Atezolizumab

Identification

Name
Atezolizumab
Accession Number
DB11595
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Atezolizumab is an Fc-engineered, humanized, monoclonal antibody that binds to Programmed Death Ligand 1 (PD-L1) and blocks its interactions with the receptors B7.1 (also known as CD80) and Programmed Death 1 (PD-1). The binding of PD-L1 to PD-1 or B7.1 on activated T cells causes an inhibitory signal to suppress their production in the lymph nodes, thereby preventing immune responses to events such as pregnancy or autoimmune disease. This pathway is also utilized by cancer cells to evade the immune system through evasion of anti-tumor T-cell response. Furthermore, over-expression of PD-L1 and PD-1 has been linked to increased tumour aggressiveness and poorer prognosis.

Currently the only antibody against PD-L1 and available as the product Tecentriq (FDA), atezolizumab is indicated for the treatment of locally advanced or metastatic urothelial carcinoma.

Protein chemical formula
Not Available
Protein average weight
145000.0 Da
Sequences
>Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYAST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYLYHPATFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
Not Available
External IDs
MPDL-3280A / MPDL3280A / RG-7446 / RG7446
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
TecentriqSolution60 mgIntravenousHoffmann La Roche2017-05-02Not applicableCanada
TecentriqInjection, solution1200 mg/20mLIntravenousGenentech, Inc.2016-05-18Not applicableUs
Categories
UNII
52CMI0WC3Y
CAS number
1380723-44-3

Pharmacology

Indication

For the treatment of patients with locally advanced or metastatic urothelial carcinoma who: 1) have disease progression during or following platinum-containing chemotherapy, and 2) have disease progression within 12 months of neoadjuvant or adjuvant treatment with platinum-containing chemotherapy.

Associated Conditions
Pharmacodynamics
Not Available
Mechanism of action

Atezolizumab is a monoclonal antibody that binds to PD-L1 and blocks its interactions with both PD-1 and B7.1 receptors. This prevents PD-L1/PD-1 mediated inhibition of the immune response, including activation of the anti-tumor immune response without inducing antibody-dependent cellular cytotoxicity.

TargetActionsOrganism
AProgrammed cell death 1 ligand 1
antibody
Human
Absorption

The population PK analysis suggests steady state is obtained after 6 to 9 weeks (2 to 3 cycles) of repeated dosing. The systemic accumulation in area under the curve (AUC), maximum concentration (Cmax) and trough concentration (Cmin) was 1.91, 1.46 and 2.75-fold, respectively.

Volume of distribution

6.9 L

Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

27 days

Clearance

0.20 L/day

Toxicity

Most common adverse reactions (≥ 20% of patients) included: fatigue, decreased appetite, nausea, urinary tract infection, pyrexia, and constipation.

Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Atezolizumab.
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Atezolizumab.
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Atezolizumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Atezolizumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Atezolizumab.
AncestimThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Atezolizumab.
Anthrax immune globulin humanThe therapeutic efficacy of Anthrax immune globulin human can be decreased when used in combination with Atezolizumab.
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Antithymocyte immunoglobulin (rabbit) is combined with Atezolizumab.
Bacillus calmette-guerin substrain connaught live antigenThe therapeutic efficacy of Bacillus calmette-guerin substrain connaught live antigen can be decreased when used in combination with Atezolizumab.
Bacillus calmette-guerin substrain tice live antigenThe therapeutic efficacy of Bacillus calmette-guerin substrain tice live antigen can be decreased when used in combination with Atezolizumab.
Food Interactions
Not Available

