Atezolizumab

Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates
Name
Atezolizumab
Accession Number
DB11595
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Atezolizumab is a humanized monoclonal antibody used to prevent the interaction of PD-L1 and PD-1, removing inhibition of immune responses seen in some cancers.2,7 This medication is reserved for patients whose tumors express PD-L1, cannot receive platinum based chemotherapy, or whose tumors do not respond to platinum based chemotherapy.7 Atezolizumab was granted FDA approval on 18 October 2016.7

Protein chemical formula
Not Available
Protein average weight
145000.0 Da
Sequences
>Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYAST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYLYHPATFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • Atezolizumab
External IDs
MPDL 3280A / MPDL-3280A / MPDL3280A / RG-7446 / RG7446
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
TecentriqSolution840 mgIntravenousHoffmann La Roche2019-10-16Not applicableCanada
TecentriqSolution1200 mgIntravenousHoffmann La Roche2017-05-02Not applicableCanada
TecentriqInjection, solution840 mg/14mLIntravenousGenentech, Inc.2019-03-08Not applicableUs
TecentriqInjection, solution1200 mg/20mLIntravenousGenentech, Inc.2016-05-18Not applicableUs
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Categories
UNII
52CMI0WC3Y
CAS number
1380723-44-3

Pharmacology

Indication

Atezolizumab is indicated to treat locally or advanced metastatic urothelial carcinoma in patients ineligible for cicplatin-containing chemotherapy with tumors expressing PD-L1, in patients ineligible for cisplatin-containing chemotherapy irrespective of PD-L1, have disease progression following platinum containing chemotherapy, or have disease progression within 12 months of neoadjuvant or adjuvant chemotherapy.7

Atezolizumab is also indicated first line for non small cell lung cancer in combination with bevacizumab, paclitaxel, and carboplatin with no EGFR or ALK genomic abnormalities.7 It can be used in patients with disease progression during or after platinum containing chemotherapy even if they have EGFR and ALK abnormalities.7

Atezolizumab is indicated in combination with paclitaxel protein-bound to treat locally advanced or metastatic triple negative breast cancer expressing PD-L1.7

Finally, atezolizumab is indicated in combination with carboplatin and etoposide as first line treatment for extensive stage small cell lung cancer.7

Associated Conditions
Pharmacodynamics

Atezolizumab is a humanized monoclonal antibody used to prevent the interaction of PD-L1 and PD-1, removing inhibition of immune responses seen in some cancers.2,7 This drug has a long duration of action as it is usually given every 3-4 weeks.7 Atezolizumab should not be used in patients with immune mediated penumonitis, hepatitis, colitis, and some endocrinopathies.7

Mechanism of action

Atezolizumab is a humanized IgG antibody that binds PD-L1, preventing its interaction with PD-1 and B7-1.2 Preventing the interaction of PD-L1 and PD-1 removes inhibition of immune responses such as the anti-tumor immune response but not antibody dependent cellular cytotoxicity.7

TargetActionsOrganism
AProgrammed cell death 1 ligand 1
antibody
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Pharmacokinetic analysis was performed in patients with metastatic urothelial carcinoma.3 In these patients, the AUC was 2.19-2.73day*µg/mL/mg, the Cmax was 0.27-0.35µg/mL/mg, and the Cmin was 0.004-0.008µg/mL/mg.3

Volume of distribution

The volume of distribution of atezolizumab is 6.91L.1,3

Protein binding

Monoclonal antibodies are not expected to bind to proteins in plasma they are not designed to target.

Metabolism

Monoclonal antibodies are broken down into smaller polypeptides and amino acids.4

Route of elimination

Atezolizumab is not renally excreted.5

Half life

The half life of atezolizumab is 27 days.1,3

Clearance

The clearance of atezolizumab is 0.200L/day.1,3

Toxicity

Most common adverse reactions (≥ 20% of patients) included: fatigue, decreased appetite, nausea, urinary tract infection, pyrexia, and constipation.

Overdose data for atezolizumab is scarce6 but the most common adverse reactions are fatigue, nausea, cough, dyspnea, decreased appetite, alopecia, constipation, diarrhea, peripheral neuropathies, anemia, headache, neutropenia, and vomiting.7

Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Atezolizumab.
AbituzumabThe risk or severity of adverse effects can be increased when Atezolizumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Atezolizumab is combined with Abrilumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Atezolizumab.
AdecatumumabThe risk or severity of adverse effects can be increased when Adecatumumab is combined with Atezolizumab.
AducanumabThe risk or severity of adverse effects can be increased when Atezolizumab is combined with Aducanumab.
AfelimomabThe risk or severity of adverse effects can be increased when Afelimomab is combined with Atezolizumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Atezolizumab.
AlirocumabThe risk or severity of adverse effects can be increased when Alirocumab is combined with Atezolizumab.
AmatuximabThe risk or severity of adverse effects can be increased when Atezolizumab is combined with Amatuximab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. Markham A: Atezolizumab: First Global Approval. Drugs. 2016 Aug;76(12):1227-32. doi: 10.1007/s40265-016-0618-8. [PubMed:27412122]
  2. Rosenberg JE, Hoffman-Censits J, Powles T, van der Heijden MS, Balar AV, Necchi A, Dawson N, O'Donnell PH, Balmanoukian A, Loriot Y, Srinivas S, Retz MM, Grivas P, Joseph RW, Galsky MD, Fleming MT, Petrylak DP, Perez-Gracia JL, Burris HA, Castellano D, Canil C, Bellmunt J, Bajorin D, Nickles D, Bourgon R, Frampton GM, Cui N, Mariathasan S, Abidoye O, Fine GD, Dreicer R: Atezolizumab in patients with locally advanced and metastatic urothelial carcinoma who have progressed following treatment with platinum-based chemotherapy: a single-arm, multicentre, phase 2 trial. Lancet. 2016 May 7;387(10031):1909-20. doi: 10.1016/S0140-6736(16)00561-4. Epub 2016 Mar 4. [PubMed:26952546]
  3. Stroh M, Winter H, Marchand M, Claret L, Eppler S, Ruppel J, Abidoye O, Teng SL, Lin WT, Dayog S, Bruno R, Jin J, Girish S: Clinical Pharmacokinetics and Pharmacodynamics of Atezolizumab in Metastatic Urothelial Carcinoma. Clin Pharmacol Ther. 2017 Aug;102(2):305-312. doi: 10.1002/cpt.587. Epub 2017 Jun 9. [PubMed:27981577]
  4. Tabrizi MA, Tseng CM, Roskos LK: Elimination mechanisms of therapeutic monoclonal antibodies. Drug Discov Today. 2006 Jan;11(1-2):81-8. doi: 10.1016/S1359-6446(05)03638-X. [PubMed:16478695]
  5. Mann, Janelle: Atezolizumab (Tecentriq®) Oncology Times. 2017 Feb 25;39(4):31.
  6. Raschi E, Mazzarella A, Antonazzo IC, Bendinelli N, Forcesi E, Tuccori M, Moretti U, Poluzzi E, De Ponti F: Toxicities with Immune Checkpoint Inhibitors: Emerging Priorities From Disproportionality Analysis of the FDA Adverse Event Reporting System. Target Oncol. 2019 Apr;14(2):205-221. doi: 10.1007/s11523-019-00632-w. [PubMed:30927173]
  7. FDA Approved Drug Products: Atezolizumab Intravenous Injection [Link]
External Links
KEGG Drug
D10773
PubChem Substance
347911207
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Atezolizumab
ATC Codes
L01XC32 — Atezolizumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (245 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
0Enrolling by InvitationBasic ScienceLung Cancer Non-Small Cell Cancer (NSCLC)1
0RecruitingBasic ScienceBreast Cancer1
0RecruitingDiagnosticRenal Cell Adenocarcinoma1
0RecruitingTreatmentBreast Cancer1
0RecruitingTreatmentClinical Stage II Esophageal Adenocarcinoma AJCC v8 / Clinical Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIA Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage IIB Esophageal Adenocarcinoma AJCC v8 / Clinical Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Clinical Stage III Esophageal Adenocarcinoma AJCC v8 / Clinical Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IC Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IC Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage II Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage II Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIB Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage III Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage III Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIA Gastroesophageal Junction Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Esophageal Adenocarcinoma AJCC v8 / Pathologic Stage IIIB Gastroesophageal Junction Adenocarcinoma AJCC v81
0TerminatedTreatmentTransitional Cell Carcinoma1
1Active Not RecruitingTreatmentAdvanced/Metastatic Solid Tumors / Tumors, Solid1
1Active Not RecruitingTreatmentAdvanced/Metastatic Tumors1
1Active Not RecruitingTreatmentBreast Cancer / Cervix Cancer / Endometrial Cancers / Ovarian Cancer1
1Active Not RecruitingTreatmentHER2 Positive Breast Cancers / Her2-negative Metastatic Breast Cancer / HER2-positive Metastatic Breast Cancer / Locally Advanced or Early Breast Cancer1
1Active Not RecruitingTreatmentHPV-Associated Cancers1
1Active Not RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer1
1Active Not RecruitingTreatmentLymphoma, Non-Hodgkin; Leukemai, Chronic Lymphocytic / Lymphoma, Non-Hodgkin; Leukemia, Chronic Lymphocytic / Non-Hodgkin's Lymphoma (NHL)1
1Active Not RecruitingTreatmentMalignancies1
1Active Not RecruitingTreatmentMalignant Lymphomas1
1Active Not RecruitingTreatmentMalignant Melanoma2
1Active Not RecruitingTreatmentMetastatic Hormone Refractory Prostate Cancer1
1Active Not RecruitingTreatmentMultiple Myeloma (MM)1
1Active Not RecruitingTreatmentNeoplasms, Gynecologic1
1Active Not RecruitingTreatmentNeoplasms / Tumors, Solid1
1Active Not RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
1Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentSolid Cancers2
1Active Not RecruitingTreatmentSolid Cancers / Tumors, Solid2
