Identification
NameBevacizumab
Accession NumberDB00112  (BTD00087, BIOD00087)
TypeBiotech
GroupsApproved, Investigational
Description

A recombinant humanized monoclonal IgG1 antibody that binds to and inhibits the biologic activity of human vascular endothelial growth factor (VEGF). Bevacizumab contains human framework regions and the complementarity-determining regions of a murine antibody that binds to VEGF. Bevacizumab is produced in a Chinese Hamster Ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin and has a molecular weight of approximately 149 kilodaltons.

Protein structureDb00112
Related Articles
Protein chemical formulaC6538H10034N1716O2033S44
Protein average weight149000.0 Da
Sequences
>"Bevacizumab light chain"
DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>"Bevacizumab heavy chain"
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY
AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
antiVEGF
Avastin
External IDs R-435
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AvastinSolution25 mgIntravenousHoffmann La Roche2005-11-02Not applicableCanada
AvastinInjection, solution100 mg/4mLIntravenousGenentech, Inc.2004-02-26Not applicableUs
AvastinInjection, solution400 mg/16mLIntravenousGenentech, Inc.2004-02-26Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNII2S9ZZM9Q9V
CAS number216974-75-3
Pharmacology
Indication

As part of combination therapy for metastatic colorectal cancer and HER2-negative metastatic breast cancer.

Structured Indications Not Available
Pharmacodynamics

Bevacizumab is an antineoplastic agent and prevents or reduces the formation of blood vessels (angiogenesis) thereby preventing or reducing metatstatic disease progressing. Bevacizumab binds VEGF and prevents vascular endothelial growth and endothelial cell proliferation.

Mechanism of action

Bevacizumab contains human framework regions with antigen binding regions of a humanised murine antibody that binds to VEGF. Bevacizumab is produced by recombinant DNA technology in a Chinese hamster ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin and is purified by a process that includes specific viral inactivation and removal steps. Bevacizumab binds VEGF and prevents the interaction of VEGF to its receptors (Flt-1 and KDR) on the surface of endothelial cells. This prevents blood vessel proliferation and in response retardation of metastatic tumor growth occurs.

TargetKindPharmacological actionActionsOrganismUniProt ID
Vascular endothelial growth factor AProteinyesNot AvailableHumanP15692 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Related Articles
AbsorptionNot Available
Volume of distribution

Vd: 46 mL/kg

Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to endothelial cells, or by human antimurine antibody production

Route of eliminationNot Available
Half life

approximately 20 days (range: 11–50 days)

Clearance
  • 0.26 L/day [Male patients who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.21 L/day [Female patients who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.25 L/day [Patients with higher tumor burden who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.2 L/day [patients with tumor burdens below the median who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]

Clearance varies by body weight, gender, and tumor burden. Increased clearance observed in men and in patients with higher tumor burden; however, no evidence of reduced efficacy.

Toxicity

Category C in pregnancy. No studies on lactating patients: recommended to discontinue the drug or discontinue lactation. No extensive studies in pediatrics. In geriatrics: increased risk of proteinuria, arterial thromboembolic events, as well as GI bleeding and sepsis among others.

Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Bevacizumab Action PathwayDrug actionSMP00420
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
2-(4-Chlorophenyl)-5-QuinoxalinecarboxamideBevacizumab may increase the cardiotoxic activities of 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide.Experimental
2-MethoxyestradiolBevacizumab may increase the cardiotoxic activities of 2-Methoxyestradiol.Investigational
3-MethoxybenzamideBevacizumab may increase the cardiotoxic activities of 3-Methoxybenzamide.Experimental
3,4-Dihydroxybenzoic AcidBevacizumab may increase the cardiotoxic activities of 3,4-Dihydroxybenzoic Acid.Experimental
7-HydroxystaurosporineBevacizumab may increase the cardiotoxic activities of 7-Hydroxystaurosporine.Experimental
8-azaguanineBevacizumab may increase the cardiotoxic activities of 8-azaguanine.Experimental
AbirateroneBevacizumab may increase the cardiotoxic activities of Abiraterone.Approved
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Bevacizumab.Approved
AclarubicinBevacizumab may increase the cardiotoxic activities of Aclarubicin.Investigational
AfatinibBevacizumab may increase the cardiotoxic activities of Afatinib.Approved
AfimoxifeneBevacizumab may increase the cardiotoxic activities of Afimoxifene.Investigational
AfliberceptBevacizumab may increase the cardiotoxic activities of Aflibercept.Approved
AlatrofloxacinBevacizumab may increase the cardiotoxic activities of Alatrofloxacin.Withdrawn
AlbendazoleBevacizumab may increase the cardiotoxic activities of Albendazole.Approved, Vet Approved
AldesleukinBevacizumab may increase the cardiotoxic activities of Aldesleukin.Approved
AlemtuzumabBevacizumab may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
AlitretinoinBevacizumab may increase the cardiotoxic activities of Alitretinoin.Approved, Investigational
AltretamineBevacizumab may increase the cardiotoxic activities of Altretamine.Approved
AminoglutethimideBevacizumab may increase the cardiotoxic activities of Aminoglutethimide.Approved
Aminolevulinic acidBevacizumab may increase the cardiotoxic activities of Aminolevulinic acid.Approved
AmonafideBevacizumab may increase the cardiotoxic activities of Amonafide.Investigational
AmrubicinBevacizumab may increase the cardiotoxic activities of Amrubicin.Approved, Investigational
AmsacrineBevacizumab may increase the cardiotoxic activities of Amsacrine.Approved
AnagrelideBevacizumab may increase the cardiotoxic activities of Anagrelide.Approved
AnastrozoleBevacizumab may increase the cardiotoxic activities of Anastrozole.Approved, Investigational
Arsenic trioxideBevacizumab may increase the cardiotoxic activities of Arsenic trioxide.Approved, Investigational
AsparaginaseBevacizumab may increase the cardiotoxic activities of Asparaginase.Approved
AxitinibBevacizumab may increase the cardiotoxic activities of Axitinib.Approved, Investigational
AzacitidineBevacizumab may increase the cardiotoxic activities of Azacitidine.Approved, Investigational
AzathioprineBevacizumab may increase the cardiotoxic activities of Azathioprine.Approved
Azelaic AcidBevacizumab may increase the cardiotoxic activities of Azelaic Acid.Approved
BatimastatBevacizumab may increase the cardiotoxic activities of Batimastat.Experimental
BelimumabThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Belimumab.Approved
BelinostatBevacizumab may increase the cardiotoxic activities of Belinostat.Approved, Investigational
BendamustineBevacizumab may increase the cardiotoxic activities of Bendamustine.Approved, Investigational
BesifloxacinBevacizumab may increase the cardiotoxic activities of Besifloxacin.Approved
Betulinic AcidBevacizumab may increase the cardiotoxic activities of Betulinic Acid.Investigational
BexaroteneBevacizumab may increase the cardiotoxic activities of Bexarotene.Approved, Investigational
BicalutamideBevacizumab may increase the cardiotoxic activities of Bicalutamide.Approved
BleomycinBevacizumab may increase the cardiotoxic activities of Bleomycin.Approved
BlinatumomabBevacizumab may increase the cardiotoxic activities of Blinatumomab.Approved
BortezomibBevacizumab may increase the cardiotoxic activities of Bortezomib.Approved, Investigational
BosutinibBevacizumab may increase the cardiotoxic activities of Bosutinib.Approved
Brentuximab vedotinBevacizumab may increase the cardiotoxic activities of Brentuximab vedotin.Approved
BusulfanBevacizumab may increase the cardiotoxic activities of Busulfan.Approved, Investigational
CabazitaxelBevacizumab may increase the cardiotoxic activities of Cabazitaxel.Approved
CabergolineBevacizumab may increase the cardiotoxic activities of Cabergoline.Approved
CabozantinibBevacizumab may increase the cardiotoxic activities of Cabozantinib.Approved
CalcipotriolBevacizumab may increase the cardiotoxic activities of Calcipotriol.Approved
CamptothecinBevacizumab may increase the cardiotoxic activities of Camptothecin.Experimental
CapecitabineBevacizumab may increase the cardiotoxic activities of Capecitabine.Approved, Investigational
CarboplatinBevacizumab may increase the cardiotoxic activities of Carboplatin.Approved
Carbopol 974PBevacizumab may increase the cardiotoxic activities of polyacrylic acid.Investigational
CarfilzomibBevacizumab may increase the cardiotoxic activities of Carfilzomib.Approved
CarmofurBevacizumab may increase the cardiotoxic activities of Carmofur.Withdrawn
CarmustineBevacizumab may increase the cardiotoxic activities of Carmustine.Approved
CediranibBevacizumab may increase the cardiotoxic activities of AZD2171.Investigational
CelecoxibBevacizumab may increase the cardiotoxic activities of Celecoxib.Approved, Investigational
CeritinibBevacizumab may increase the cardiotoxic activities of Ceritinib.Approved
CetuximabBevacizumab may increase the cardiotoxic activities of Cetuximab.Approved
ChlorambucilBevacizumab may increase the cardiotoxic activities of Chlorambucil.Approved
ChlorotrianiseneBevacizumab may increase the cardiotoxic activities of Chlorotrianisene.Withdrawn
CinoxacinBevacizumab may increase the cardiotoxic activities of Cinoxacin.Approved, Withdrawn
CiprofloxacinBevacizumab may increase the cardiotoxic activities of Ciprofloxacin.Approved, Investigational
CisplatinBevacizumab may increase the cardiotoxic activities of Cisplatin.Approved
CladribineBevacizumab may increase the cardiotoxic activities of Cladribine.Approved, Investigational
ClofarabineBevacizumab may increase the cardiotoxic activities of Clofarabine.Approved, Investigational
ClozapineThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Clozapine.Approved
ColchicineBevacizumab may increase the cardiotoxic activities of Colchicine.Approved
CrizotinibBevacizumab may increase the cardiotoxic activities of Crizotinib.Approved
CyclophosphamideBevacizumab may increase the cardiotoxic activities of Cyclophosphamide.Approved, Investigational
Cyproterone acetateBevacizumab may increase the cardiotoxic activities of Cyproterone acetate.Approved, Investigational
CytarabineBevacizumab may increase the cardiotoxic activities of Cytarabine.Approved, Investigational
DabrafenibBevacizumab may increase the cardiotoxic activities of Dabrafenib.Approved
DacarbazineBevacizumab may increase the cardiotoxic activities of Dacarbazine.Approved, Investigational
DactinomycinBevacizumab may increase the cardiotoxic activities of Dactinomycin.Approved
DaratumumabBevacizumab may increase the cardiotoxic activities of Daratumumab.Approved
DasatinibBevacizumab may increase the cardiotoxic activities of Dasatinib.Approved, Investigational
DaunorubicinBevacizumab may increase the cardiotoxic activities of Daunorubicin.Approved
DecitabineBevacizumab may increase the cardiotoxic activities of Decitabine.Approved, Investigational
Denileukin diftitoxBevacizumab may increase the cardiotoxic activities of Denileukin diftitox.Approved, Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Bevacizumab.Approved
DexamethasoneBevacizumab may increase the cardiotoxic activities of Dexamethasone.Approved, Investigational, Vet Approved
DexrazoxaneBevacizumab may increase the cardiotoxic activities of Dexrazoxane.Approved, Withdrawn
DienogestBevacizumab may increase the cardiotoxic activities of Dienogest.Approved
DiethylstilbestrolBevacizumab may increase the cardiotoxic activities of Diethylstilbestrol.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Bevacizumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Bevacizumab.Approved
DinutuximabBevacizumab may increase the cardiotoxic activities of Dinutuximab.Approved
DocetaxelBevacizumab may increase the cardiotoxic activities of Docetaxel.Approved, Investigational
DoxorubicinBevacizumab may increase the cardiotoxic activities of Doxorubicin.Approved, Investigational
EcabetBevacizumab may increase the cardiotoxic activities of Ecabet.Approved, Investigational
EflornithineBevacizumab may increase the cardiotoxic activities of Eflornithine.Approved, Withdrawn
EG009Bevacizumab may increase the cardiotoxic activities of EG009.Investigational
ElsamitrucinBevacizumab may increase the cardiotoxic activities of Elsamitrucin.Investigational
EnoxacinBevacizumab may increase the cardiotoxic activities of Enoxacin.Approved
EpirubicinBevacizumab may increase the cardiotoxic activities of Epirubicin.Approved
Epothilone BBevacizumab may increase the cardiotoxic activities of Epothilone B.Experimental, Investigational
EribulinBevacizumab may increase the cardiotoxic activities of Eribulin.Approved, Investigational
ErlotinibBevacizumab may increase the cardiotoxic activities of Erlotinib.Approved, Investigational
EstramustineBevacizumab may increase the cardiotoxic activities of Estramustine.Approved
Ethiodized oilBevacizumab may increase the cardiotoxic activities of Ethiodized oil.Approved
Ethyl carbamateBevacizumab may increase the cardiotoxic activities of Ethyl carbamate.Withdrawn
EtoposideBevacizumab may increase the cardiotoxic activities of Etoposide.Approved
EverolimusBevacizumab may increase the cardiotoxic activities of Everolimus.Approved
ExemestaneBevacizumab may increase the cardiotoxic activities of Exemestane.Approved, Investigational
FenretinideBevacizumab may increase the cardiotoxic activities of Fenretinide.Investigational
FlavopiridolBevacizumab may increase the cardiotoxic activities of Flavopiridol.Experimental, Investigational
FleroxacinBevacizumab may increase the cardiotoxic activities of Fleroxacin.Approved
FloxuridineBevacizumab may increase the cardiotoxic activities of Floxuridine.Approved
FludarabineBevacizumab may increase the cardiotoxic activities of Fludarabine.Approved
FlumequineBevacizumab may increase the cardiotoxic activities of Flumequine.Withdrawn
FluorouracilBevacizumab may increase the cardiotoxic activities of Fluorouracil.Approved
FlutamideBevacizumab may increase the cardiotoxic activities of Flutamide.Approved
FormestaneBevacizumab may increase the cardiotoxic activities of Formestane.Approved, Investigational, Withdrawn
FormycinBevacizumab may increase the cardiotoxic activities of Formycin.Experimental
FotemustineBevacizumab may increase the cardiotoxic activities of Fotemustine.Experimental
FulvestrantBevacizumab may increase the cardiotoxic activities of Fulvestrant.Approved, Investigational
FumagillinBevacizumab may increase the cardiotoxic activities of Fumagillin.Experimental
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Bevacizumab.Investigational
Gallium nitrateBevacizumab may increase the cardiotoxic activities of Gallium nitrate.Approved, Investigational
GatifloxacinBevacizumab may increase the cardiotoxic activities of Gatifloxacin.Approved, Investigational
GefitinibBevacizumab may increase the cardiotoxic activities of Gefitinib.Approved, Investigational
GeldanamycinBevacizumab may increase the cardiotoxic activities of Geldanamycin.Experimental
GemcitabineBevacizumab may increase the cardiotoxic activities of Gemcitabine.Approved