References

General References
  1. Markham A: Atezolizumab: First Global Approval. Drugs. 2016 Aug;76(12):1227-32. doi: 10.1007/s40265-016-0618-8. [PubMed:27412122]
  2. Rosenberg JE, Hoffman-Censits J, Powles T, van der Heijden MS, Balar AV, Necchi A, Dawson N, O'Donnell PH, Balmanoukian A, Loriot Y, Srinivas S, Retz MM, Grivas P, Joseph RW, Galsky MD, Fleming MT, Petrylak DP, Perez-Gracia JL, Burris HA, Castellano D, Canil C, Bellmunt J, Bajorin D, Nickles D, Bourgon R, Frampton GM, Cui N, Mariathasan S, Abidoye O, Fine GD, Dreicer R: Atezolizumab in patients with locally advanced and metastatic urothelial carcinoma who have progressed following treatment with platinum-based chemotherapy: a single-arm, multicentre, phase 2 trial. Lancet. 2016 May 7;387(10031):1909-20. doi: 10.1016/S0140-6736(16)00561-4. Epub 2016 Mar 4. [PubMed:26952546]
  3. Chang SS: Re: MPDL3280A (Anti-PD-L1) Treatment Leads to Clinical Activity in Metastatic Bladder Cancer. J Urol. 2015 Oct;194(4):956. doi: 10.1016/j.juro.2015.07.017. Epub 2015 Jul 10. [PubMed:26382775]
  4. Thompson RH, Gillett MD, Cheville JC, Lohse CM, Dong H, Webster WS, Krejci KG, Lobo JR, Sengupta S, Chen L, Zincke H, Blute ML, Strome SE, Leibovich BC, Kwon ED: Costimulatory B7-H1 in renal cell carcinoma patients: Indicator of tumor aggressiveness and potential therapeutic target. Proc Natl Acad Sci U S A. 2004 Dec 7;101(49):17174-9. Epub 2004 Nov 29. [PubMed:15569934]
External Links
KEGG Drug
D10773
PubChem Substance
347911207
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Atezolizumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (245 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
0Active Not RecruitingTreatmentTransitional Cell Carcinoma1
0RecruitingBasic ScienceLung Cancer Non-Small Cell Cancer (NSCLC)1
1Active Not RecruitingBasic ScienceAdvanced/Metastatic Solid Tumors1
1Active Not RecruitingTreatmentCancer of the Ovary / Cancer, Breast / Cervix Cancer / Endometrial Cancers1
1Active Not RecruitingTreatmentCancers1
1Active Not RecruitingTreatmentCastrate-resistant Prostate Cancer (CRPC)1
1Active Not RecruitingTreatmentColorectal Cancers1
1Active Not RecruitingTreatmentHER2 Positive Breast Cancers / Her2-negative Metastatic Breast Cancer / HER2-positive Metastatic Breast Cancer / Locally Advanced or Early Breast Cancer1
1Active Not RecruitingTreatmentLocally Advanced or Metastatic Solid Tumors or Hematologic Malignancies / Malignancies, Hematologic / Solid Cancers / Tumors1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer1
1Active Not RecruitingTreatmentMalignant Lymphomas1
1Active Not RecruitingTreatmentMalignant Melanoma1
1Active Not RecruitingTreatmentNeoplasms1
1Active Not RecruitingTreatmentNeoplasms / Tumors, Solid1
1Active Not RecruitingTreatmentSolid Cancers1
1Active Not RecruitingTreatmentTumors, Solid2
1Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1Not Yet RecruitingTreatmentUrothelial/Bladder Cancer, Nos1
1RecruitingBasic ScienceSoft Tissue Sarcoma Adult1
1RecruitingOtherMetastatic Colorectal Cancers / Metastatic Triple Negative Breast Cancer1
1RecruitingTreatmentAdvanced Ovarian Cancer / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentAdvanced/Metastatic Tumors1
1RecruitingTreatmentBiphasic Mesothelioma / Epithelioid Mesothelioma / Stage I Pleural Malignant Mesothelioma AJCC v7 / Stage IA Pleural Malignant Mesothelioma AJCC v7 / Stage IB Pleural Malignant Mesothelioma AJCC v7 / Stage II Pleural Malignant Mesothelioma AJCC v7 / Stage III Pleural Malignant Mesothelioma AJCC v71