1Active Not RecruitingTreatmentStage I Non-Small Cell Lung Cancer1
1Active Not RecruitingTreatmentTumors, Solid1
1CompletedTreatmentCastrate-resistant Prostate Cancer (CRPC)1
1CompletedTreatmentColorectal Cancers1
1CompletedTreatmentLocally Advanced or Metastatic Solid Tumors or Hematologic Malignancies / Malignancies, Hematologic / Solid Cancers / Tumors1
1CompletedTreatmentMyelodysplastic Syndromes1
1CompletedTreatmentNeoplasms1
1CompletedTreatmentTumors, Solid1
1Not Yet RecruitingTreatmentAdult Solid Tumor1
1Not Yet RecruitingTreatmentCutaneous Melanoma1
1Not Yet RecruitingTreatmentInvasive Bladder Cancer1
1Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingOtherMetastatic Colorectal Cancers / Metastatic Triple Negative Breast Cancer1
1RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Positive Lymph Node / Stage IB2 Cervical Cancer AJCC v8 / Stage II Cervical Cancer AJCC v8 / Stage IIA Cervical Cancer AJCC v8 / Stage IIA1 Cervical Cancer AJCC v8 / Stage IIA2 Cervical Cancer AJCC v8 / Stage IIB Cervical Cancer AJCC v8 / Stage IIIB Cervical Cancer AJCC v8 / Stage IVA Cervical Cancer AJCC v81
1RecruitingTreatmentAdvanced Solid Tumors / Cervical Cancers / Colorectal Cancers / EGFR Positive Solid Tumor / Head and Neck Carcinoma / Hepatocellular,Carcinoma / Her2-Positive Breast Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Malignant Lymphomas / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Melanoma / Microsatellite Instability / Neuroendocrine Carcinoma of the Skin / Renal Cell Adenocarcinoma / Squamous Cell Carcinoma (SCC) / Transitional Cell Carcinoma1
1RecruitingTreatmentBiphasic Mesothelioma / Epithelioid Mesothelioma / Stage I Pleural Malignant Mesothelioma AJCC v7 / Stage IA Pleural Malignant Mesothelioma AJCC v7 / Stage IB Pleural Malignant Mesothelioma AJCC v7 / Stage II Pleural Malignant Mesothelioma AJCC v7 / Stage III Pleural Malignant Mesothelioma AJCC v71
1RecruitingTreatmentBladder Cancers / Colorectal Cancers / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma / Metastatic Castration Resistant Prostate Cancer / Prostate Cancer / Renal Cell Adenocarcinoma / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentBladder Cancers / Colorectal Cancers / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Other Solid Cancers / Renal Cancers / Triple Negative Breast Cancer (TNBC) / Tumors1
1RecruitingTreatmentBreast Cancer1
1RecruitingTreatmentCholangiocarcinoma Non-resectable / Cholangiocarcinoma, Extrahepatic / Cholangiocarcinoma, Intrahepatic / Gallbladder Adenocarcinoma1
1RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Lymphocytic Leukemia, Chronic, Lymphoma, Non Hodgkin / Non-Hodgkin's Lymphoma (NHL)1
1RecruitingTreatmentColorectal Cancers1
1RecruitingTreatmentHER2-positive Bladder Cancer / Her2-Positive Breast Cancer / HER2-positive Gastric Cancer / HER2-positive Solid Tumor1
1RecruitingTreatmentHematopoietic and Lymphoid Cell Neoplasm / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Unresectable Malignant Solid Neoplasm / Unresectable Solid Neoplasm1
1RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1RecruitingTreatmentMalignancies / Tumors, Solid1
1RecruitingTreatmentMetastatic Cancers / Tumors, Solid1
1RecruitingTreatmentMetastatic Lung Non-Small Cell Carcinoma / Refractory Lung Non-Small Cell Carcinoma / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Stage IV Lung Cancer AJCC v8 / Unresectable Lung Non-Small Cell Carcinoma1
1RecruitingTreatmentNeoplasms1
1RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)2
1RecruitingTreatmentOvarian Cancer1
1RecruitingTreatmentRecurrent B-Cell Non-Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma1
1RecruitingTreatmentRecurrent Diffuse Large B-Cell Lymphoma / Recurrent Transformed Non-Hodgkin Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Transformed Indolent Non-Hodgkin Lymphoma / Refractory Transformed Non-Hodgkin Lymphoma / Richter's Syndrome / Transformed Follicular Lymphoma to Diffuse Large B-Cell Lymphoma1
1RecruitingTreatmentTumors, Solid1
1RecruitingTreatmentUrothelial/Bladder Cancer, Nos1
1SuspendedTreatmentAsymptomatic Myeloma1
1TerminatedTreatmentAdvanced Ovarian Cancer / Triple Negative Breast Cancer (TNBC)1
1TerminatedTreatmentBladder Cancers / Clear-cell Metastatic Renal Cell Carcinoma / Genitourinary tract neoplasm / Head and Neck Carcinoma / Kidney Diseases / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms / Neoplasms by Histologic Type / Neoplasms, Kidney / Renal Cell Adenocarcinoma / Triple Negative Breast Cancer (TNBC) / Urologic Diseases / Urologic Neoplasms1
1TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / NSCLC (Non-small Cell Lung Carcinoma) / Transitional Cell Carcinoma / UC (Urothelial Cancer)1
1TerminatedTreatmentNon-Small Cell Lung Cancer Recurrent1
1, 2Active Not RecruitingTreatmentBladder Cancers / High-Risk Non-Muscle-Invasive Bladder Cancer1
1, 2Active Not RecruitingTreatmentBreast Cancer1
1, 2Active Not RecruitingTreatmentDiffuse Large B-Cell Lymphoma, Lymphoma Follicular / Diffuse Large B-Cell Lymphoma, Lymphoma, Follicular1
1, 2Active Not RecruitingTreatmentFollicular Lymphoma (FL)1
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Active Not RecruitingTreatmentMalignant Lymphomas1
1, 2Active Not RecruitingTreatmentMesothelin Positive / Stage III Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer AJCC v71
1, 2Active Not RecruitingTreatmentMultiple Myeloma (MM)1
1, 2Active Not RecruitingTreatmentRefractory Diffuse Large B Cell Lymphoma1
1, 2Active Not RecruitingTreatmentTransitional Cell Carcinoma1
1, 2Not Yet RecruitingTreatmentCutaneous Squamous Cell Carcinoma / Melanoma / Neuroendocrine Carcinoma of the Skin1
