Ixekizumab

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates
Name
Ixekizumab
Accession Number
DB11569
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Ixekizumab is a humanized immunoglobulin G subclass 4 (IgG4) monoclonal antibody (mAb) against interleukin-17A (IL-17A) and prevents it from interacting with the IL-17A receptor. As IL-17A is a pro-inflammatory cytokine involved in inflammation and immune responses, blocking its effect is beneficial for use in inflammatory conditions. In particular, IL-17A has been found to be implicated in a variety of autoimmune diseases including Rheumatoid Arthritis and plaque psoriasis.

Ixekizumab is produced by recombinant DNA technology in a recombinant mammalian cell line and purified using standard technology for bioprocessing. Ixekizumab is comprised of two identical light chain polypeptides of 219 amino acids each and two identical heavy chain polypeptides of 445 amino acids each, and has a molecular weight of 146,158 Daltons for the protein backbone of the molecule. It is indicated for the treatment of adults with moderate-to-severe plaque psoriasis who are candidates for systemic therapy or phototherapy.

Protein chemical formula
C6492H10012N1728O2028S46
Protein average weight
146158.0 Da
Sequences
>Heavy Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYHIHWVRQAPGQGLEWMGVINPMYGTTDY
NQRFKGRVTITADESTSTAYMELSSLRSEDTAVYYCARYDYFTGTGVYWGQGTLVTVSSA
STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN
VFSCSVMHEALHNHYTQKSLSLSLG
>Light Chain Sequence
DIVMTQTPLSLSVTPGQPASISCRSSRSLVHSRGNTYLHWYLQKPGQSPQLLIYKVSNRF
IGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHLPFTFGQGTKLEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
External IDs
LY 2439821 / LY-2439821 / LY2439821
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
TaltzInjection, solution80 mg/1mLSubcutaneousEli Lilly and Company2016-03-22Not applicableUs
TaltzInjection, solution80 mgSubcutaneousEli Lilly Nederland B.V.2016-04-25Not applicableEu
TaltzInjection, solution80 mgSubcutaneousEli Lilly Nederland B.V.2016-04-25Not applicableEu
TaltzInjection, solution80 mgSubcutaneousEli Lilly Nederland B.V.2016-04-25Not applicableEu
TaltzSolution80 mgSubcutaneousEli Lilly & Co. Ltd.2016-08-11Not applicableCanada
TaltzInjection, solution80 mgSubcutaneousEli Lilly Nederland B.V.2016-04-25Not applicableEu
TaltzSolution80 mgSubcutaneousEli Lilly & Co. Ltd.2016-08-11Not applicableCanada
TaltzInjection, solution80 mgSubcutaneousEli Lilly Nederland B.V.2016-04-25Not applicableEu
TaltzInjection, solution80 mg/1mLSubcutaneousEli Lilly and Company2016-03-22Not applicableUs
TaltzInjection, solution80 mgSubcutaneousEli Lilly Nederland B.V.2016-04-25Not applicableEu
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Categories
UNII
BTY153760O
CAS number
1143503-69-8

Pharmacology

Indication

Ixekizumab is indicated for the treatment of adults with moderate-to-severe plaque psoriasis who are candidates for systemic therapy or phototherapy.

Associated Conditions
Pharmacodynamics
Not Available
Mechanism of action

Ixekizumab is a humanized immunoglobulin G subclass 4 (IgG4) monoclonal antibody (mAb) against interleukin-17A (IL-17A) and prevents it from interacting with the IL-17A receptor. As IL-17A is a pro-inflammatory cytokine involved in inflammation and immune responses, blocking its effect is beneficial for use in inflammatory conditions. In particular, IL-17A has been found to be implicated in a variety of autoimmune diseases including Rheumatoid Arthritis and plaque psoriasis.

TargetActionsOrganism
AInterleukin-17A
antibody
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Following a single subcutaneous dose of 160 mg in subjects with plaque psoriasis, ixekizumab reached peak mean (±SD) serum concentrations (Cmax) of 16.2 ±6.6 mcg/mL by approximately 4 days post dose.

Volume of distribution

The mean (geometric CV%) volume of distribution at steady-state was 7.11 L (29%) in subjects with plaque psoriasis.

Protein binding
Not Available
Metabolism

The metabolic pathway of ixekizumab has not been characterized. As a humanized IgG4 monoclonal antibody ixekizumab is expected to be degraded into small peptides and amino acids via catabolic pathways in the same manner as endogenous IgG.