1RecruitingTreatmentBladder Cancers / Colorectal Cancers / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Melanoma / Metastatic Castration Resistant Prostate Cancer / Prostate Cancer / Renal Cell Adenocarcinoma / Triple Negative Breast Cancer (TNBC)1
1RecruitingTreatmentBladder Cancers / Colorectal Cancers / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Other Solid Cancers / Renal Cancers / Triple Negative Breast Cancer (TNBC) / Tumors1
1RecruitingTreatmentCholangiocarcinoma Non-resectable / Cholangiocarcinoma, Extrahepatic / Cholangiocarcinoma, Intrahepatic / Gallbladder Adenocarcinoma1
1RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Lymphocytic Leukemia, Chronic, Lymphoma, Non Hodgkin / Non Hodgkin Lymphoma (NHL)1
1RecruitingTreatmentHPV-Associated Cancers1
1RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms / Renal Cell Adenocarcinoma / Urothelial Neoplasm1
1RecruitingTreatmentHematopoietic and Lymphoid Cell Neoplasm / Metastatic Malignant Solid Neoplasm / Metastatic Solid Neoplasm / Unresectable Solid Neoplasm1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms Metastasis / Urinary Bladder Neoplasms1
1RecruitingTreatmentLymphoma, Non-Hodgkin; Leukemai, Chronic Lymphocytic / Non-Hodgkin's Lymphoma (NHL)1
1RecruitingTreatmentMalignant Melanoma1
1RecruitingTreatmentMetastatic Hormone Refractory Prostate Cancer1
1RecruitingTreatmentNeoplasms1
1RecruitingTreatmentNeoplasms, Gynecologic1
1RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
1RecruitingTreatmentRecurrent Diffuse Large B-Cell Lymphoma / Refractory Diffuse Large B Cell Lymphoma / Refractory Transformed Indolent Non-Hodgkin Lymphoma / Refractory Transformed Non-Hodgkin Lymphoma / Transformed Follicular Lymphoma to Diffuse Large B-Cell Lymphoma1
1RecruitingTreatmentRecurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
1RecruitingTreatmentRenal Cell Adenocarcinoma1
1RecruitingTreatmentRenal Pelvis Neoplasms / Transitional Cell Carcinoma / Ureteral Neoplasms / Urethral Neoplasms / Urinary Bladder Neoplasms / Urologic Neoplasms / Urothelial Cancer1
1RecruitingTreatmentSolid Cancers1
1RecruitingTreatmentSolid Cancers / Tumors, Solid2
1RecruitingTreatmentStage I Non-Small Cell Lung Cancer1
1RecruitingTreatmentTumors, Solid1
1SuspendedTreatmentAsymptomatic Myeloma1
1SuspendedTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1SuspendedTreatmentMyelodysplastic Syndromes1
1TerminatedTreatmentBladder Cancers / Clear-cell Metastatic Renal Cell Carcinoma / Genitourinary tract neoplasm / Head and Neck Carcinoma / Kidney Diseases / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma / Neoplasms / Neoplasms by Histologic Type / Neoplasms, Kidney / Renal Cell Adenocarcinoma / Triple Negative Breast Cancer (TNBC) / Urologic Diseases / Urologic Neoplasms1
1TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / NSCLC (Non-small Cell Lung Carcinoma) / Transitional Cell Carcinoma / UC (Urothelial Cancer)1
1TerminatedTreatmentNon-Small Cell Lung Cancer Recurrent1
1, 2Active Not RecruitingTreatmentDiffuse Large B-Cell Lymphoma, Lymphoma Follicular / Diffuse Large B-Cell Lymphoma, Lymphoma, Follicular1
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Active Not RecruitingTreatmentMalignant Lymphomas1
1, 2Active Not RecruitingTreatmentTumors, Solid1
1, 2CompletedPreventionLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2RecruitingTreatmentAdenocarcinoma of the Pancreas1
1, 2RecruitingTreatmentBladder Cancers / High-Risk Non-Muscle-Invasive Bladder Cancer1
1, 2RecruitingTreatmentBladder Cancers / Metastatic Bladder Cancer / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentCancer of the Ovary / Neoplasms, Ovarian1