1, 2Not Yet RecruitingTreatmentExtensive-Stage Small Cell Lung Cancer / Tumors, Solid1
1, 2Not Yet RecruitingTreatmentMalignant Gliomas1
1, 2Not Yet RecruitingTreatmentMalignant Melanoma1
1, 2RecruitingHealth Services ResearchGlioblastoma Multiforme (GBM) / Metastatic Hormone Refractory Prostate Cancer / Tumors, Solid1
1, 2RecruitingTreatmentAcute Myeloid Leukemia With FMS-like Tyrosine Kinase (FLT3) Mutation / Leukemia Acute Myeloid Leukemia (AML)1
1, 2RecruitingTreatmentAdenocarcinoma of the Pancreas1
1, 2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Castration-Resistant Prostate Cancer (CRPC) / Colorectal Cancers / Differentiated Thyroid Cancer (DTC) / Endometrial Cancers / Head and Neck Carcinoma / Hepatocellular,Carcinoma / Lower Esophageal Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Ovarian Cancer / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentBladder Cancers / Metastatic Bladder Cancer / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentCancer, Advanced / Cervical Cancers / Esophageal Cancers / Hepatocellular,Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Melanoma / Renal Cell Adenocarcinoma / Squamous Cell Carcinoma of the Head and Neck (SCCHN) / Triple Negative Breast Cancer (TNBC)1
1, 2RecruitingTreatmentChronic Myelomonocytic Leukemia / Myelodysplastic Syndrome / Recurrent Acute Myeloid Leukemia With Myelodysplasia-Related Changes1
1, 2RecruitingTreatmentColorectal Cancers1
1, 2RecruitingTreatmentEsophageal Cancers / Head and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Selected Advanced Solid Tumors / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentEstrogen Receptor-positive / HER2/Neu Negative / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2RecruitingTreatmentGastric Adenocarcinoma or Gastroesophageal Junction Adenocarcinoma1
1, 2RecruitingTreatmentGlioblastoma, Adult1
1, 2RecruitingTreatmentGlioblastomas / Gliosarcoma / Malignant Neoplasms of Eye Brain and Other Parts of Central Nervous System1
1, 2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1, 2RecruitingTreatmentMalignant Neoplasm of Pancreas1
1, 2RecruitingTreatmentMetastatic Cancers / Renal Cancers1
1, 2RecruitingTreatmentNeoplasms1
1, 2RecruitingTreatmentNeoplasms, Breast1
1, 2RecruitingTreatmentNeoplasms, Ovarian / Ovarian Cancer1
1, 2RecruitingTreatmentRectal Neoplasms1
1, 2RecruitingTreatmentSolid Cancers1
1, 2RecruitingTreatmentTransitional Cell Carcinoma3
1, 2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1, 2SuspendedTreatmentPlatinum-Resistant Fallopian Tube Carcinoma / Platinum-Resistant Ovarian Carcinoma / Platinum-Resistant Primary Peritoneal Carcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
1, 2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2TerminatedTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
1, 2TerminatedTreatmentTumors, Solid1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Recurrent, IV-B Cervical cancer / Stage IV Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v71
2Active Not RecruitingTreatmentAdvanced Gynecological Cancers / Cervical Cancers / Ovarian Cancer / Uterine Malignancies1
2Active Not RecruitingTreatmentAdvanced Non-Clear Cell Kidney Cancer1
2Active Not RecruitingTreatmentBladder Cancers3
2Active Not RecruitingTreatmentBladder Cancers / Carcinoma, Transitional Cell , Bladder Cancer, Bladder Tumors, Urinary Bladder Neoplasms1
2Active Not RecruitingTreatmentBreast Cancer1
2Active Not RecruitingTreatmentCarcinoma of Gallbladder / Intrahepatic Cholangiocarcinoma / Non-Resectable Cholangiocarcinoma / Recurrent Cholangiocarcinoma / Stage IV Intrahepatic Cholangiocarcinoma AJCC v8 / Unresectable Cholangiocarcinoma1
2Active Not RecruitingTreatmentColorectal Cancers1
2Active Not RecruitingTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Invasive Breast Carcinoma / Progesterone Receptor Negative / Stage II Breast Cancer AJCC v6 and v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Triple-Negative Breast Carcinoma1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Small Cell Lung Cancer Extensive Stage / Small Cell Lung Cancer Limited Stage1
2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2Active Not RecruitingTreatmentMetastatic Colorectal Carcinoma / Recurrent Colorectal Carcinoma / Refractory Colorectal Carcinoma / Stage IV Colorectal Cancer / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
2Active Not RecruitingTreatmentMetastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic1
2Active Not RecruitingTreatmentRecurrent Bladder Urothelial Carcinoma / Stage 0a Bladder Urothelial Carcinoma / Stage 0a Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage 0is Bladder Urothelial Carcinoma / Stage 0is Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage I Bladder Cancer With Carcinoma In Situ / Stage I Bladder Urothelial Carcinoma / Stage I Bladder Urothelial Carcinoma AJCC v6 and v71
2Active Not RecruitingTreatmentTransitional Cell Carcinoma1
2Active Not RecruitingTreatmentTumors, Solid1
2Active Not RecruitingTreatmentTumors / Tumors, Solid1
2CompletedTreatmentLiposarcoma / Locally Advanced Sarcoma / Metastatic Sarcoma / Myxoid/Round Cell Liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Sarcomas / Synovial Sarcoma1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)4
2CompletedTreatmentRenal Cell Adenocarcinoma1
2Not Yet RecruitingDiagnosticBladder Cancer, Metastatic / Bladder Cancers1
2Not Yet RecruitingTreatmentAdenocarcinoma, Prostate1
2Not Yet RecruitingTreatmentAnal canal neoplasms malignant / Cervical Cancers / Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