GemifloxacinBevacizumab may increase the cardiotoxic activities of Gemifloxacin.Approved, Investigational
Gemtuzumab ozogamicinBevacizumab may increase the cardiotoxic activities of Gemtuzumab ozogamicin.Approved, Investigational, Withdrawn
GenisteinBevacizumab may increase the cardiotoxic activities of Genistein.Investigational
Ginsenoside CBevacizumab may increase the cardiotoxic activities of Ginsenoside C.Nutraceutical
GoserelinBevacizumab may increase the cardiotoxic activities of Goserelin.Approved
GrepafloxacinBevacizumab may increase the cardiotoxic activities of Grepafloxacin.Withdrawn
HadacidinBevacizumab may increase the cardiotoxic activities of Hadacidin.Experimental
HalofuginoneBevacizumab may increase the cardiotoxic activities of Halofuginone.Investigational, Vet Approved
HexestrolBevacizumab may increase the cardiotoxic activities of Hexestrol.Withdrawn
Hydroxyprogesterone caproateBevacizumab may increase the cardiotoxic activities of Hydroxyprogesterone caproate.Approved
HydroxyureaBevacizumab may increase the cardiotoxic activities of Hydroxyurea.Approved
IbrutinibBevacizumab may increase the cardiotoxic activities of Ibrutinib.Approved
IdarubicinBevacizumab may increase the cardiotoxic activities of Idarubicin.Approved
IdelalisibBevacizumab may increase the cardiotoxic activities of Idelalisib.Approved
IfosfamideBevacizumab may increase the cardiotoxic activities of Ifosfamide.Approved
ImatinibBevacizumab may increase the cardiotoxic activities of Imatinib.Approved
ImiquimodBevacizumab may increase the cardiotoxic activities of Imiquimod.Approved, Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Bevacizumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Bevacizumab.Investigational
Interferon beta-1aBevacizumab may increase the cardiotoxic activities of Interferon beta-1a.Approved, Investigational
Interferon beta-1bBevacizumab may increase the cardiotoxic activities of Interferon beta-1b.Approved
IobenguaneBevacizumab may increase the cardiotoxic activities of Iobenguane.Approved
IpilimumabBevacizumab may increase the cardiotoxic activities of Ipilimumab.Approved
IrinotecanThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Irinotecan.Approved, Investigational
IrofulvenBevacizumab may increase the cardiotoxic activities of MGI-114.Investigational
IxabepiloneBevacizumab may increase the cardiotoxic activities of Ixabepilone.Approved, Investigational
IxazomibBevacizumab may increase the cardiotoxic activities of Ixazomib.Approved
KOS-1584Bevacizumab may increase the cardiotoxic activities of KOS-1584.Investigational
L-EflornithineBevacizumab may increase the cardiotoxic activities of Alpha-Difluoromethylornithine.Experimental
LanreotideBevacizumab may increase the cardiotoxic activities of Lanreotide.Approved
LapatinibBevacizumab may increase the cardiotoxic activities of Lapatinib.Approved, Investigational
LeflunomideBevacizumab may increase the cardiotoxic activities of Leflunomide.Approved, Investigational
LenalidomideBevacizumab may increase the cardiotoxic activities of Lenalidomide.Approved
LenvatinibBevacizumab may increase the cardiotoxic activities of Lenvatinib.Approved
LetrozoleBevacizumab may increase the cardiotoxic activities of Letrozole.Approved, Investigational
LeuprolideBevacizumab may increase the cardiotoxic activities of Leuprolide.Approved, Investigational
LevofloxacinBevacizumab may increase the cardiotoxic activities of Levofloxacin.Approved, Investigational
LomefloxacinBevacizumab may increase the cardiotoxic activities of Lomefloxacin.Approved
LomustineBevacizumab may increase the cardiotoxic activities of Lomustine.Approved
MasoprocolBevacizumab may increase the cardiotoxic activities of Masoprocol.Approved
MebendazoleBevacizumab may increase the cardiotoxic activities of Mebendazole.Approved, Vet Approved
MechlorethamineBevacizumab may increase the cardiotoxic activities of Mechlorethamine.Approved
MedrogestoneBevacizumab may increase the cardiotoxic activities of Medrogestone.Approved
Medroxyprogesterone acetateBevacizumab may increase the cardiotoxic activities of Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateBevacizumab may increase the cardiotoxic activities of Megestrol acetate.Approved, Vet Approved
MelphalanBevacizumab may increase the cardiotoxic activities of Melphalan.Approved
MercaptopurineBevacizumab may increase the cardiotoxic activities of Mercaptopurine.Approved
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Bevacizumab.Withdrawn
MethotrexateBevacizumab may increase the cardiotoxic activities of Methotrexate.Approved
Methyl aminolevulinateBevacizumab may increase the cardiotoxic activities of Methyl aminolevulinate.Approved
MethylprednisoloneBevacizumab may increase the cardiotoxic activities of Methylprednisolone.Approved, Vet Approved
MethyltestosteroneBevacizumab may increase the cardiotoxic activities of Methyltestosterone.Approved
MidostaurinBevacizumab may increase the cardiotoxic activities of Midostaurin.Approved
MiltefosineBevacizumab may increase the cardiotoxic activities of Miltefosine.Approved
MitomycinBevacizumab may increase the cardiotoxic activities of Mitomycin.Approved
MitotaneBevacizumab may increase the cardiotoxic activities of Mitotane.Approved
MitoxantroneBevacizumab may increase the cardiotoxic activities of Mitoxantrone.Approved, Investigational
motexafin gadoliniumBevacizumab may increase the cardiotoxic activities of motexafin gadolinium.Investigational
MoxifloxacinBevacizumab may increase the cardiotoxic activities of Moxifloxacin.Approved, Investigational
Mycophenolic acidBevacizumab may increase the cardiotoxic activities of Mycophenolic acid.Approved
Nalidixic AcidBevacizumab may increase the cardiotoxic activities of Nalidixic Acid.Approved
NavitoclaxBevacizumab may increase the cardiotoxic activities of Navitoclax.Investigational
NebularineBevacizumab may increase the cardiotoxic activities of Purine Riboside.Experimental
NecitumumabBevacizumab may increase the cardiotoxic activities of Necitumumab.Approved
NelarabineBevacizumab may increase the cardiotoxic activities of Nelarabine.Approved, Investigational
NiguldipineBevacizumab may increase the cardiotoxic activities of Niguldipine.Experimental
NilotinibBevacizumab may increase the cardiotoxic activities of Nilotinib.Approved, Investigational
NilutamideBevacizumab may increase the cardiotoxic activities of Nilutamide.Approved
NintedanibBevacizumab may increase the cardiotoxic activities of Nintedanib.Approved
NivolumabBevacizumab may increase the cardiotoxic activities of Nivolumab.Approved
nocodazoleBevacizumab may increase the cardiotoxic activities of nocodazole.Experimental
NorfloxacinBevacizumab may increase the cardiotoxic activities of Norfloxacin.Approved
ObinutuzumabBevacizumab may increase the cardiotoxic activities of Obinutuzumab.Approved
OctreotideBevacizumab may increase the cardiotoxic activities of Octreotide.Approved, Investigational
OfatumumabBevacizumab may increase the cardiotoxic activities of Ofatumumab.Approved
OfloxacinBevacizumab may increase the cardiotoxic activities of Ofloxacin.Approved
OlaparibBevacizumab may increase the cardiotoxic activities of Olaparib.Approved
OleandrinAnvirzel may decrease the cardiotoxic activities of Bevacizumab.Experimental
Omacetaxine mepesuccinateBevacizumab may increase the cardiotoxic activities of Omacetaxine mepesuccinate.Approved
OprelvekinBevacizumab may increase the cardiotoxic activities of Oprelvekin.Approved, Investigational
OsimertinibBevacizumab may increase the cardiotoxic activities of Osimertinib.Approved
OuabainOuabain may decrease the cardiotoxic activities of Bevacizumab.Approved
OxaliplatinBevacizumab may increase the cardiotoxic activities of Oxaliplatin.Approved, Investigational
PaclitaxelBevacizumab may increase the cardiotoxic activities of Paclitaxel.Approved, Vet Approved
PalbociclibBevacizumab may increase the cardiotoxic activities of Palbociclib.Approved
PamidronateBevacizumab may increase the cardiotoxic activities of Pamidronate.Approved
PanitumumabBevacizumab may increase the cardiotoxic activities of Panitumumab.Approved, Investigational
PanobinostatBevacizumab may increase the cardiotoxic activities of Panobinostat.Approved, Investigational
PazopanibBevacizumab may increase the cardiotoxic activities of Pazopanib.Approved
PefloxacinBevacizumab may increase the cardiotoxic activities of Pefloxacin.Approved
PegaspargaseBevacizumab may increase the cardiotoxic activities of Pegaspargase.Approved, Investigational
PembrolizumabBevacizumab may increase the cardiotoxic activities of Pembrolizumab.Approved
PemetrexedBevacizumab may increase the cardiotoxic activities of Pemetrexed.Approved, Investigational
PentostatinBevacizumab may increase the cardiotoxic activities of Pentostatin.Approved, Investigational
PertuzumabBevacizumab may increase the cardiotoxic activities of Pertuzumab.Approved
Phenylacetic acidBevacizumab may increase the cardiotoxic activities of Phenylacetic acid.Approved
Phenylbutyric acidBevacizumab may increase the cardiotoxic activities of Sodium phenylbutyrate.Approved, Investigational
PipobromanBevacizumab may increase the cardiotoxic activities of Pipobroman.Approved
PirarubicinBevacizumab may increase the cardiotoxic activities of Pirarubicin.Investigational
PirfenidoneBevacizumab may increase the cardiotoxic activities of Pirfenidone.Investigational
PirlindoleBevacizumab may increase the cardiotoxic activities of Pirlindole.Approved
PixantroneBevacizumab may increase the cardiotoxic activities of Pixantrone.Investigational
PlicamycinBevacizumab may increase the cardiotoxic activities of Plicamycin.Approved, Withdrawn
PodofiloxBevacizumab may increase the cardiotoxic activities of Podofilox.Approved
PodophyllinBevacizumab may increase the cardiotoxic activities of Podophyllin.Approved
PomalidomideBevacizumab may increase the cardiotoxic activities of Pomalidomide.Approved
PonatinibBevacizumab may increase the cardiotoxic activities of Ponatinib.Approved
Porfimer sodiumBevacizumab may increase the cardiotoxic activities of Porfimer.Approved, Investigational
PralatrexateBevacizumab may increase the cardiotoxic activities of Pralatrexate.Approved
PrednisoloneBevacizumab may increase the cardiotoxic activities of Prednisolone.Approved, Vet Approved
PrednisoneBevacizumab may increase the cardiotoxic activities of Prednisone.Approved, Vet Approved
ProcarbazineBevacizumab may increase the cardiotoxic activities of Procarbazine.Approved
PuromycinBevacizumab may increase the cardiotoxic activities of Puromycin.Experimental
QuinacrineBevacizumab may increase the cardiotoxic activities of Quinacrine.Approved
Radium Ra 223 DichlorideBevacizumab may increase the cardiotoxic activities of Radium Ra 223 Dichloride.Approved, Investigational
RaltitrexedBevacizumab may increase the cardiotoxic activities of Raltitrexed.Approved, Investigational
RamucirumabBevacizumab may increase the cardiotoxic activities of Ramucirumab.Approved, Investigational
RanibizumabBevacizumab may increase the cardiotoxic activities of Ranibizumab.Approved
RanpirnaseBevacizumab may increase the cardiotoxic activities of Ranpirnase.Investigational
RegorafenibBevacizumab may increase the cardiotoxic activities of Regorafenib.Approved
ResveratrolBevacizumab may increase the cardiotoxic activities of Resveratrol.Experimental, Investigational
Rhodamine 6GBevacizumab may increase the cardiotoxic activities of Rhodamine 6G.Experimental
RindopepimutThe therapeutic efficacy of CDX-110 can be decreased when used in combination with Bevacizumab.Investigational
RituximabBevacizumab may increase the cardiotoxic activities of Rituximab.Approved
RomidepsinBevacizumab may increase the cardiotoxic activities of Romidepsin.Approved, Investigational
RomiplostimBevacizumab may increase the cardiotoxic activities of Romiplostim.Approved
RoquinimexBevacizumab may increase the cardiotoxic activities of Roquinimex.Investigational