1, 2RecruitingTreatmentCancer, Breast1
1, 2RecruitingTreatmentCastration-Resistant Prostate Cancer (CRPC) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Renal Cell Adenocarcinoma / Transitional Cell Carcinoma1
1, 2RecruitingTreatmentChronic Myelomonocytic Leukemia / Myelodysplastic Syndrome / Recurrent Acute Myeloid Leukemia With Myelodysplasia-Related Changes1
1, 2RecruitingTreatmentColorectal Cancers1
1, 2RecruitingTreatmentEstrogen Receptor-positive / HER2/Neu Negative / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2RecruitingTreatmentGastric Adenocarcinoma or Gastroesophageal Junction Adenocarcinoma1
1, 2RecruitingTreatmentGlioblastoma, Adult1
1, 2RecruitingTreatmentGlioblastomas / Gliosarcoma / Malignant Neoplasms of Eye Brain and Other Parts of Central Nervous System1
1, 2RecruitingTreatmentLeukemia Acute Myeloid Leukemia (AML)1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2RecruitingTreatmentMesothelin Positive / Stage III Non-Small Cell Lung Cancer AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Non-Small Cell Lung Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer AJCC v71
1, 2RecruitingTreatmentMetastatic Cancers / Renal Cancers1
1, 2RecruitingTreatmentMultiple Myeloma (MM)1
1, 2RecruitingTreatmentNeoplasms1
1, 2RecruitingTreatmentNeoplasms, Breast1
1, 2RecruitingTreatmentRectal Neoplasms1
1, 2RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
1, 2RecruitingTreatmentRefractory Diffuse Large B Cell Lymphoma1
1, 2RecruitingTreatmentTransitional Cell Carcinoma2
1, 2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1, 2TerminatedTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Recurrent, IV-B Cervical cancer / Stage IV Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v71
2Active Not RecruitingTreatmentBladder Cancers2
2Active Not RecruitingTreatmentBladder Cancers / Carcinoma, Transitional Cell , Bladder Cancer, Bladder Tumors, Urinary Bladder Neoplasms1
2Active Not RecruitingTreatmentCancer, Breast1
2Active Not RecruitingTreatmentLiposarcoma / Locally Advanced Sarcoma / Metastatic Sarcoma / Myxoid/Round Cell Liposarcoma / Recurrent Adult Soft Tissue Sarcoma / Sarcomas / Synovial Sarcoma1
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Small Cell Lung Cancer Extensive Stage / Small Cell Lung Cancer Limited Stage1
2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2Active Not RecruitingTreatmentRecurrent Colorectal Carcinoma / Refractory Colorectal Carcinoma / Stage IV Colorectal Cancer / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
2Active Not RecruitingTreatmentTransitional Cell Carcinoma1
2CompletedTreatmentTransitional Cell Carcinoma1
2Not Yet RecruitingBasic ScienceMetastatic Colorectal Cancers1
2Not Yet RecruitingTreatmentAdenocarcinomas of the Gastroesophageal Junction / Malignant Neoplasm of Stomach1
2Not Yet RecruitingTreatmentBladder Cancers1
2Not Yet RecruitingTreatmentCancer of the Ovary / Fallopian Tube Cancer / Primary Peritoneal Carcinoma1
2Not Yet RecruitingTreatmentCancer, Breast1
2Not Yet RecruitingTreatmentCervical Cancer Metastatic / Cervical Cancers / Recurrent Cervical Cancer1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2Not Yet RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / NHL1
2Not Yet RecruitingTreatmentLymphoma, T-Cell, Cutaneous / Mycosis Fungoides/Sezary Syndrome / Mycosis fungoides; sezary syndrome1
2Not Yet RecruitingTreatmentMesothelioma, Malignant1