2Not Yet RecruitingTreatmentBiliary Tract Cancer / Esophageal Cancers / Gastrooesophageal Cancer / Hepatobiliary Neoplasms1
2Not Yet RecruitingTreatmentBladder Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Melanoma / Solid Tumor, Adult / Triple Negative Breast Cancer (TNBC) / Virus-associated Tumors1
2Not Yet RecruitingTreatmentCLL Transformation1
2Not Yet RecruitingTreatmentEarly-Stage Breast Cancer / Her2-Positive Breast Cancer1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2Not Yet RecruitingTreatmentMalignant Pleural Mesothelioma, Advanced / Malignant Pleural Mesothelioma, Unresectable1
2Not Yet RecruitingTreatmentMelanoma1
2Not Yet RecruitingTreatmentNSCLC Stage IIIB~IV1
2Not Yet RecruitingTreatmentNon-small-cell Lung Cancer Patients1
2Not Yet RecruitingTreatmentPancreatic Ductal Adenocarcinoma1
2Not Yet RecruitingTreatmentRadiosurgery / Sarcomas1
2Not Yet RecruitingTreatmentRectal Carcinoma1
2RecruitingOtherBreast Cancer / Estrogen Receptor-Positive Breast Cancer1
2RecruitingTreatmentALK Gene Rearrangement Positive / EGFR Gene Mutations / NSCLC Stage IIIB / NSCLC Stage IV / ROS1 Gene Mutation1
2RecruitingTreatmentAdenocarcinoma, Prostate1
2RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer2
2RecruitingTreatmentAdvanced Solid Tumors1
2RecruitingTreatmentAdvanced/Metastatic Head and Neck, Oesophageal and Cervical Cancers / Tumors, Solid1
2RecruitingTreatmentAlveolar Soft Part Sarcoma (ASPS) / Metastatic Alveolar Soft Part Sarcoma1
2RecruitingTreatmentAnal Carcinoma1
2RecruitingTreatmentAnaplastic Thyroid Carcinoma / Malignant Neoplasms of Thyroid and Other Endocrine Glands / Metastatic Thyroid Gland Carcinoma / Poorly Differentiated Thyroid Cancer / Poorly Differentiated Thyroid Gland Carcinoma / Stage IVA Thyroid Gland Anaplastic Carcinoma AJCC v8 / Stage IVB Thyroid Gland Anaplastic Carcinoma AJCC v8 / Stage IVC Thyroid Gland Anaplastic Carcinoma AJCC v8 / Thyroid Gland Anaplastic Carcinoma / Unresectable Thyroid Gland Carcinoma1
2RecruitingTreatmentAppendiceal Adenocarcinoma / Cutaneous Squamous Cell Carcinoma / Locally Advanced Malignant Neoplasm / Malignant Neoplasms of Digestive Organs / Melanoma and Other Malignant Neoplasms of Skin / Metastatic Malignant Neoplasm / Rare Lesion / Rare Neoplastic Syndrome / Refractory Malignant Neoplasm / Skin Squamous Cell Carcinoma / Small Bowel Adenocarcinoma / Unresectable Malignant Neoplasm1
2RecruitingTreatmentAppendix Adenocarcinoma / Human Papillomavirus-Related Anal Squamous Cell Carcinoma / Human Papillomavirus-Related Cervical Squamous Cell Carcinoma / Human Papillomavirus-Related Squamous Cell Carcinoma of the Penis / Human Papillomavirus-Related Vulvar Squamous Cell Carcinoma / Malignant Neoplasms of Digestive Organs / Malignant Neoplasms of Lip Oral Cavity and Pharynx / Malignant Neoplasms of Mesothelial and Soft Tissue / Malignant Neoplasms of Respiratory and Intrathoracic Organs / Neuroendocrine Carcinomas / Progressive Neuroendocrine Tumors of pancreatic origin / Recurrent Merkel Cell Carcinoma / Recurrent Nasopharynx Carcinoma / Recurrent Peritoneal Malignant Mesothelioma / Recurrent Pleural Malignant Mesothelioma / Stage III Merkel Cell Carcinoma AJCC v7 / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Pleural Malignant Mesothelioma AJCC v7 / Stage IV Merkel Cell Carcinoma AJCC v7 / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Pleural Malignant Mesothelioma AJCC v7 / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma AJCC v7 / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified1
2RecruitingTreatmentBRAF V600 Wild Type / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Intracranial Melanoma / Melanoma and Other Malignant Neoplasms of Skin / Metastatic Malignant Neoplasm in the Brain / Metastatic Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Refractory Melanoma1
2RecruitingTreatmentBRCA1 Gene Mutation / Brca2 Gene Mutation / Estrogen Receptor Negative / HER2/Neu Negative / Homologous Recombination Deficiency / Locally Advanced Unresectable Breast Carcinoma / Metastatic Breast Carcinoma / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v7 / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentBiliary Cancer / Bladder Cancers / Neoplasms / Salivary Cancer / Tumors, Solid1
2RecruitingTreatmentBladder Cancers1
2RecruitingTreatmentBladder Cancers / Breast Cancer / Cancer of the Urinary Tract / Locally Advanced or Metastatic Solid Tumors / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2RecruitingTreatmentBladder Cancers / Head/Neck Cancers / Lung Cancers / Melanoma Cancers / Metastatic Cancers / Renal Cancers1
2RecruitingTreatmentBreast Adenocarcinoma / Breast Cancer / Estrogen Receptor Negative / HER2/Neu Negative / Invasive Breast Carcinoma / Progesterone Receptor Negative / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentBreast Cancer5
2RecruitingTreatmentBreast Cancer Invasive Nos / HER2 negative / Stage IV Breast Cancer / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentBreast Cancer / Neoplasms Metastasis1
2RecruitingTreatmentBreast Cancer / Renal Cell Adenocarcinoma1
2RecruitingTreatmentBreast Cancer / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentCancer of Unknown Primary Site1
2RecruitingTreatmentCarcinoma NOS / Head and Neck Carcinoma / Malignancies / Squamous Cell Carcinoma (SCC)1
2RecruitingTreatmentCentral Nervous System Metastases / HER2-positive Metastatic Breast Cancer1
2RecruitingTreatmentCervical Cancer Metastatic / Cervical Cancers / Recurrent Cervical Cancer1
2RecruitingTreatmentCervical Cancers1