RucaparibBevacizumab may increase the cardiotoxic activities of Rucaparib.Approved, Investigational
RuxolitinibBevacizumab may increase the cardiotoxic activities of Ruxolitinib.Approved
SatraplatinBevacizumab may increase the cardiotoxic activities of Satraplatin.Investigational
SemaxanibBevacizumab may increase the cardiotoxic activities of Semaxanib.Investigational
SeocalcitolBevacizumab may increase the cardiotoxic activities of Seocalcitol.Experimental
SiltuximabBevacizumab may increase the cardiotoxic activities of Siltuximab.Approved
SirolimusBevacizumab may increase the cardiotoxic activities of Sirolimus.Approved, Investigational
SonidegibBevacizumab may increase the cardiotoxic activities of Sonidegib.Approved, Investigational
SorafenibThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Sorafenib.Approved, Investigational
SparfloxacinBevacizumab may increase the cardiotoxic activities of Sparfloxacin.Approved
Sparfosic acidBevacizumab may increase the cardiotoxic activities of Sparfosic acid.Experimental
SparsomycinBevacizumab may increase the cardiotoxic activities of Sparsomycin.Experimental
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Bevacizumab.Investigational
SRT501Bevacizumab may increase the cardiotoxic activities of SRT501.Investigational
StreptozocinBevacizumab may increase the cardiotoxic activities of Streptozocin.Approved
SulindacBevacizumab may increase the cardiotoxic activities of Sulindac.Approved
SunitinibThe risk or severity of adverse effects can be increased when Sunitinib is combined with Bevacizumab.Approved, Investigational
SuraminBevacizumab may increase the cardiotoxic activities of Suramin.Approved
TamoxifenBevacizumab may increase the cardiotoxic activities of Tamoxifen.Approved
TegafurBevacizumab may increase the cardiotoxic activities of Tegafur.Approved
TemafloxacinBevacizumab may increase the cardiotoxic activities of Temafloxacin.Withdrawn
TemozolomideBevacizumab may increase the cardiotoxic activities of Temozolomide.Approved, Investigational
TemsirolimusBevacizumab may increase the cardiotoxic activities of Temsirolimus.Approved
TeniposideBevacizumab may increase the cardiotoxic activities of Teniposide.Approved
TestolactoneBevacizumab may increase the cardiotoxic activities of Testolactone.Approved
TetrathiomolybdateBevacizumab may increase the cardiotoxic activities of Tetrathiomolybdate.Investigational
ThalidomideBevacizumab may increase the cardiotoxic activities of Thalidomide.Approved, Investigational, Withdrawn
ThiotepaBevacizumab may increase the cardiotoxic activities of Thiotepa.Approved
ThymalfasinBevacizumab may increase the cardiotoxic activities of Thymalfasin.Approved, Investigational
TiboloneBevacizumab may increase the cardiotoxic activities of Tibolone.Approved
TioguanineBevacizumab may increase the cardiotoxic activities of Tioguanine.Approved
TipifarnibBevacizumab may increase the cardiotoxic activities of Tipifarnib.Investigational
TirapazamineBevacizumab may increase the cardiotoxic activities of Tirapazamine.Investigational
TopotecanBevacizumab may increase the cardiotoxic activities of Topotecan.Approved, Investigational
ToremifeneBevacizumab may increase the cardiotoxic activities of Toremifene.Approved, Investigational
TositumomabBevacizumab may increase the cardiotoxic activities of Tositumomab.Approved
TrabectedinBevacizumab may increase the cardiotoxic activities of Trabectedin.Approved, Investigational
TrametinibBevacizumab may increase the cardiotoxic activities of Trametinib.Approved
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Bevacizumab.Approved, Investigational
Trastuzumab emtansineBevacizumab may increase the cardiotoxic activities of Trastuzumab emtansine.Approved
TretazicarBevacizumab may increase the cardiotoxic activities of CB1954.Investigational
TretinoinBevacizumab may increase the cardiotoxic activities of Tretinoin.Approved, Investigational, Nutraceutical
TridolgosirBevacizumab may increase the cardiotoxic activities of Swainsonine.Experimental
TrifluridineBevacizumab may increase the cardiotoxic activities of Trifluridine.Approved
TrilostaneBevacizumab may increase the cardiotoxic activities of Trilostane.Approved, Investigational, Vet Approved, Withdrawn
TrimetrexateBevacizumab may increase the cardiotoxic activities of Trimetrexate.Approved, Investigational
TriptorelinBevacizumab may increase the cardiotoxic activities of Triptorelin.Approved, Vet Approved
TrovafloxacinBevacizumab may increase the cardiotoxic activities of Trovafloxacin.Approved, Withdrawn
TroxacitabineBevacizumab may increase the cardiotoxic activities of Troxacitabine.Investigational
TTNPBBevacizumab may increase the cardiotoxic activities of TTNPB.Experimental
TubercidinBevacizumab may increase the cardiotoxic activities of Tubercidin.Experimental
UbenimexBevacizumab may increase the cardiotoxic activities of Ubenimex.Experimental
Uracil mustardBevacizumab may increase the cardiotoxic activities of Uracil mustard.Approved
ValrubicinBevacizumab may increase the cardiotoxic activities of Valrubicin.Approved
VandetanibBevacizumab may increase the cardiotoxic activities of Vandetanib.Approved
VapreotideBevacizumab may increase the cardiotoxic activities of Vapreotide.Approved, Investigational
VeliparibBevacizumab may increase the cardiotoxic activities of Veliparib.Investigational
VemurafenibBevacizumab may increase the cardiotoxic activities of Vemurafenib.Approved
VerteporfinBevacizumab may increase the cardiotoxic activities of Verteporfin.Approved, Investigational
VinblastineBevacizumab may increase the cardiotoxic activities of Vinblastine.Approved
VincristineBevacizumab may increase the cardiotoxic activities of Vincristine.Approved, Investigational
VindesineBevacizumab may increase the cardiotoxic activities of Vindesine.Approved
VinorelbineBevacizumab may increase the cardiotoxic activities of Vinorelbine.Approved, Investigational
VismodegibBevacizumab may increase the cardiotoxic activities of Vismodegib.Approved
Vitamin ABevacizumab may increase the cardiotoxic activities of Vitamin A.Approved, Nutraceutical, Vet Approved
VorinostatBevacizumab may increase the cardiotoxic activities of Vorinostat.Approved, Investigational
ZorubicinBevacizumab may increase the cardiotoxic activities of Zorubicin.Experimental
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Velcheti V, Viswanathan A, Govindan R: The proportion of patients with metastatic non-small cell lung cancer potentially eligible for treatment with bevacizumab: a single institutional survey. J Thorac Oncol. 2006 Jun;1(5):501. [PubMed:17409907 ]
  2. Link [Link]
External Links
ATC CodesL01XC07
AHFS Codes
  • 10:00.00
PDB Entries
FDA labelDownload (133 KB)
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingBasic ScienceGlioblastoma Multiforme1
0Active Not RecruitingTreatmentDiffuse Intrinsic Pontine Glioma (DIPG) / Newly Diagnosed High-Grade Gliomas1
0CompletedTreatmentCancer, Breast1
0CompletedTreatmentHead and Neck Carcinoma / Pharynx Cancer1
0Not Yet RecruitingNot AvailableEnd Stage Renal Disease (ESRD) / Hemodialysis Vascular Access Failure1
0RecruitingBasic ScienceBevacizumab-alone Maintenance Treatment Progression / Metastatic Breast Cancer (MBC)1
0RecruitingBasic ScienceCancer, Breast / Early-Stage Breast Carcinoma / Human Epidermal Growth Factor 2 Negative Carcinoma of Breast1
0RecruitingPreventionTumors, Solid1
0RecruitingTreatmentGlioblastomas / Neoplasms, Brain1
0RecruitingTreatmentPrimary Esophageal Carcinoma1
0RecruitingTreatmentRenal Cancers1
0TerminatedTreatmentHemangioblastomas / Von Hippel Lindau Disease1
0Unknown StatusTreatmentGlioblastomas / Optic Neuropathies1
1Active Not RecruitingNot AvailableHealthy Volunteers1
1Active Not RecruitingDiagnosticCancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
1Active Not RecruitingTreatmentAdvanced Cancers1
1Active Not RecruitingTreatmentAdvanced Gastrointestinal Tumors1
1Active Not RecruitingTreatmentCancer, Advanced4
1Active Not RecruitingTreatmentCancer, Advanced / Tumors, Solid1
1Active Not RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / No Prior Chemotherapy / Primary Peritoneal Cancer1
1Active Not RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cancer1
1Active Not RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cancer / Primary Peritoneal Carcinoma1
1Active Not RecruitingTreatmentCancer, Ovarian / Non-Squamous Non-Small Cell Lung Cancer1
1Active Not RecruitingTreatmentCancers1
1Active Not RecruitingTreatmentCancers / Neoplasms1
1Active Not RecruitingTreatmentColorectal Cancers1
1Active Not RecruitingTreatmentFallopian Tube Cancer / Ovarian Carcinoma / Primary Peritoneal Cancer1
1Active Not RecruitingTreatmentFallopian Tube Carcinosarcoma / Fallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Neoplasm / Fallopian Tube Transitional Cell Carcinoma / Ovarian Brenner Tumor / Ovarian Carcinosarcoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Tumor / Ovarian Mucinous Adenocarcinoma / Ovarian Seromucinous Tumor / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Stage IIA Fallopian Tube Cancer / Stage IIA Ovarian Cancer / Stage IIB Fallopian Tube Cancer / Stage IIB Ovarian Cancer / Stage IIC Fallopian Tube Cancer / Stage IIC Ovarian Cancer / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
1Active Not RecruitingTreatmentKRAS Mutant Metastatic Colorectal Cancer1
1Active Not RecruitingTreatmentMalignant Ovarian Mixed Epithelial Tumor / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Cystadenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Ovarian Carcinoma1
1Active Not RecruitingTreatmentMetastatic Colorectal Cancers2
1Active Not RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
1Active Not RecruitingTreatmentNeuroblastomas1
1Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1Active Not RecruitingTreatmentRenal Cell Adenocarcinoma2
1Active Not RecruitingTreatmentSarcomas1
1Active Not RecruitingTreatmentSolid Neoplasms1
1Active Not RecruitingTreatmentTumors, Solid2
1CompletedNot AvailablePterygium1
1CompletedNot AvailableRenal Cell Adenocarcinoma1
1CompletedNot AvailableTumors, Solid3
1CompletedBasic ScienceHealthy Volunteers1
1CompletedBasic ScienceLung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
1CompletedTreatmentAdenocarcinoma of the Ovaries / Fallopian Tube Adenocarcinoma / Primary Peritoneal Carcinoma1
1CompletedTreatmentAdenocarcinoma of the Rectum / Stage II Rectal Cancer / Stage III Rectal Cancer1
1CompletedTreatmentAdenocarcinomas / Non-Small-Cell Lung Carcinoma (NSCLC)1
1CompletedTreatmentAdult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Childhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Grade III Lymphomatoid Granulomatosis / Childhood Immunoblastic Large Cell Lymphoma / Childhood Nasal Type Extranodal NK/T-cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Progressive Hairy Cell Leukemia, Initial Treatment / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Childhood Anaplastic Large Cell Lymphoma / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent/Refractory Childhood Hodgkin Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Adult T-Cell Leukemia/Lymphoma / Stage IV Childhood Anaplastic Large Cell Lymphoma / Stage IV Childhood Hodgkin Lymphoma / Stage IV Childhood Large Cell Lymphoma / Stage IV Childhood Lymphoblastic Lymphoma / Stage IV Childhood Small Noncleaved Cell Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IVA Mycosis Fungoides/Sezary Syndrome / Stage IVB Mycosis Fungoides/Sezary Syndrome / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific / Waldenstrom's Macroglobulinemia (WM)1
1CompletedTreatmentAdult Solid Tumor1
1CompletedTreatmentAdvanced Cancers3
1CompletedTreatmentAdvanced Malignancies / Refractory Malignancy1
1CompletedTreatmentAdvanced Malignancy / Malignant Lymphomas / Plasma Cell Myeloma / Tumors, Solid1
1CompletedTreatmentAdvanced Solid Tumors2