2Not Yet RecruitingTreatmentMetastatic Bladder Urothelial Carcinoma / Metastatic Renal Pelvis Urothelial Carcinoma / Metastatic Ureter Urothelial Carcinoma / Metastatic Ureteral Neoplasm / Metastatic Urethral Neoplasm / Metastatic Urethral Urothelial Carcinoma / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Recurrent Bladder Urothelial Carcinoma / Recurrent Renal Pelvis Urothelial Carcinoma / Recurrent Ureter Urothelial Carcinoma / Recurrent Urethral Urothelial Carcinoma / Stage III Bladder Cancer AJCC v8 / Stage III Renal Pelvis Cancer AJCC v8 / Stage III Ureter Cancer AJCC v8 / Stage III Urethral Cancer AJCC v8 / Stage IV Bladder Cancer AJCC v8 / Stage IV Renal Pelvis Cancer AJCC v8 / Stage IV Ureter Cancer AJCC v8 / Stage IV Urethral Cancer AJCC v8 / Stage IVA Bladder Cancer AJCC v8 / Stage IVB Bladder Cancer AJCC v8 / Transitional Cell Carcinoma / Urothelial carcinoma ureter metastatic1
2Not Yet RecruitingTreatmentMetastatic Melanoma1
2Not Yet RecruitingTreatmentRadiosurgery / Sarcomas1
2RecruitingOtherCancer, Breast / Estrogen Receptor-Positive Breast Cancer1
2RecruitingTreatmentAdvanced Gynecological Cancers / Cancer of the Ovary / Cervical Cancers / Uterine Cancers1
2RecruitingTreatmentAdvanced Non-Clear Cell Kidney Cancer1
2RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer2
2RecruitingTreatmentAlveolar Soft Part Sarcoma (ASPS) / Metastatic Alveolar Soft Part Sarcoma1
2RecruitingTreatmentAnal Carcinoma1
2RecruitingTreatmentAnaplastic Thyroid Carcinoma / Malignant Neoplasms of Thyroid and Other Endocrine Glands / Poorly Differentiated Thyroid Cancer1
2RecruitingTreatmentAppendiceal Adenocarcinoma / Cutaneous Squamous Cell Carcinoma / Malignant Neoplasms of Digestive Organs / Melanoma and Other Malignant Neoplasms of Skin / Small Bowel Adenocarcinoma1
2RecruitingTreatmentBRCA1 Gene Mutation / Brca2 Gene Mutation / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Recurrent Breast Carcinoma / Stage III Breast Cancer / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v7 / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentBladder Cancers / Cancer of the Urinary Tract / Cancer, Breast / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2RecruitingTreatmentBreast Cancer Invasive Nos / HER2 negative / Stage IV Breast Cancer / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentCancer of Unknown Primary Site1
2RecruitingTreatmentCancer, Breast4
2RecruitingTreatmentCancer, Breast / Triple Negative Breast Cancer (TNBC)1
2RecruitingTreatmentCarcinoma of Gallbladder / Intrahepatic Cholangiocarcinoma / Non-Resectable Cholangiocarcinoma / Recurrent Cholangiocarcinoma / Stage IV Intrahepatic Cholangiocarcinoma AJCC v8 / Unresectable Cholangiocarcinoma1
2RecruitingTreatmentCentral Nervous System Metastases / HER2-positive Metastatic Breast Cancer1
2RecruitingTreatmentCervical Cancers1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)1
2RecruitingTreatmentClinical Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage III Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIA Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIB Cutaneous Melanoma AJCC v8 / Pathologic Stage IIIC Cutaneous Melanoma AJCC v8 / Pathologic Stage IIID Cutaneous Melanoma AJCC v81
2RecruitingTreatmentCancer treatment / Colorectal Cancers / MSI / Resistance, APC1
2RecruitingTreatmentEndometrial Cancers1
2RecruitingTreatmentEsophageal Cancer Stage III / Esophageal Cancer, Stage II1
2RecruitingTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Invasive Breast Carcinoma / Progesterone Receptor Negative / Stage II Breast Cancer AJCC v6 and v7 / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer / Stage IIIC Breast Cancer AJCC v7 / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Marginal Zone Lymphoma / Mucosa Associated Lymphoid Tissue1