2RecruitingTreatmentCervical Cancers / Colorectal Cancers / Head and Neck Squamous Cell Carcinoma (HNSCC) / Hepatocellular,Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Malignant Neoplasm of Stomach / Melanoma / Microsatellite Instability / Mismatch Repair Deficiency / Neuroendocrine Carcinoma of the Skin / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Chronic Lymphocytic Leukemia (CLL) - Refractory / Chronic, recurrent Lymphocytic Leukemia / Loss of Chromosome 11q / Loss of Chromosome 17p / Recurrent Small Lymphocytic Lymphoma / Recurrent Transformed Chronic Lymphocytic Leukemia / Refractory Small Lymphocytic Lymphoma / Refractory Transformed Chronic Lymphocytic Leukemia / Richter's Syndrome / Small Lymphocytic Lymphoma (SLL) / TP53 Gene Mutation / Untreated Chronic Lymphocytic Leukemia / Untreated Small Lymphocytic Lymphoma1
2RecruitingTreatmentClinical Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIA Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v81
2RecruitingTreatmentColonic Neoplasms / Neoplasms Metastasis / Neoplasms, Colorectal / Rectal Neoplasms1
2RecruitingTreatmentCancer treatment / Colorectal Cancers / MSI / Resistance, APC1
2RecruitingTreatmentEGFR Activating Mutation / NSCLC Stage IIIB / NSCLC Stage IV1
2RecruitingTreatmentEdema / Erythemas / Malignant Neoplasm of Breast / Peau d'orange / Recurrent Inflammatory Breast Carcinoma / Stage IV Inflammatory Breast Carcinoma1
2RecruitingTreatmentEndometrial Cancers1
2RecruitingTreatmentEndometrial Cancers / Uterine Carcinosarcoma1
2RecruitingTreatmentEsophageal Cancer Stage III / Esophageal Cancer, Stage II1
2RecruitingTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Carcinoma1
2RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Marginal Zone Lymphoma / Mucosa Associated Lymphoid Tissue1
2RecruitingTreatmentGastro Esophageal Junction Cancer / Malignant Neoplasm of Stomach1
2RecruitingTreatmentHer2-Positive Breast Cancer1
2RecruitingTreatmentKRAS Gene Mutation / Recurrent Lung Non-Small Cell Carcinoma / Recurrent Non-Small Cell Lung Carcinoma / Refractory Lung Non-Small Cell Carcinoma / Stage IV Lung Non-Small Cell Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer AJCC v71
2RecruitingTreatmentLocally Advanced Cervical Cancer1
2RecruitingTreatmentLocally Advanced / Transitional Cell Carcinoma / Unresectable1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)10
2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Refractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma1
2RecruitingTreatmentLymphoma, T-Cell, Cutaneous / Mycosis Fungoides/Sezary Syndrome / Mycosis fungoides; sezary syndrome1
2RecruitingTreatmentMalignant Lymphomas1
2RecruitingTreatmentMalignant Melanoma2
2RecruitingTreatmentMesothelioma, Malignant1
2RecruitingTreatmentMetastatic Alveolar Soft Part Sarcoma1
2RecruitingTreatmentMetastatic Bladder Urothelial Carcinoma / Metastatic Renal Pelvis Urothelial Carcinoma / Metastatic Ureter Urothelial Carcinoma / Metastatic Ureteral Neoplasm / Metastatic Urethral Neoplasm / Metastatic Urethral Urothelial Carcinoma / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Recurrent Bladder Urothelial Carcinoma / Recurrent Renal Pelvis Urothelial Carcinoma / Recurrent Ureter Urothelial Carcinoma / Recurrent Urethral Urothelial Carcinoma / Stage III Bladder Cancer AJCC v8 / Stage III Renal Pelvis Cancer AJCC v8 / Stage III Ureter Cancer AJCC v8 / Stage III Urethral Cancer AJCC v8 / Stage IV Bladder Cancer AJCC v8 / Stage IV Renal Pelvis Cancer AJCC v8 / Stage IV Ureter Cancer AJCC v8 / Stage IV Urethral Cancer AJCC v8 / Stage IVA Bladder Cancer AJCC v8 / Stage IVB Bladder Cancer AJCC v8 / Transitional Cell Carcinoma / Urothelial carcinoma ureter metastatic1
2RecruitingTreatmentMetastatic Colorectal Cancers1
2RecruitingTreatmentMetastatic Melanoma1
2RecruitingTreatmentNSCLC Stage IV / NSCLC, Recurrent1
2RecruitingTreatmentNeoplasms, Head and Neck1
2RecruitingTreatmentNeoplasms, Ovarian1
2RecruitingTreatmentPatients With Metastatic Tumours1
2RecruitingTreatmentPenile Cancer1
2RecruitingTreatmentSafety Issues1
2RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2RecruitingTreatmentTransitional Cell Carcinoma4
2RecruitingTreatmentRefractory Small cell lung cancer1
2SuspendedTreatmentMetastatic Kidney Carcinoma / Metastatic Renal Cell Cancer / Recurrent Lung Non-Small Cell Carcinoma / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Skin Melanoma1
2SuspendedTreatmentRecurrent Bladder Urothelial Carcinoma / Recurrent Renal Pelvis and Ureter Urothelial Carcinoma / Recurrent Urethral Urothelial Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer / Stage III Urethral Cancer AJCC v7 / Stage IV Bladder Urothelial Carcinoma / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer / Stage IV Urethral Cancer AJCC v7 / Ureter Urothelial Carcinoma / Urothelial carcinoma ureter metastatic1
2TerminatedTreatmentLymphoma, Hodgkins1
2TerminatedTreatmentTransitional Cell Carcinoma1
2WithdrawnBasic ScienceMetastatic Colorectal Cancers1
2WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2, 3RecruitingTreatmentLimited Stage Lung Small Cell Carcinoma / Limited Stage Small Cell Lung Carcinoma / Stage I Lung Cancer AJCC v8 / Stage IA1 Lung Cancer AJCC v8 / Stage IA2 Lung Cancer AJCC v8 / Stage IA3 Lung Cancer AJCC v8 / Stage IB Lung Cancer AJCC v8 / Stage II Lung Cancer AJCC v8 / Stage IIA Lung Cancer AJCC v8 / Stage IIB Lung Cancer AJCC v8 / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v81
2, 3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2, 3SuspendedTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Undifferentiated Carcinoma / High Grade Fallopian Tube Serous Adenocarcinoma / High Grade Ovarian Serous Adenocarcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Undifferentiated Carcinoma / Platinum-Resistant Ovarian Carcinoma / Primary Peritoneal High Grade Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