1CompletedTreatmentAdvanced Solid Tumors / Liver Cancer1
1CompletedTreatmentAnal, Colon, and Rectal Cancers / Colon/Rectal Cancer / Neoplasms, Colorectal1
1CompletedTreatmentAnaplastic Astrocytoma (AA) / Glioblastoma Multiforme1
1CompletedTreatmentAstrocytoma, Oligoastrocytoma, Mixed / Ganglioglioma / Ganglioneuroma / Glioblastoma Multiforme Glioma / Gliomas1
1CompletedTreatmentBrenner Tumor / Fallopian Tube Cancer / Ovarian Carcinosarcoma / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Carcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Ovarian Undifferentiated Adenocarcinoma / Primary Peritoneal Cavity Cancer / Stage II Ovarian Epithelial Cancer / Stage III Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
1CompletedTreatmentBrenner Tumor / Fallopian Tube Cancer / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Carcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Ovarian Undifferentiated Adenocarcinoma / Primary Peritoneal Cavity Cancer / Stage II Ovarian Epithelial Cancer / Stage III Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
1CompletedTreatmentCancer of Parotid / Head and Neck Carcinoma / Malignant Neoplasm of Thyroid / Melanoma / Parotid Gland Cancer / Stage IV Head and Neck Cancer / Thyroid neoplasms malignant1
1CompletedTreatmentCancer, Advanced3
1CompletedTreatmentCancer, Advanced / Liver Cancer1
1CompletedTreatmentCancer, Advanced / Metastatic Cancers1
1CompletedTreatmentCancer, Breast1
1CompletedTreatmentCancer, Breast / Metastatic Breast Cancer, Locally Advanced Breast Cancer1
1CompletedTreatmentCancer, Breast / Lymphedema of the extremities1
1CompletedTreatmentCancer, Ovarian1
1CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cancer1
1CompletedTreatmentCancers1
1CompletedTreatmentCancers / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentCentral nervous system neoplasms malignant NEC / Recurrent or Refractory Solid Tumors1
1CompletedTreatmentClear Cell Renal Cell Carcinoma / Recurrent Renal Cell Cancer / Stage I Renal Cell Cancer / Stage II Renal Cell Cancer / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentColorectal Cancers5
1CompletedTreatmentCorneal Neovascularization1
1CompletedTreatmentGlioblastoma Multiforme2
1CompletedTreatmentGlioblastomas1
1CompletedTreatmentHealthy Volunteers1
1CompletedTreatmentHemorrhagic Hereditary Telangiectasia (HHT)1
1CompletedTreatmentLeukemias / Refractory Solid Tumors1
1CompletedTreatmentLiver Cancer1
1CompletedTreatmentLung Cancers1
1CompletedTreatmentLung Cancers / Lymphoproliferative Disorders / Malignant Lymphomas / Small Intestine Cancer / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentMalignant Neoplasm of Pancreas4
1CompletedTreatmentMetastatic Colorectal Cancers3
1CompletedTreatmentMetastatic Colorectal Cancers / Tumors, Solid1
1CompletedTreatmentMetastatic Malignant Neoplasm to Brain1
1CompletedTreatmentMetastatic Renal Cell Carcinoma / Renal Cancers1
1CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Lymphoepithelioma of the Oropharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1CompletedTreatmentMucinous Adenocarcinoma of the Colon / Mucinous Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Signet Ring Adenocarcinoma of the Colon / Signet Ring Adenocarcinoma of the Rectum / Stage IIIA Colon Cancer / Stage IIIA Rectal Cancer / Stage IIIB Colon Cancer / Stage IIIB Rectal Cancer / Stage IIIC Colon Cancer / Stage IIIC Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
1CompletedTreatmentMyopia1
1CompletedTreatmentMyopia, Degenerative / Pathological Myopia / Subfoveal Choroidal Neovascularization1
1CompletedTreatmentNeoplasms3
1CompletedTreatmentNeoplasms Metastasis1
1CompletedTreatmentNeoplasms, Malignant1
1CompletedTreatmentNeuroblastomas1
1CompletedTreatmentNeuromyelitis Optica / Neuromyelitis Optica Spectrum Disorder1
1CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer3
1CompletedTreatmentPeritoneal Cancer1
1CompletedTreatmentRectal Carcinoma1
1CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IV Colon Cancer / Stage IV Rectal Cancer1
1CompletedTreatmentRecurrent Colon Carcinoma / Recurrent Rectal Carcinoma / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
1CompletedTreatmentRecurrent Pterygium1
1CompletedTreatmentRecurrent Respiratory Papillomatosis1
1CompletedTreatmentRefractory Solid Tumors in Children1
1CompletedTreatmentRenal Cell Adenocarcinoma1
1CompletedTreatmentSarcomas1
1CompletedTreatmentSolid Cancers6
1CompletedTreatmentTumors1
1CompletedTreatmentTumors, Central Nervous System1
1CompletedTreatmentTumors, Solid3
1CompletedTreatmentUnresectable Advanced Cancer1
1CompletedTreatmentUnspecified Adult Solid Tumor1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific5
1CompletedTreatmentUnspecified Childhood Solid Tumor, Protocol Specific1
1Not Yet RecruitingOtherHealthy Volunteers1
1Not Yet RecruitingTreatmentHealthy Volunteers1
1RecruitingTreatmentAdult Glioblastoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Serous Adenocarcinoma / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Recurrent Uterine Corpus Carcinoma / Solid Neoplasms / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer1
1RecruitingTreatmentAdvanced Cancers1
1RecruitingTreatmentAdvanced Solid Tumors / Cancers1
1RecruitingTreatmentBrain Arteriovenous Malformations1
1RecruitingTreatmentCancer, Advanced1
1RecruitingTreatmentCancer, Breast / Colorectal Cancers / Esophagogastric Cancer / Malignant Neoplasm of Pancreas / Non-Small-Cell Lung Carcinoma (NSCLC) / Tumors1
1RecruitingTreatmentCarcinoma NOS1
1RecruitingTreatmentCervical Carcinoma / Colorectal Adenocarcinoma / Non-Squamous Non-Small Cell Lung Cancer / Platinum-refractory Ovarian Carcinoma / Renal Cell Adenocarcinoma1
1RecruitingTreatmentColorectal Cancers1
1RecruitingTreatmentColorectal Cancers / Glioblastoma Multiforme / Gliosarcoma / Renal Cell Adenocarcinoma1
1RecruitingTreatmentEndometrial Cancers / Fallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
1RecruitingTreatmentGlioblastoma Multiforme2
1RecruitingTreatmentGlioblastomas1
1RecruitingTreatmentGlioblastomas / Gliomas1
1RecruitingTreatmentHealthy Volunteers1
1RecruitingTreatmentInflammatory carcinoma of the breast1
1RecruitingTreatmentMalignant Gliomas1
1RecruitingTreatmentMetastatic Colorectal Cancers1
1RecruitingTreatmentNeoplasms, Brain1
1RecruitingTreatmentRetinopathy of Prematurity1
1RecruitingTreatmentSolid Cancers1
1RecruitingTreatmentTumors, Solid1
1SuspendedTreatmentAdenosquamous carcinoma of the cervix / Cervical Adenosarcoma / Cervical Carcinosarcoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Endometrial Clear Cell Adenocarcinoma / Endometrial Endometrioid Adenocarcinoma / Endometrial Mixed Adenocarcinoma / Endometrial Mucinous Adenocarcinoma / Endometrial Squamous Cell Carcinoma / Endometrial Transitional Cell Carcinoma / Endometrial Undifferentiated Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Malignant Ovarian Epithelial Tumor / Malignant Peritoneal Neoplasm / Ovarian Carcinosarcoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Stage IV Skin Melanoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma / Uterine Corpus Carcinosarcoma1
1SuspendedTreatmentVestibular Schwannomas1
1TerminatedTreatmentAdenocarcinoma of the Lung / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer1
1TerminatedTreatmentAdvanced Colorectal Cancer1
1TerminatedTreatmentAnaplastic Astrocytoma (AA) / Anaplastic Oligodendroglioma (AO) / High Grade Glioma: Glioblastoma (GBM) / High Grade Glioma: Gliosarcoma / Mixed Anaplastic Oligoastrocytoma (AOA)1
1TerminatedTreatmentCancer, Breast / Pleural Effusion, Malignant1
1TerminatedTreatmentCancer, Ovarian / Fallopian Tube Carcinoma / Ovarian Epithelial Cancer / Primary Peritoneal Carcinoma1
1TerminatedTreatmentCholangiocarcinomas / Hepatocellular,Carcinoma / Liver Cancer1
1TerminatedTreatmentColorectal Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
1TerminatedTreatmentMalignant Glioma (WHO Grade III or IV)1
1TerminatedTreatmentMetastatic Colorectal Cancers1
1TerminatedTreatmentNeoplasms1
1TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1TerminatedTreatmentRetinopathy of Prematurity1
1TerminatedTreatmentToxicity1
1TerminatedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1Unknown StatusTreatmentDiffuse Diabetic Macular Edema1
1Unknown StatusTreatmentIntravitreal Bevacizumab Injection / Pars Plana Vitrectomy / Retinopathy, Diabetic / Tractional Retinal Detachment1
1Unknown StatusTreatmentRefractory Malignant Ascites1
1Unknown StatusTreatmentLymphedema of the extremities1
1WithdrawnNot AvailableNeovascular Age-Related Macular Degeneration1
1WithdrawnTreatmentGlioblastoma Multiforme1
1WithdrawnTreatmentTumors, Central Nervous System1
1, 2Active Not RecruitingTreatmentAdenocarcinomas / Malignant Neoplasm of Colon / Metastasis / Rectal Carcinoma1
1, 2Active Not RecruitingTreatmentAdult Anaplastic Astrocytoma / Adult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Adult Mixed Glioma / Recurrent Adult Brain Neoplasm1
1, 2Active Not RecruitingTreatmentAdult Brain Glioblastoma / Glioblastoma Multiforme1
1, 2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1, 2Active Not RecruitingTreatmentGlioblastoma Multiforme3
1, 2Active Not RecruitingTreatmentLocally Advanced Sarcoma / Metastatic Sarcoma / Sarcomas / Soft Tissue Sarcoma (STS) / Unresectable Sarcoma1
1, 2Active Not RecruitingTreatmentMalignant Gliomas1
1, 2Active Not RecruitingTreatmentMetastatic Cancers / Renal Cancers1
1, 2Active Not RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
1, 2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2CompletedBasic ScienceAge-Related Macular Degeneration (ARMD) / Diabetic Macular Edema (DME) / Retinal Vein Occlusions(RVO)1
1, 2CompletedTreatmentAdenocarcinoma of the Rectum / Rectal Carcinoma1
1, 2CompletedTreatmentBrain Cancer / Malignant Gliomas / Recurrent Glioblastoma1
1, 2CompletedTreatmentCancer, Breast3
1, 2CompletedTreatmentCentral Nervous System Neoplasms / Neoplasms, Brain1
1, 2CompletedTreatmentChromophobe Renal Cell Carcinoma / Clear Cell Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Renal Cell Carcinoma Recurrent / Sarcomatoid Renal Cell Carcinoma / Stage IV Renal Cell Cancer1
1, 2CompletedTreatmentClear Cell Renal Cell Carcinoma1
1, 2CompletedTreatmentClear Cell Renal Cell Carcinoma / Recurrent Renal Cell Cancer / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2CompletedTreatmentClear Cell Renal Cell Carcinoma / Recurrent Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2CompletedTreatmentColon Cancer With Metastases to the Liver1
1, 2CompletedTreatmentColorectal Cancers3
1, 2CompletedTreatmentColorectal Cancers / Malignant Neoplasm of Colon / Metastatic Colorectal Cancers / Rectal Carcinoma1
1, 2CompletedTreatmentCorneal Graft Failure / Corneal Neovascularization1
1, 2CompletedTreatmentGlioblastomas / Neoplasms, Brain1
1, 2CompletedTreatmentLeptomeningeal Metastases1
1, 2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1, 2CompletedTreatmentLiver Cancer1
1, 2CompletedTreatmentLocally Advanced Gastric Carcinoma1
1, 2CompletedTreatmentLung Cancers2
1, 2CompletedTreatmentMale Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2CompletedTreatmentMalignant Gliomas1
1, 2CompletedTreatmentMalignant Neoplasm of Prostate2
1, 2CompletedTreatmentMetastatic Colorectal Cancers1
1, 2CompletedTreatmentMetastatic Melanoma1
1, 2CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Colon Cancer / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Non-small Cell Lung Cancer / Recurrent Pancreatic Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Colon Cancer / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Lymphoepithelioma of the Oropharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Pancreatic Cancer / Stage III Rectal Cancer / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Colon Cancer / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Pancreatic Cancer / Stage IV Rectal Cancer / Stage IV Renal Cell Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1, 2CompletedTreatmentNeoplasms, Colorectal1