2RecruitingTreatmentGastro Esophageal Junction Cancer / Malignant Neoplasm of Stomach1
2RecruitingTreatmentHer2-Positive Breast Cancer1
2RecruitingTreatmentKRAS Gene Mutation / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer AJCC v71
2RecruitingTreatmentLocally Advanced Cervical Cancer1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)7
2RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2RecruitingTreatmentLymphoma, Hodgkins1
2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Refractory Diffuse Large B Cell Lymphoma / Relapsed, Diffuse Large B-cell Lymphoma1
2RecruitingTreatmentMalignant Lymphomas1
2RecruitingTreatmentMalignant Melanoma1
2RecruitingTreatmentMalignant Neoplasm of Breast1
2RecruitingTreatmentMalignant Neoplasms of Digestive Organs / Malignant Neoplasms of Lip Oral Cavity and Pharynx / Malignant Neoplasms of Mesothelial and Soft Tissue / Malignant Neoplasms of Respiratory and Intrathoracic Organs1
2RecruitingTreatmentMelanoma and Other Malignant Neoplasms of Skin1
2RecruitingTreatmentMetastatic Alveolar Soft Part Sarcoma1
2RecruitingTreatmentMetastatic Renal Cell Cancer / Recurrent Melanoma / Recurrent Non-Small Cell Lung Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V7 / Stage IV Skin Melanoma1
2RecruitingTreatmentMetastatic Renal Cell Carcinoma / Urothelial carcinoma ureter metastatic1
2RecruitingTreatmentNeoplasms1
2RecruitingTreatmentNeoplasms, Ovarian1
2RecruitingTreatmentRecurrent Bladder Urothelial Carcinoma / Recurrent Urethral Urothelial Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Renal Pelvis Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma / Stage III Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage III Renal Pelvis Cancer AJCC v7 / Stage III Renal Pelvis Carcinoma / Stage III Ureter Cancer / Stage III Ureter Cancer AJCC v7 / Stage III Urethral Cancer / Stage III Urethral Cancer AJCC v7 / Stage IV Bladder Urothelial Carcinoma / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Renal Pelvis Carcinoma / Stage IV Ureter Cancer / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer / Stage IV Urethral Cancer AJCC v7 / Ureter Urothelial Carcinoma / Urothelial carcinoma ureter metastatic1
2RecruitingTreatmentRecurrent Bladder Urothelial Carcinoma / Stage 0a Bladder Urothelial Carcinoma / Stage 0a Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage 0is Bladder Urothelial Carcinoma / Stage 0is Bladder Urothelial Carcinoma AJCC v6 and v7 / Stage I Bladder Cancer With Carcinoma In Situ / Stage I Bladder Urothelial Carcinoma / Stage I Bladder Urothelial Carcinoma AJCC v6 and v71
2RecruitingTreatmentSafety Issues1
2RecruitingTreatmentSoft Tissue Sarcoma (STS)1
2RecruitingTreatmentTransitional Cell Carcinoma2
2RecruitingTreatmentTumors, Solid2
2RecruitingTreatmentTumors / Tumors, Solid1
2RecruitingTreatmentRefractory Small cell lung cancer1
2SuspendedTreatmentColorectal Cancers1
2SuspendedTreatmentLocally Advanced / Transitional Cell Carcinoma / Unresectable1
2WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2, 3RecruitingTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Undifferentiated Carcinoma / High Grade Fallopian Tube Serous Adenocarcinoma / High Grade Ovarian Serous Adenocarcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Undifferentiated Carcinoma / Primary Peritoneal High Grade Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