3Active Not RecruitingTreatmentAbdominal wall neoplasm / Fallopian Tube Cancer / Ovarian Cancer1
3Active Not RecruitingTreatmentAdvanced BRAFV600 Wild-type Melanoma1
3Active Not RecruitingTreatmentBladder Cancer, Cancer / Transitional Cell Carcinoma1
3Active Not RecruitingTreatmentCarcinoma, Non-Squamous Non-Small Cell Lung / Lung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentHepatocellular,Carcinoma1
3Active Not RecruitingTreatmentInvasive Ductal Breast Carcinoma1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Small Cell Lung Carcinoma1
3Active Not RecruitingTreatmentMelanoma1
3Active Not RecruitingTreatmentMetastatic Breast Cancer, Triple Negative Breast Cancer / Triple Negative Breast Cancer (TNBC)1
3Active Not RecruitingTreatmentNon-Squamous Non-Small Cell Lung Cancer / Non-Squamous Non-Small Cell Lung Cancer, Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentOvarian Cancer1
3Active Not RecruitingTreatmentProstatic Neoplasms, Castration-Resistant1
3Active Not RecruitingTreatmentRenal Cell Adenocarcinoma2
3Active Not RecruitingTreatmentTransitional Cell Carcinoma1
3Active Not RecruitingTreatmentUrinary Tract Cancers1
3CompletedTreatmentBladder Cancers1
3CompletedTreatmentColorectal Cancers1
3CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer1
3Not Yet RecruitingTreatmentAdvanced Solid Tumors / Anal Carcinoma / Bladder Cancers / Cholangiocarcinomas / Colorectal Cancers / Hepatocellular,Carcinoma / HNSCC / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Stomach / Melanoma / Renal Cancers1
3Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
3Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3Not Yet RecruitingTreatmentTriple-Negative Breast Cancer (TNBC)1
3RecruitingOtherBreast Cancer Invasive Nos1
3RecruitingTreatmentBladder Cancers1
3RecruitingTreatmentBladder Carcinoma Infiltrating the Muscle of the Bladder Wall / Bladder Urothelial Carcinoma / Stage II Bladder Cancer AJCC v8 / Stage III Bladder Cancer AJCC v8 / Stage IIIA Bladder Cancer AJCC v81
3RecruitingTreatmentBreast Adenocarcinoma / HER2/Neu Positive / Metastatic Breast Carcinoma / Recurrent Breast Carcinoma / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v71
3RecruitingTreatmentBreast Cancer1
3RecruitingTreatmentCarcinoma of the Cervix, Stage IVB1
3RecruitingTreatmentColon Adenocarcinoma / DNA Repair Disorder / Lynch Syndrome / Microsatellite Instability / Stage III Colon Cancer AJCC v7 / Stage IIIA Colon Cancer / Stage IIIA Colon Cancer AJCC v7 / Stage IIIB Colon Cancer / Stage IIIB Colon Cancer AJCC v7 / Stage IIIC Colon Cancer / Stage IIIC Colon Cancer AJCC v71
3RecruitingTreatmentColorectal Adenocarcinoma / High-Frequency Microsatellite Instability / Mismatch Repair Deficiency / Stage IV Colorectal Cancer / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
3RecruitingTreatmentEndometrial Cancers1
3RecruitingTreatmentHepatocellular,Carcinoma1
3RecruitingTreatmentLocally Advanced Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non Small Cell Lung Cancer Metastatic / Non-Small Cell Carcinoma of Lung, TNM Stage 41
3RecruitingTreatmentMalignancies1
3RecruitingTreatmentNon Small Cell Lung Cancer Metastatic1
3RecruitingTreatmentNon-Small-Cell Lung1
3RecruitingTreatmentPleural Mesothelioma Malignant Advanced1
3RecruitingTreatmentRecurrent Ovarian Carcinoma2
3RecruitingTreatmentSmall Cell Lung Carcinoma1
3RecruitingTreatmentTriple Negative Breast Cancer (TNBC)2
3RecruitingTreatmentTriple Negative Breast Neoplasms1
3RecruitingTreatmentTriple-Negative Breast Cancer (TNBC)2
3TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer1
3WithdrawnTreatmentRenal Cell Adenocarcinoma1
4Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
4Approved for MarketingNot AvailableTransitional Cell Carcinoma1
4Not Yet RecruitingDiagnosticLung neoplasm malignant1
4RecruitingTreatmentMalignancies1
Not AvailableNot Yet RecruitingNot AvailableBreast Cancer1
Not AvailableNot Yet RecruitingNot AvailableImmune-Related Adverse Events / Lung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableNot Yet RecruitingNot AvailableLung Cancers / Melanoma / Renal Cancers1
Not AvailableNot Yet RecruitingNot AvailableTransitional Cell Carcinoma1
Not AvailableNot Yet RecruitingTreatmentTransitional Cell Carcinoma1
Not AvailableRecruitingNot AvailableBladder Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableRecruitingNot AvailableImmunotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metagenome / Microbiome / Renal Cell Adenocarcinoma1
Not AvailableRecruitingNot AvailableImmunotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Neoantigens / Neoepitopes / Next Generation Sequencing (NGS) / Personalized Neoantigen Cancer Vaccine1
Not AvailableRecruitingNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC)2
Not AvailableRecruitingNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancer Small Cell Lung Cancer (SCLC) / Transitional Cell Carcinoma1
Not AvailableTerminatedNot AvailableTransitional Cell Carcinoma1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solutionIntravenous1200 mg/20mL
Injection, solutionIntravenous840 mg/14mL
SolutionIntravenous1200 mg
SolutionIntravenous840 mg
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
PropertyValueSource
melting point (°C)78 Ji-Hee, et al. Front Immunol, 7:394 (2016)
boiling point (°C) Fab and Fc domains denaturates at 60 and 70 ºC respectively Arnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404
water solubility50mg/mL Human IgG purified. Product Information
isoelectric point6.6-7.2 Jin, et al. Electrophoresis. Sep;23(19):3385-91. (2002).