1, 2CompletedTreatmentRecurrent Melanoma / Stage III Melanoma / Stage IV Melanoma / Unspecified Adult Solid Tumor, Protocol Specific1
1, 2CompletedTreatmentRecurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Salivary Gland Squamous Cell Carcinoma / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity1
1, 2CompletedTreatmentRetinopathy, Diabetic / Vitreous Hemorrhage1
1, 2CompletedTreatmentStage IV Colorectal Cancer1
1, 2Enrolling by InvitationTreatmentTumors, Solid1
1, 2Not Yet RecruitingTreatmentAdvanced Colorectal Cancer1
1, 2Not Yet RecruitingTreatmentColorectal Cancers1
1, 2Not Yet RecruitingTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2Not Yet RecruitingTreatmentMelanoma1
1, 2Not Yet RecruitingTreatmentNeuroendocrine Carcinoma of the Skin1
1, 2Not Yet RecruitingTreatmentNon Hodgkin Lymphoma (NHL)1
1, 2Not Yet RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentAdvanced Gastrointestinal Cancers1
1, 2RecruitingTreatmentAnaplastic Astrocytoma (AA) / Brain Stem Gliomas / Diffuse Intrinsic Pontine Glioma (DIPG) / DIPG / Glioblastoma Multiforme / Glioma, Astrocytic / Gliosarcoma / Low-Grade Gliomas / Optic Nerve Glioma / Pilocytic Astrocytoma / Pilomyxoid Astrocytoma / Pleomorphic Xanthoastrocytoma1
1, 2RecruitingTreatmentAnaplastic Astrocytoma (AA) / Brain Stem Gliomas / Diffuse Intrinsic Pontine Glioma (DIPG) / Fibrillary Astrocytoma of Brain / Glioblastoma Multiforme / Glioma of Brainstem / Mixed Oligodendroglioma-Astrocytoma / Pilomyxoid Astrocytoma1
1, 2RecruitingTreatmentAnaplastic Astrocytoma (AA) / Glioblastoma Multiforme1
1, 2RecruitingTreatmentCancer, Ovarian1
1, 2RecruitingTreatmentClear Cell Renal Cell Carcinoma / Stage IV Renal Cell Cancer1
1, 2RecruitingTreatmentCorneal Graft Failure / Corneal Neovascularization1
1, 2RecruitingTreatmentEGFR-mutant Lung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
1, 2RecruitingTreatmentGerm Cell Tumors1
1, 2RecruitingTreatmentGlioblastoma Multiforme1
1, 2RecruitingTreatmentGlioblastoma Multiforme / Gliomas / Gliosarcoma / Malignant Brain Tumors1
1, 2RecruitingTreatmentGlioblastoma Multiforme / Neoplasms, Brain1
1, 2RecruitingTreatmentGlioblastomas / Malignant Gliomas1
1, 2RecruitingTreatmentMalignant Solid Tumours1
1, 2RecruitingTreatmentMetastatic Pancreas Adenocarcinoma1
1, 2RecruitingTreatmentNeoplasms, Colorectal1
1, 2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)2
1, 2RecruitingTreatmentRecurrent Gliomas1
1, 2RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2SuspendedTreatmentAnaplastic Astrocytoma (AA) / Glioblastoma Multiforme1
1, 2TerminatedNot AvailableNon-Small-Cell Lung Carcinoma (NSCLC)1
1, 2TerminatedTreatmentAdult Anaplastic Astrocytoma / Adult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Recurrent Adult Brain Tumor1
1, 2TerminatedTreatmentGlioblastomas / Gliosarcoma / Neoplasms, Brain1
1, 2TerminatedTreatmentLung Cancers1
1, 2TerminatedTreatmentMalignant Neoplasm of Pancreas1
1, 2TerminatedTreatmentMalignant Neoplasm of Pancreas / Pancreatic Ductal Adenocarcinoma1
1, 2TerminatedTreatmentMalignant Neoplasm of Prostate1
1, 2TerminatedTreatmentMesothelioma1
1, 2TerminatedTreatmentMetastatic Colorectal Carcinoma1
1, 2TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1, 2TerminatedTreatmentRecurrent Renal Cell Cancer / Renal Cell Adenocarcinoma / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2Unknown StatusTreatmentAcute Nonarteritic Anterior Ischemic Optic Neuropathy1
1, 2Unknown StatusTreatmentGastric cancer stage IV1
1, 2Unknown StatusTreatmentHereditary Haemorrhagic Telangiectasia (HHT)1
1, 2Unknown StatusTreatmentMacular Degeneration1
1, 2Unknown StatusTreatmentMelanoma (Skin)1
1, 2Unknown StatusTreatmentRenal Cell Adenocarcinoma1
1, 2WithdrawnNot AvailableCancer, Ovarian / Primary Peritoneal Cancer1
1, 2WithdrawnTreatmentGlioblastoma Multiforme1
1, 2WithdrawnTreatmentLung Cancers1
1, 2WithdrawnTreatmentMetastatic Brain Tumors / Metastatic Melanoma1
2Active Not RecruitingNot AvailableAdenocarcinoma of the Gastro-oesophageal Junction / Metastatic Gastric Cancers1
2Active Not RecruitingBasic ScienceStage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingOtherNon-Small-Cell Lung Carcinoma (NSCLC)1
2Active Not RecruitingTreatmentAge-Related Macular Degeneration (AMD) / AMD / Eye Diseases / Macular Degeneration / Macular Degeneration, Age-related, 10 / Neovascular Age-Related Macular Degeneration / Retinal Degenerations / Retinal Diseases1
2Active Not RecruitingTreatmentAcoustic Schwannoma / Adult Anaplastic Meningioma / Adult Ependymoma / Adult Grade I Meningioma / Adult Grade II Meningioma / Adult Meningeal Hemangiopericytoma / Adult Papillary Meningioma / Neurofibromatosis Type 1 / Neurofibromatosis Type 2 / Recurrent Adult Brain Tumor1
2Active Not RecruitingTreatmentAdenocarcinoma of the Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Diffuse Adenocarcinoma of the Stomach / Intestinal Adenocarcinoma of the Stomach / Mixed Adenocarcinoma of the Stomach / Squamous Cell Carcinoma of the Esophagus / Stage IA Esophageal Cancer / Stage IA Gastric Cancer / Stage IB Esophageal Cancer / Stage IB Gastric Cancer / Stage IIA Esophageal Cancer / Stage IIA Gastric Cancer / Stage IIB Esophageal Cancer / Stage IIB Gastric Cancer / Stage IIIA Esophageal Cancer / Stage IIIA Gastric Cancer / Stage IIIB Esophageal Cancer / Stage IIIB Gastric Cancer / Stage IIIC Esophageal Cancer / Stage IIIC Gastric Cancer1
2Active Not RecruitingTreatmentAdenocarcinoma of the Lung / Non-Small-Cell Lung Carcinoma (NSCLC)1
2Active Not RecruitingTreatmentAdult Anaplastic Astrocytoma / Adult Anaplastic Ependymoma / Adult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma1
2Active Not RecruitingTreatmentAdult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Adult Oligodendroglioma / Recurrent Adult Brain Neoplasm1
2Active Not RecruitingTreatmentAdult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Recurrent Adult Brain Tumor1
2Active Not RecruitingTreatmentAdult Hepatocellular Carcinoma / Advanced Adult Hepatocellular Carcinoma / Endometrial Serous Adenocarcinoma / Localized Non-Resectable Adult Liver Carcinoma / Lung Carcinoid Tumor / Malignant Ovarian Mixed Epithelial Tumor / Malignant Pancreatic Gastrinoma / Malignant Pancreatic Glucagonoma / Malignant Pancreatic Insulinoma / Malignant Pancreatic Somatostatinoma / Metastatic Digestive System Neuroendocrine Tumor G1 / Ovarian Carcinosarcoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Surface Papillary Adenocarcinoma / Pancreatic Alpha Cell Adenoma / Pancreatic Beta Cell Adenoma / Pancreatic Delta Cell Adenoma / Pancreatic G-Cell Adenoma / Pancreatic Polypeptide Tumor / Recurrent Adult Liver Carcinoma / Recurrent Digestive System Neuroendocrine Tumor G1 / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Neuroendocrine Carcinoma / Recurrent Primary Peritoneal Carcinoma / Recurrent Uterine Corpus Carcinoma / Regional Digestive System Neuroendocrine Tumor G1 / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIA Uterine Corpus Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIB Uterine Corpus Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Stage IIIC Uterine Corpus Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer / Uterine Carcinosarcoma1
2Active Not RecruitingTreatmentAdvanced Colorectal Cancer1
2Active Not RecruitingTreatmentAdvanced Ovarian Carcinoma / Ovarian Carcinosarcoma / Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentAdvanced Solid Tumors / Carcinoids / Colorectal Cancers / Locally Advanced / Malignant Lymphomas / Metastatic Cancers / Non-Small-Cell Lung Carcinoma (NSCLC) / Sarcomas / Tumors, Solid1
2Active Not RecruitingTreatmentAnaplastic Astrocytoma (AA) / Brain Stem Gliomas / Glial Cell Tumors / Glioblastoma Multiforme / Gliomatosis Cerebri / Gliosarcoma / Malignant Gliomas1
2Active Not RecruitingTreatmentBrain Tumor, Recurrent / Glioblastomas / Gliomas1
2Active Not RecruitingTreatmentBrain and Central Nervous System Tumors4
2Active Not RecruitingTreatmentCancer of the Breast / Cancer, Breast / Neoplasms, Breast1
2Active Not RecruitingTreatmentCancer, Breast11
2Active Not RecruitingTreatmentCancer, Breast / HER2-Negative Breast Cancer / HER2-positive Breast Cancer / Recurrent Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingTreatmentCancer, Ovarian1
2Active Not RecruitingTreatmentCervical Cancer, Cancer, Metastatic Cancers / Cervical Cancers1
2Active Not RecruitingTreatmentChoriocarcinoma1
2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Recurrent Renal Cell Cancer / Renal Cell Carcinoma Recurrent / Stage IV Renal Cell Cancer1
2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Renal Cell Cancer / Type 1 Papillary Renal Cell Carcinoma / Type 2 Papillary Renal Cell Carcinoma1
2Active Not RecruitingTreatmentColorectal Cancers3
2Active Not RecruitingTreatmentColorectal Cancers / Liver Metastasis1
2Active Not RecruitingTreatmentDesmoplastic Small Round Cell Tumor (DSRCT) / Ewing Sarcoma of Bone or Soft Tissue / Localized Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Metastatic Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor1
2Active Not RecruitingTreatmentDiffuse Intrinsic Pontine Glioma (DIPG)1
2Active Not RecruitingTreatmentEGFR Activating Mutation / Stage IV Non-Small Cell Lung Cancer1
2Active Not RecruitingTreatmentEndometrial Adenocarcinomas / Endometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Serous Adenocarcinoma / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer / Stage IIIB Uterine Corpus Cancer / Stage IIIC Uterine Corpus Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer1
2Active Not RecruitingTreatmentEndometrial Cancers1
2Active Not RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach3
2Active Not RecruitingTreatmentEstrogen Receptor-negative Breast Cancer / HER2-Negative Breast Cancer / Progesterone Receptor-negative Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer / Triple-Negative Breast Cancer (TNBC)1
2Active Not RecruitingTreatmentFallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentGastric cancer stage IV1
2Active Not RecruitingTreatmentGastrin-Producing Neuroendocrine Tumor / Malignant Pancreatic Gastrinoma / Malignant Pancreatic Glucagonoma / Malignant Pancreatic Insulinoma / Malignant Pancreatic Somatostatinoma / Pancreatic Alpha Cell Adenoma / Pancreatic Beta Cell Adenoma / Pancreatic Delta Cell Adenoma / Pancreatic G-Cell Adenoma / Pancreatic Gastrinoma / Pancreatic Glucagonoma / Pancreatic Insulinoma / Pancreatic Neuroendocrine Tumor G1 / Pancreatic Neuroendocrine Tumor G2 / Pancreatic Polypeptide Tumor / Pancreatic Vipoma / Recurrent Pancreatic Carcinoma / Recurrent Pancreatic Neuroendocrine Carcinoma / Somatostatin-Producing Neuroendocrine Tumor / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2Active Not RecruitingTreatmentGastrinoma / Glucagonoma / Insulinoma / Pancreatic Polypeptide Tumor / Recurrent Islet Cell Carcinoma / Recurrent Pancreatic Cancer / Somatostatinoma / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2Active Not RecruitingTreatmentGastrointestinal Cancers1
2Active Not RecruitingTreatmentGiant Cell Glioblastoma / Glioblastomas / Gliosarcoma1
2Active Not RecruitingTreatmentGlioblastoma Multiforme2
2Active Not RecruitingTreatmentGlioblastoma Multiforme / Gliosarcoma1
2Active Not RecruitingTreatmentGlioblastoma Multiforme / Gliosarcoma / Malignant Gliomas1
2Active Not RecruitingTreatmentGlioblastomas4
2Active Not RecruitingTreatmentGlioblastomas / Gliosarcoma / Grade 4 Malignant Glioma / Malignant Gliomas1
2Active Not RecruitingTreatmentGliomas / High Grade Glioma (HGG)1
2Active Not RecruitingTreatmentGliosarcoma / Recurrent Adult Brain Tumor / Recurrent Glioblastoma1
2Active Not RecruitingTreatmentHemangiosarcoma / Paclitaxel1
2Active Not RecruitingTreatmentKaposi s Sarcoma (KS)1