2, 3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3Active Not RecruitingTreatmentBladder Cancers1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer2
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentLung Cancer Small Cell Lung Cancer (SCLC) / Small Cell Lung Carcinoma1
3Active Not RecruitingTreatmentMetastatic Breast Cancer, Triple Negative Breast Cancer / Triple Negative Breast Cancer (TNBC)1
3Active Not RecruitingTreatmentNon-Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentNon-Squamous Non-Small Cell Lung Cancer / Non-Squamous Non-Small Cell Lung Cancer, Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentTransitional Cell Carcinoma1
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer / Squamous Non-Small Cell Lung Cancer1
3Not Yet RecruitingOtherBreast Cancer Invasive Nos1
3Not Yet RecruitingTreatmentBreast Adenocarcinoma / HER2/Neu Positive / Recurrent Breast Carcinoma / Stage III Breast Cancer AJCC V7 / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v71
3Not Yet RecruitingTreatmentCarcinoma of the Cervix, Stage IVB1
3Not Yet RecruitingTreatmentEndometrial Cancers1
3Not Yet RecruitingTreatmentRecurrent Ovarian Carcinoma1
3RecruitingTreatmentAbdominal wall neoplasm / Cancer of the Ovary / Fallopian Tube Cancer1
3RecruitingTreatmentAdvanced BRAFV600 Wild-type Melanoma1
3RecruitingTreatmentBladder Cancer, Cancer / Transitional Cell Carcinoma1
3RecruitingTreatmentCancer of the Ovary1
3RecruitingTreatmentCancers1
3RecruitingTreatmentColon Adenocarcinoma / DNA Repair Disorder / Lynch Syndrome / Microsatellite Instability / Stage III Colon Cancer AJCC v7 / Stage IIIA Colon Cancer / Stage IIIA Colon Cancer AJCC v7 / Stage IIIB Colon Cancer / Stage IIIB Colon Cancer AJCC v7 / Stage IIIC Colon Cancer / Stage IIIC Colon Cancer AJCC v71
3RecruitingTreatmentColorectal Adenocarcinoma / High-Frequency Microsatellite Instability / Mismatch Repair Deficiency / Stage IV Colorectal Cancer / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
3RecruitingTreatmentHepatocellular,Carcinoma1
3RecruitingTreatmentInvasive Ductal Breast Carcinoma1
3RecruitingTreatmentLocally Advanced Squamous Cell Carcinoma of the Head and Neck (SCCHN)1
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Squamous Non-Small Cell Lung Cancer1
3RecruitingTreatmentMelanoma1
3RecruitingTreatmentNon-Small-Cell Lung1
3RecruitingTreatmentProstatic Neoplasms, Castration-Resistant1
3RecruitingTreatmentRecurrent Ovarian Carcinoma1
3RecruitingTreatmentRenal Cell Adenocarcinoma1
3RecruitingTreatmentTriple Negative Breast Cancer (TNBC)2
3RecruitingTreatmentTriple Negative Breast Neoplasms1
3RecruitingTreatmentTriple-Negative Breast Cancer (TNBC)1
3RecruitingTreatmentUrinary Tract Cancers1
4Approved for MarketingNot AvailableTransitional Cell Carcinoma1
4RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableNot Yet RecruitingNot AvailableTransitional Cell Carcinoma1
Not AvailableRecruitingNot AvailableBladder Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableRecruitingNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableRecruitingNot AvailableTransitional Cell Carcinoma1
Not AvailableRecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solutionIntravenous1200 mg/20mL
SolutionIntravenous60 mg
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Not Available
Specific Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell ...
Gene Name
CD274
Uniprot ID
Q9NZQ7
Uniprot Name
Programmed cell death 1 ligand 1
Molecular Weight
33275.095 Da

Drug created on May 19, 2016 09:42 / Updated on September 18, 2018 23:02