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antibody
General Function
Not Available
Specific Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell ...
Gene Name
CD274
Uniprot ID
Q9NZQ7
Uniprot Name
Programmed cell death 1 ligand 1
Molecular Weight
33275.095 Da
References
  1. Markham A: Atezolizumab: First Global Approval. Drugs. 2016 Aug;76(12):1227-32. doi: 10.1007/s40265-016-0618-8. [PubMed:27412122]
  2. Rosenberg JE, Hoffman-Censits J, Powles T, van der Heijden MS, Balar AV, Necchi A, Dawson N, O'Donnell PH, Balmanoukian A, Loriot Y, Srinivas S, Retz MM, Grivas P, Joseph RW, Galsky MD, Fleming MT, Petrylak DP, Perez-Gracia JL, Burris HA, Castellano D, Canil C, Bellmunt J, Bajorin D, Nickles D, Bourgon R, Frampton GM, Cui N, Mariathasan S, Abidoye O, Fine GD, Dreicer R: Atezolizumab in patients with locally advanced and metastatic urothelial carcinoma who have progressed following treatment with platinum-based chemotherapy: a single-arm, multicentre, phase 2 trial. Lancet. 2016 May 7;387(10031):1909-20. doi: 10.1016/S0140-6736(16)00561-4. Epub 2016 Mar 4. [PubMed:26952546]
  3. FDA Approved Drug Products: Atezolizumab Intravenous Injection [Link]

Drug created on May 19, 2016 09:42 / Updated on November 20, 2019 12:32