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas1
2Active Not RecruitingTreatmentLiver Cancer3
2Active Not RecruitingTreatmentLiver Only Metastasis From KRAS Exon 2 Wild Type (Under Protocol 1.0-1.2 Edition) and RAS Wild Type (Under Protocol 2.0 Edition) Colorectal Cancer1
2Active Not RecruitingTreatmentLung Cancers4
2Active Not RecruitingTreatmentLung Cancers / Neoplasms Metastasis1
2Active Not RecruitingTreatmentLymphoma, Hodgkins1
2Active Not RecruitingTreatmentMalignant Peripheral Nerve Sheath Tumour (MPNST) / MPNST / Sarcomas1
2Active Not RecruitingTreatmentMalignant Fibrous Histiocytoma (MFH) of Bone / Sarcoma, Osteogenic1
2Active Not RecruitingTreatmentMalignant Neoplasm of Pancreas3
2Active Not RecruitingTreatmentMalignant Neoplasm of Stomach / Unresectable1
2Active Not RecruitingTreatmentMalignant Ovarian Epithelial Tumor / Ovarian Granulosa Cell Tumor / Ovarian Gynandroblastoma / Ovarian Sertoli-Leydig Cell Tumors / Ovarian Sex Cord Tumor With Annular Tubules / Ovarian Sex Cord-Stromal Tumor / Ovarian Sex Cord-Stromal Tumor of Mixed or Unclassified Cell Types / Ovarian Steroid Cell Tumor / Ovarian Stromal Cancer1
2Active Not RecruitingTreatmentMelanoma (Skin)1
2Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)2
2Active Not RecruitingTreatmentMetastatic Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
2Active Not RecruitingTreatmentMetastatic Colorectal Cancers4
2Active Not RecruitingTreatmentMetastatic Hormone Refractory Prostate Cancer1
2Active Not RecruitingTreatmentMetastatic Melanoma / Mucosal Melanoma / Recurrent Melanoma / Stage IV Skin Melanoma / Stage IV Uveal Melanoma1
2Active Not RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Nonsquamous Nonsmall Cell Neoplasm of Lung1
2Active Not RecruitingTreatmentNeoplasms, Breast1
2Active Not RecruitingTreatmentNeuroblastomas1
2Active Not RecruitingTreatmentNeuroblastomas / Sarcomas1
2Active Not RecruitingTreatmentNeurofibromatosis Type 2 / Progressive Vestibular Schwannomas1
2Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)4
2Active Not RecruitingTreatmentOvarian Sex-cord Stromal Tumor1
2Active Not RecruitingTreatmentProstatic Neoplasms1
2Active Not RecruitingTreatmentPulmonary Veno Occlusive Disease1
2Active Not RecruitingTreatmentRectal Adenocarcinoma / Stage II Rectal Cancer / Stage III Rectal Cancer1
2Active Not RecruitingTreatmentRectal Cancer Patients1
2Active Not RecruitingTreatmentRectal Carcinoma2
2Active Not RecruitingTreatmentRecurrent Childhood Medulloblastoma / Recurrent Childhood Pineoblastoma / Recurrent Childhood Supratentorial Embryonal Tumor, Not Otherwise Specified / Recurrent Childhood Supratentorial Primitive Neuroectodermal Tumor1
2Active Not RecruitingTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IV Colon Cancer / Stage IV Rectal Cancer1
2Active Not RecruitingTreatmentRecurrent Endometrial Carcinoma1
2Active Not RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentRenal Cancers1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma2
2Active Not RecruitingTreatmentRenal Cell Carcinoma Recurrent / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
2Active Not RecruitingTreatmentRetinopathy of Prematurity1
2Active Not RecruitingTreatmentSarcomas2
2Active Not RecruitingTreatmentStage III Ovarian Cancer / Stage IV Ovarian Cancer1
2Active Not RecruitingTreatmentTumors, Central Nervous System1
2CompletedNot AvailableMacular Degeneration / Macular Edema (ME) / Retinopathy, Diabetic1
2CompletedNot AvailableMalignant Gliomas1
2CompletedDiagnosticCancers1
2CompletedDiagnosticColorectal Cancers / Neoplasms Metastasis1
2CompletedPreventionPancreatic Cancer Metastatic1
2CompletedSupportive CareAdult Anaplastic Astrocytoma / Adult Anaplastic Ependymoma / Adult Anaplastic Meningioma / Adult Anaplastic Oligodendroglioma / Adult Brain Stem Glioma / Adult Central Nervous System Germ Cell Tumor / Adult Choroid Plexus Tumor / Adult Diffuse Astrocytoma / Adult Ependymoma / Adult Grade II Meningioma / Adult Grade III Meningioma / Adult Malignant Hemangiopericytoma / Adult Mixed Glioma / Adult Oligodendroglioma / Adult Papillary Meningioma / Adult Pineocytoma / Meningeal Melanocytoma / Neoplasms, Malignant / Radiation Toxicity / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Adult Brain Tumor / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage I Adenoid Cystic Carcinoma of the Oral Cavity / Stage I Basal Cell Carcinoma of the Lip / Stage I Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage I Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage I Lymphoepithelioma of the Nasopharynx / Stage I Lymphoepithelioma of the Oropharynx / Stage I Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage I Mucoepidermoid Carcinoma of the Oral Cavity / Stage I Salivary Gland Cancer / Stage I Squamous Cell Carcinoma of the Hypopharynx / Stage I Squamous Cell Carcinoma of the Larynx / Stage I Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage I Squamous Cell Carcinoma of the Nasopharynx / Stage I Squamous Cell Carcinoma of the Oropharynx / Stage I Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage I Verrucous Carcinoma of the Larynx / Stage I Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity1
2CompletedSupportive CareColorectal Cancers1
2CompletedTreatmentAcoustic Schwannoma / Neurofibromatosis Type 21
2CompletedTreatmentAdenocarcinoma of the Cervix / Cervical Adenosquamous Cell Carcinoma / Cervical Squamous Cell Carcinoma / Stage IB Cervical Cancer / Stage IIA Cervical Cancer / Stage IIB Cervical Cancer / Stage III Cervical Cancer1
2CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Advanced Colorectal Cancer1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Recurrent Non-small Cell Lung Cancer / Squamous Cell Carcinoma of Lung / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Malignant Neoplasm of Pancreas1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer1
2CompletedTreatmentAdenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer1
2CompletedTreatmentAdenocarcinoma of the Prostate / Malignant Neoplasm of Prostate1
2CompletedTreatmentAdenocarcinoma of the Prostate / Recurrent Prostate Cancer / Stage I Prostate Cancer / Stage IIA Prostate Cancer / Stage IIB Prostate Cancer / Stage III Prostate Cancer1
2CompletedTreatmentAdenocarcinoma of the Rectum / Mucinous Adenocarcinoma of the Colon / Recurrent Colon Cancer / Recurrent Rectal Cancer / Signet Ring Adenocarcinoma of the Colon / Stage IV Colon Cancer / Stage IV Rectal Cancer1
2CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Diffuse Adenocarcinoma of the Stomach / Intestinal Adenocarcinoma of the Stomach / Mixed Adenocarcinoma of the Stomach / Recurrent Gastric Cancer / Stage IIIA Gastric Cancer / Stage IIIB Gastric Cancer / Stage IIIC Gastric Cancer / Stage IV Gastric Cancer1
2CompletedTreatmentAdenocarcinomas / Carcinoma NOS / Hypernephroid / Nephroid Carcinoma / Renal Cell / Renal Cell Adenocarcinoma1
2CompletedTreatmentAdenocarcinomas / Non-Small-Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentAdenosquamous Cell Lung Cancer / Drug/Agent Toxicity by Tissue/Organ / Hemoptysis / Squamous Cell Carcinoma of Lung / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdult Brain Tumors / Malignant Gliomas / Recurrent Glioblastoma Multiforme1
2CompletedTreatmentAdult Glioblastoma / Adult Gliosarcoma / Recurrent Adult Brain Tumor1
2CompletedTreatmentAdult Primary Hepatocellular Carcinoma / Advanced Adult Primary Liver Cancer / Localized Unresectable Adult Primary Liver Cancer / Recurrent Adult Primary Liver Cancer1
2CompletedTreatmentAdult Primary Hepatocellular Carcinoma / Localized Unresectable Adult Primary Liver Cancer / Recurrent Adult Primary Liver Cancer1
2CompletedTreatmentAdult Rhabdomyosarcoma / Childhood Alveolar Rhabdomyosarcoma / Childhood Pleomorphic Rhabdomyosarcoma / Childhood Rhabdomyosarcoma With Mixed Embryonal and Alveolar Features / Previously Treated Childhood Rhabdomyosarcoma / Recurrent Adult Soft Tissue Sarcoma / Recurrent Childhood Rhabdomyosarcoma1
2CompletedTreatmentAdvanced Malignant Mesothelioma / Epithelial Mesothelioma / Localized Malignant Mesothelioma / Recurrent Malignant Mesothelioma / Sarcomatous Mesothelioma1
2CompletedTreatmentAdvanced Non-Small Cell Lung Cancer / Non-Small-Cell Lung Carcinoma (NSCLC) / Recurrent Non-small Cell Lung Cancer1
2CompletedTreatmentAdverse Effect of Radiation Therapy / Brain Necrosis / Nasopharyngeal Carcinoma1
2CompletedTreatmentAge Related Macular Degeneration (ARMD)1
2CompletedTreatmentAge Related Macular Degeneration (ARMD) / Macular Edema (ME) / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentAge Related Macular Degeneration (ARMD) / Proliferative Diabetic Retinopathy (PDR)1
2CompletedTreatmentAnaplastic Astrocytoma (AA) / Anaplastic Mixed Oligoastrocytoma / Anaplastic Oligodendroglioma (AO) / Glioblastomas / Gliosarcoma1
2CompletedTreatmentAnaplastic Large Cell Lymphoma / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Mantle Cell Lymphoma1
2CompletedTreatmentAstrocytomas / Glioblastomas1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia / Refractory Chronic Lymphocytic Leukemia1
2CompletedTreatmentBasal Cell Carcinoma (BCC) / Cancer, Ovarian / Metastatic Colorectal Cancers1
2CompletedTreatmentBiliary Tract Cancer / Gallbladder Adenocarcinoma1
2CompletedTreatmentBladder Cancers3
2CompletedTreatmentBrain Cancer / Glioblastomas1
2CompletedTreatmentBrain Cancer / Pediatric Cancers1
2CompletedTreatmentBrain and Central Nervous System Tumors2
2CompletedTreatmentBreast Cancer Invasive Nos1
2CompletedTreatmentCancer of the Rectum / Colorectal Cancers / Rectal Carcinoma1
2CompletedTreatmentCancer, Breast34
2CompletedTreatmentCancer, Breast / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentCancer, Breast / Neoplasms, Breast1
2CompletedTreatmentCancer, Ovarian7
2CompletedTreatmentCancer, Ovarian / Carcinoma of the Vulva / Cervical Cancers / Endometrial Cancers / Vaginal Cancers1
2CompletedTreatmentCancer, Ovarian / Clear Cell Mullerian Tumor / Fallopian Tube Cancer / Papillary Serous Mullerian Tumor / Primary Peritoneal Cancer1
2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Malignant Tumor of Peritoneum1
2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cancer3
2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Carcinoma2
2CompletedTreatmentCancers4
2CompletedTreatmentCancers / Colorectal Cancers / Malignant Neoplasm of Colon / Metastatic Cancers / Metastatic Colorectal Cancers / Rectal Carcinoma1
2CompletedTreatmentCancers / Myeloproliferative Disorders / Transitional Cell Carcinoma1
2CompletedTreatmentCarcinoma NOS1
2CompletedTreatmentCervical Cancers1
2CompletedTreatmentCervical Squamous Cell Carcinoma / Recurrent Cervical Cancer1
2CompletedTreatmentChildhood Cerebral Anaplastic Astrocytoma / Childhood Oligodendroglioma / Childhood Spinal Cord Neoplasm / Recurrent Childhood Brain Stem Glioma / Recurrent Childhood Ependymoma / Recurrent Childhood Medulloblastoma1
2CompletedTreatmentCholangiocarcinoma of the Extrahepatic Bile Duct / Cholangiocarcinoma of the Gallbladder / Gastrointestinal Cancers / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer1
2CompletedTreatmentCholangiocarcinomas2
2CompletedTreatmentCholangiocarcinomas / Gallbladder Cancer1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)1
2CompletedTreatmentColorectal Adenocarcinoma1
2CompletedTreatmentColorectal Cancer (CRC)1
2CompletedTreatmentColorectal Cancer Stage II1
2CompletedTreatmentColorectal Cancers37
2CompletedTreatmentColorectal Cancers / Malignant Neoplasm of Colon / Metastatic Colorectal Cancers / Rectal Carcinoma1
2CompletedTreatmentColorectal Cancers / Neoplasms Metastasis1
2CompletedTreatmentColorectal Cancers / Neoplasms, Colorectal1
2CompletedTreatmentColorectal, Cancer1
2CompletedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma1
2CompletedTreatmentDiabetic Macular Edema (DME)3
