
Not AvailableNot Yet RecruitingNot AvailableAge-Related Macular Degeneration (ARMD)1
Not AvailableNot Yet RecruitingTreatmentVisual Acuity Improvement With Aflibercept Injection1
Not AvailableRecruitingNot AvailableAge Related Macular Degeneration (ARMD)1
Not AvailableRecruitingNot AvailableAge Related Macular Degeneration (ARMD) / Intravitreal Injections1
Not AvailableRecruitingNot AvailableEye Diseases1
Not AvailableRecruitingNot AvailableMacular Degeneration1
Not AvailableRecruitingNot AvailableMacular Diseases1
Not AvailableRecruitingNot AvailableMacular Edema (ME)1
Not AvailableRecruitingNot AvailableRetinopathy, Diabetic1
Not AvailableRecruitingNot AvailableSubfoveal Choroidal Neovascularization2
Not AvailableRecruitingNot AvailableWet Macular Degeneration2
Not AvailableRecruitingTreatmentPolypoidal Choroidal Vasculopathy1
Not AvailableTerminatedPreventionMacular Degeneration / Retinal Detachment1
Not AvailableWithdrawnTreatmentNeovascular Age-Related Macular Degeneration1
Not AvailableWithdrawnTreatmentPattern Dystrophy of Macula1
PharmacodynamicsCompared to other anti-VEGF drugs like bevacizumab and ranibizumab, aflibercept has a higher binding affinity to VEGF-A (Kd = 0.5 pM).
Mechanism of actionAblibercept is a recombinant fusion protein that acts as a decoy receptor for the ligands, vascular endothelial growth factor-A (VEGF-A) and placental growth factor (PIGF). It prevents these ligands to binding to endothelial receptors, VEGFR-1 and VEGFR-2, to suppress neovascularization and decrease vascular permeability. This ultimately will slow vision loss or the progression of metastatic colorectal cancer.
TargetKindPharmacological actionActionsOrganismUniProt ID
Vascular endothelial growth factor AProteinyes
binder
HumanP15692 details
Placenta growth factorProteinyes
binder
HumanP49763 details
Vascular endothelial growth factor BProteinyes
binder
HumanP49765 details
Related Articles
AbsorptionIn patients with wet AMD and CRVO, the mean peak plasma concentration (Cmax) was 0.02 mcg/mL and 0.05 mcg/mL respectively. These concentrations were reached in 1 to 3 days. Aflibercept did not accumulate when administered as repeated doses intravitreally every 4 weeks.
Volume of distribution

After intravenous injection of aflibercept, the volume of distribution is 6 L.

Protein bindingNot Available
Metabolism

Because aflibercept is a protein, it is expected to be broken down via proteolysis into smaller peptides and amino acids. The cytochrome P450 enzyme system is not involved in the metabolism of aflibercept.

Route of eliminationVia kidney and liver
Half lifeIntravitreal half-life= 7.13 days in humans; Terminal elimination half-life of free aflibercept in plasma was 5 to 6 days after IV injection of 2 - 4 mg/kg dose.
Clearance

When cancer patients were given 2-9 mg/kg every 2 or 3 week; 1 hour IV infusion of aflibercept the typical estimated clearances were as follows:
CL of free aflibercept (CLf) = 0.88 L/day;
CL of bound aflibercept (CLf) = 0.19 L/day;
Patients clear free aflibercept faster if they had low albumin or high alkaline phosphatase levels.

ToxicityFor all intravitreal VEGF inhibitors, there is increased risk of stroke and myocardial infarction. An increase in intraocular pressure may also occur. When used intravenously, most common adverse reactions were leukopenia, diarrhea, neutropenia, proteinuria, AST increased, stomatitis, fatigue, thrombocytopenia, ALT increased, hypertension, weight decreased, decreased appetite, epistaxis, abdominal pain, dysphonia, serum creatinine increased, and headache.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Aflibercept.Approved
AnvirzelAnvirzel may decrease the cardiotoxic activities of Aflibercept.Investigational
BevacizumabBevacizumab may increase the cardiotoxic activities of Aflibercept.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Aflibercept.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Aflibercept.Approved, Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Aflibercept.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Aflibercept.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Aflibercept.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Aflibercept.Approved, Investigational
OuabainOuabain may decrease the cardiotoxic activities of Aflibercept.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Aflibercept.Approved, Vet Approved
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Aflibercept.Approved, Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Freund KB, Mrejen S, Gallego-Pinazo R: An update on the pharmacotherapy of neovascular age-related macular degeneration. Expert Opin Pharmacother. 2013 Jun;14(8):1017-28. doi: 10.1517/14656566.2013.787410. Epub 2013 Apr 8. [PubMed:23560774 ]
  2. Thai HT, Veyrat-Follet C, Mentre F, Comets E: Population pharmacokinetic analysis of free and bound aflibercept in patients with advanced solid tumors. Cancer Chemother Pharmacol. 2013 Jul;72(1):167-80. doi: 10.1007/s00280-013-2182-1. Epub 2013 May 15. [PubMed:23673444 ]
External Links
ATC CodesL01XX44S01LA05
AHFS Codes
  • 10:00
  • 52:92
PDB EntriesNot Available
FDA labelDownload (325 KB)
MSDSDownload (91.1 KB)
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, solutionIntravitreal40 mg/ml
SolutionIntravitreal40 mg
Injection, solution, concentrateIntravenous25 mg/ml
SolutionIntravenous100 mg
SolutionIntravenous200 mg
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US7070959 No2006-07-042020-05-23Us
US7306799 No2005-03-252020-05-23Us
US7374757 No2008-05-202020-05-23Us
US7374758 No2008-05-202020-05-23Us
US7531173 No2009-05-122026-02-02Us
US7608261 No2009-10-272027-06-14Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
water solubility>100 mg/mLMSDS
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
binder
General Function:
Vascular endothelial growth factor receptor binding
Specific Function:
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activ...
Gene Name:
VEGFA
Uniprot ID:
P15692
Molecular Weight:
27042.205 Da
References
  1. Browning DJ, Kaiser PK, Rosenfeld PJ, Stewart MW: Aflibercept for age-related macular degeneration: a game-changer or quiet addition? Am J Ophthalmol. 2012 Aug;154(2):222-6. doi: 10.1016/j.ajo.2012.04.020. [PubMed:22813448 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
binder
General Function:
Heparin binding
Specific Function:
Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.
Gene Name:
PGF
Uniprot ID:
P49763
Molecular Weight:
24788.45 Da
References
  1. Browning DJ, Kaiser PK, Rosenfeld PJ, Stewart MW: Aflibercept for age-related macular degeneration: a game-changer or quiet addition? Am J Ophthalmol. 2012 Aug;154(2):222-6. doi: 10.1016/j.ajo.2012.04.020. [PubMed:22813448 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
binder
General Function:
Vascular endothelial growth factor receptor 1 binding
Specific Function:
Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
Gene Name:
VEGFB
Uniprot ID:
P49765
Molecular Weight:
21601.56 Da
References
  1. Browning DJ, Kaiser PK, Rosenfeld PJ, Stewart MW: Aflibercept for age-related macular degeneration: a game-changer or quiet addition? Am J Ophthalmol. 2012 Aug;154(2):222-6. doi: 10.1016/j.ajo.2012.04.020. [PubMed:22813448 ]
Comments
comments powered by Disqus
Drug created on May 24, 2013 15:16 / Updated on August 17, 2016 12:24