Route of elimination
Not Available
Half life

13 days

Clearance

0.39 L/day

Toxicity

The most common adverse reactions associated with Ixekizumab treatment are injection site reactions, upper respiratory tract infections, nausea, and tinea infections.

Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
2-MethoxyethanolThe risk or severity of adverse effects can be increased when 2-Methoxyethanol is combined with Ixekizumab.
9-(N-methyl-L-isoleucine)-cyclosporin AThe risk or severity of adverse effects can be increased when Ixekizumab is combined with 9-(N-methyl-L-isoleucine)-cyclosporin A.
AbataceptThe risk or severity of adverse effects can be increased when Abatacept is combined with Ixekizumab.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ixekizumab.
AbetimusThe risk or severity of adverse effects can be increased when Abetimus is combined with Ixekizumab.
AbituzumabThe risk or severity of adverse effects can be increased when Ixekizumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Ixekizumab is combined with Abrilumab.
ActeosideThe risk or severity of adverse effects can be increased when Ixekizumab is combined with Acteoside.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Ixekizumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Ixekizumab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. Dyring-Andersen B, Skov L, Zachariae C: Ixekizumab for treatment of psoriasis. Expert Rev Clin Immunol. 2015 Apr;11(4):435-42. doi: 10.1586/1744666X.2015.1023295. Epub 2015 Mar 8. [PubMed:25748485]
  2. Genovese MC, Van den Bosch F, Roberson SA, Bojin S, Biagini IM, Ryan P, Sloan-Lancaster J: LY2439821, a humanized anti-interleukin-17 monoclonal antibody, in the treatment of patients with rheumatoid arthritis: A phase I randomized, double-blind, placebo-controlled, proof-of-concept study. Arthritis Rheum. 2010 Apr;62(4):929-39. doi: 10.1002/art.27334. [PubMed:20131262]
  3. Bush KA, Farmer KM, Walker JS, Kirkham BW: Reduction of joint inflammation and bone erosion in rat adjuvant arthritis by treatment with interleukin-17 receptor IgG1 Fc fusion protein. Arthritis Rheum. 2002 Mar;46(3):802-5. [PubMed:11920418]
External Links
KEGG Drug
D10071
PubChem Substance
347911203
ChEMBL
CHEMBL1743034
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Ixekizumab
ATC Codes
L04AC13 — Ixekizumab
AHFS Codes
  • 84:92.00 — Misc. Skin and Mucous Membrane Agents
FDA label
Download (6.58 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedBasic ScienceHealthy Volunteers3
1CompletedBasic SciencePsoriasis2
1CompletedTreatmentRheumatoid Arthritis2
2Active Not RecruitingTreatmentPityriasis Rubra Pilaris1
2CompletedTreatmentBullous Pemphigoid (BP) / Pemphigoid1
2CompletedTreatmentPsoriasis1
2CompletedTreatmentPyoderma Gangrenosum1
2CompletedTreatmentRheumatoid Arthritis1
3Active Not RecruitingTreatmentPsoriasis Vulgaris (Plaque Psoriasis)2
3Active Not RecruitingTreatmentSpondyloarthritis, Axial1
3CompletedTreatmentGenital Psoriasis / Psoriasis1
3CompletedTreatmentPsoriasis5
3CompletedTreatmentPsoriasis Vulgaris (Plaque Psoriasis)4
3CompletedTreatmentPsoriasis, Arthritic1
3CompletedTreatmentPsoriatic Arthritis2
3CompletedTreatmentSpondyloarthritis2
3CompletedTreatmentSpondyloarthritis, Axial1
3WithdrawnTreatmentAnkylosing Spondylitis (AS)1
4Active Not RecruitingTreatmentPsoriasis Vulgaris (Plaque Psoriasis)1
4CompletedTreatmentPsoriatic Arthritis1
4RecruitingTreatmentErythrodermic psoriasis / Generalized Pustular Psoriasis1
Not AvailableRecruitingNot AvailableAtopic Dermatitis (AD) / Psoriasis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous80 mg/1mL
Injection, solutionSubcutaneous80 mg
SolutionSubcutaneous80 mg
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Cytokine receptor binding
Specific Function
Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of ICAM1/intracellular adhesion molecule 1 in fibroblasts.
Gene Name
IL17A
Uniprot ID
Q16552
Uniprot Name
Interleukin-17A
Molecular Weight
17503.92 Da

Drug created on April 06, 2016 09:41 / Updated on December 08, 2019 20:10