2CompletedTreatmentEndometrial Adenocarcinomas / Endometrial Adenosquamous Cell Carcinoma / Endometrial Clear Cell Carcinoma / Endometrial Papillary Serous Carcinoma / Stage I Endometrial Carcinoma / Stage II Endometrial Carcinoma / Stage III Endometrial Carcinoma / Stage IV Endometrial Carcinoma1
2CompletedTreatmentEndometrial Carcinoma1
2CompletedTreatmentEsophageal Cancers2
2CompletedTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach3
2CompletedTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Male Breast Carcinoma / Progesterone Receptor Negative / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Triple-Negative Breast Carcinoma1
2CompletedTreatmentEwing Sarcoma of Bone / Extraosseous Ewing Sarcoma / Peripheral Primitive Neuroectodermal Tumor / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor1
2CompletedTreatmentExtensive Stage Small Cell Lung Cancer2
2CompletedTreatmentFallopian Tube Cancer / Neoplasms, Ovarian / Primary Peritoneal Cancer1
2CompletedTreatmentFallopian Tube Cancer / Primary Peritoneal Cavity Cancer / Recurrent Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
2CompletedTreatmentFollicular Lymphoma (FL)1
2CompletedTreatmentGastrointestinal Cancers / Malignant Ascites1
2CompletedTreatmentGastrooesophageal Cancer / Malignant Neoplasm of Stomach1
2CompletedTreatmentGiant Cell Glioblastoma / Glioblastoma With Oligodendroglial Component / Glioblastomas / Gliosarcoma / Recurrent Glioblastoma / Relapsed Glioblastoma / Small Cell Glioblastoma1
2CompletedTreatmentGlioblastoma Multiforme8
2CompletedTreatmentGlioblastoma Multiforme / Gliosarcoma2
2CompletedTreatmentGlioblastoma Multiforme / Primary Brain Tumors1
2CompletedTreatmentGlioblastomas4
2CompletedTreatmentGlioblastomas / Gliosarcoma6
2CompletedTreatmentGlioblastomas / Gliosarcoma / Neoplasms, Brain1
2CompletedTreatmentGliomas2
2CompletedTreatmentGliomas / Neoplasms, Brain1
2CompletedTreatmentHIV Seronegativity / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)1
2CompletedTreatmentHead and Neck Carcinoma3
2CompletedTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentHemangiosarcoma / Histiocytoma / Leiomyosarcomas / Malignant Fibrous / Sarcomas1
2CompletedTreatmentHemorrhagic Hereditary Telangiectasia (HHT)1
2CompletedTreatmentHepatocellular,Carcinoma3
2CompletedTreatmentHepatocellular,Carcinoma / Liver Cancer1
2CompletedTreatmentHereditary Haemorrhagic Telangiectasia (HHT) / Morbus Osler / Nasal Bleeding1
2CompletedTreatmentHereditary Haemorrhagic Telangiectasia (HHT) / Nasal Bleeding1
2CompletedTreatmentIdiopathic Polypoidal Choroidal Vasculopathy1
2CompletedTreatmentKaposi s Sarcoma (KS)1
2CompletedTreatmentLeptomeningeal Metastasis / Metastatic Brain Tumors / Neoplasms, Breast1
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
2CompletedTreatmentLiver Cancer5
2CompletedTreatmentLocally Advanced Breast Cancer (LABC) / Metastatic Breast Cancer (MBC)1
2CompletedTreatmentLocally Advanced Non-Small Cell Lung Cancer / Non-Small-Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentLocally Recurrent and Metastatic Breast Cancer1
2CompletedTreatmentLocally Recurrent or Metastatic Breast Cancer1
2CompletedTreatmentLung Cancer Small Cell Lung Cancer (SCLC)2
2CompletedTreatmentLung Cancers17
2CompletedTreatmentLung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentLung Cancers / Small Cell Lung Carcinoma1
2CompletedTreatmentLymphocytic Leukemia, Chronic1
2CompletedTreatmentMacular Degeneration2
2CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentMacular Edema (ME) / Retinopathy, Diabetic1
2CompletedTreatmentMale Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentMale Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer1
2CompletedTreatmentMalignant Gliomas1
2CompletedTreatmentMalignant Gliomas / Recurrent High-Grade Gliomas1
2CompletedTreatmentMalignant Lymphomas3
2CompletedTreatmentMalignant Melanoma2
2CompletedTreatmentMalignant Neoplasm of Colon1
2CompletedTreatmentMalignant Neoplasm of Pancreas6
2CompletedTreatmentMalignant Neoplasm of Prostate5
2CompletedTreatmentMelanoma3
2CompletedTreatmentMelanoma (Skin)2
2CompletedTreatmentMesothelioma3
2CompletedTreatmentMetastases / Renal Cell Adenocarcinoma1
2CompletedTreatmentMetastatic Breast Cancer (MBC)8
2CompletedTreatmentMetastatic Colorectal Cancers10
2CompletedTreatmentMetastatic Gastrointestinal Carcinoid Tumor / Recurrent Gastrointestinal Carcinoid Tumor / Regional Gastrointestinal Carcinoid Tumor1
2CompletedTreatmentMetastatic Malignant Melanoma1
2CompletedTreatmentMetastatic Melanoma3
2CompletedTreatmentMetastatic Renal Cell Carcinoma2
2CompletedTreatmentMultiple Myeloma (MM)2
2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm2
2CompletedTreatmentNaive Unresectable Glioblastoma1
2CompletedTreatmentNeoplasm Recurrence, Local / Non-Small-Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentNeoplasms2
2CompletedTreatmentNeoplasms Metastasis / Neoplasms, Esophageal / Stomach Neoplasms1
2CompletedTreatmentNeoplasms, Brain / Non-Small-Cell Lung Carcinoma (NSCLC)1
2CompletedTreatmentNeoplasms, Breast1
2CompletedTreatmentNeoplasms, Colorectal5
2CompletedTreatmentNeoplasms, Esophageal / Stomach Neoplasms1
2CompletedTreatmentNeoplasms, Germ Cell and Embryonal1
2CompletedTreatmentNeoplasms, Ovarian2
2CompletedTreatmentNeoplasms, Pancreatic1
2CompletedTreatmentNeovascular Age-Related Macular Degeneration1
2CompletedTreatmentNeuroendocrine Carcinomas2
2CompletedTreatmentNeuroendocrine Tumors2
2CompletedTreatmentNon-Small-Cell Lung Cancer (NSCLC)2
2CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)29
2CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer4
2CompletedTreatmentOvarian Carcinoma / Primary Peritoneal Carcinoma1
2CompletedTreatmentOvarian Epithelial Cancer / Primary Peritoneal Carcinoma1
2CompletedTreatmentPrimary Peritoneal Carcinoma / Recurrent Ovarian Carcinoma / Stage IV Ovarian Cancer1
2CompletedTreatmentPrimary Peritoneal Cavity Cancer / Recurrent Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
2CompletedTreatmentPterygium2
2CompletedTreatmentRectal Adenocarcinoma1
2CompletedTreatmentRectal Carcinoma3
2CompletedTreatmentRectum Cancer1
2CompletedTreatmentRecurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentRecurrent Breast Carcinoma / Stage IV Breast Cancer1
2CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
2CompletedTreatmentRecurrent Endometrial Carcinoma1
2CompletedTreatmentRecurrent Glioblastoma1
2CompletedTreatmentRecurrent Glioblastoma Multiforme / Recurrent Gliosarcoma1
2CompletedTreatmentRecurrent Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma1
2CompletedTreatmentRecurrent Melanoma / Stage IV Melanoma1
2CompletedTreatmentRecurrent Melanoma / Stage IV Skin Melanoma1
2CompletedTreatmentRecurrent Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2CompletedTreatmentRecurrent Renal Cell Cancer / Stage IV Renal Cell Cancer1
2CompletedTreatmentRenal Cancers4
2CompletedTreatmentRenal Cancers / Renal Cell Adenocarcinoma3
2CompletedTreatmentRenal Cell Adenocarcinoma3
2CompletedTreatmentRenal Cell Carcinoma Recurrent / Stage IV Renal Cell Cancer1
2CompletedTreatmentRetinal Detachment / Retinopathy, Diabetic1
2CompletedTreatmentRetinal Neovascularization1
2CompletedTreatmentRetinopathy, Diabetic1
2CompletedTreatmentSarcomas1
2CompletedTreatmentSmall Cell Lung Carcinoma1
2CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2CompletedTreatmentStage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer1
2CompletedTreatmentStage II Squamous Cell Carcinoma of the Nasopharynx / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Nasopharynx1
2CompletedTreatmentAdvanced thymic carcinoma / Thymic Cancer1
2CompletedTreatmentTumors1
2CompletedTreatmentUnknown Primary Neoplasms2
2Enrolling by InvitationTreatmentColorectal Cancers1
2Enrolling by InvitationTreatmentMalignant Pleural Effusions / Non-Small-Cell Lung Carcinoma (NSCLC)1
2Enrolling by InvitationTreatmentOvarian Epithelial Cancer1
2Not Yet RecruitingTreatmentAnaplastic Thyroid Carcinoma / Malignant Neoplasms of Thyroid and Other Endocrine Glands / Poorly Differentiated Thyroid Cancer1
2Not Yet RecruitingTreatmentAstrocytomas1
2Not Yet RecruitingTreatmentColorectal Adenocarcinoma / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
2Not Yet RecruitingTreatmentColorectal Cancers1
2Not Yet RecruitingTreatmentCancer treatment / Colorectal Cancers / MSI / Resistance, APC1
2Not Yet RecruitingTreatmentColorectal Carcinomatosis1
2Not Yet RecruitingTreatmentEGFR Activating Mutation / EGFR NP_005219.2:p.T790M / Metastatic Malignant Neoplasm in the Brain / Non-Small Cell Lung Carcinoma (NSCLC) / Recurrent Non-Small Cell Lung Carcinoma1
2Not Yet RecruitingTreatmentGlioblastoma Multiforme1
2Not Yet RecruitingTreatmentGlioblastomas / Gliomas1
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers / MSI1
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancers1
2Not Yet RecruitingTreatmentNon Small Cell Lung Cancer Metastatic1
2Not Yet RecruitingTreatmentNon-Small-Cell Lung Cancer (NSCLC)1
2Not Yet RecruitingTreatmentRecurrent Colorectal Carcinoma / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
2Not Yet RecruitingTreatmentRecurrent Glioblastoma1
2Not Yet RecruitingTreatmentTransitional Cell Carcinoma1
2RecruitingNot AvailableCancers1
2RecruitingBasic ScienceRecurrent Glioblastoma1
2RecruitingSupportive CareMetastatic Brain Tumors / Radionecrosis1
2RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Stage IV Cervical Cancer / Stage IVA Cervical Cancer / Stage IVB Cervical Cancer1
2RecruitingTreatmentAdult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Recurrent Adult Brain Tumor1
2RecruitingTreatmentAdvanced Non-Clear Cell Kidney Cancer1
2RecruitingTreatmentAnaplastic (Malignant) Meningioma / Atypical Meningioma / Grade II Meningioma / Grade III Meningioma / Recurrent Meningiomas / Supratentorial Meningioma1
2RecruitingTreatmentAnaplastic Ependymoma / Ependymomas1
2RecruitingTreatmentBevacizumab / Metastatic Brain Tumors / Non Squamous Non-small Cell Lung Cancer1
2RecruitingTreatmentCancer, Breast4
2RecruitingTreatmentCancer, Breast / Metastatic Brain Tumors1
2RecruitingTreatmentCancer, Ovarian1
2RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Malignant Neoplasms of Female Genital Organs / Primary Peritoneal Cancer1
2RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cancer1
2RecruitingTreatmentCarcinoma, Breast1
2RecruitingTreatmentChoriocarcinoma / Epithelioid Trophoblastic Tumor / Gestational Trophoblastic Neoplasia / Placental Site Trophoblastic Tumor1
2RecruitingTreatmentCollecting Duct Carcinoma (Kidney)1
2RecruitingTreatmentColorectal Adenocarcinoma / KRAS wt Allele / Metastatic Colorectal Cancers / NRAS wt Allele / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
2RecruitingTreatmentColorectal Cancer Liver Metastases1
2RecruitingTreatmentColorectal Cancers3
2RecruitingTreatmentColorectal Cancers / Neoplasms / Neoplasms, Metastatic1
2RecruitingTreatmentDiabetes / Diabetic Macular Edema (DME) / Retinopathy, Diabetic1
2RecruitingTreatmentExtranodal NK/T-cell Lymphoma, Nasal Type1
2RecruitingTreatmentFallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
2RecruitingTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
2RecruitingTreatmentGBM / Glioblastoma Multiforme / Glioblastomas / Malignant Gliomas1
2RecruitingTreatmentGerm Cell Tumors1
2RecruitingTreatmentGlioblastoma - Category / Glioblastoma Multiforme1
2RecruitingTreatmentGlioblastomas2
2RecruitingTreatmentGlioblastomas / Gliomas / Gliosarcoma1
2RecruitingTreatmentGlioblastomas / Gliosarcoma1
2RecruitingTreatmentGliomas1
2RecruitingTreatmentHLRCC / Metastatic Papillary RCC1
2RecruitingTreatmentHuman Epidermal Growth Factor 2 Negative Carcinoma of Breast / Metastatic Breast Cancer (MBC)1
2RecruitingTreatmentLow Grade Glioma (LGG)1
2RecruitingTreatmentLung adenocarcinoma metastatic1
2RecruitingTreatmentMalignant Neoplasm of Colon1
2RecruitingTreatmentMalignant Neoplasms of Digestive Organs / Malignant Neoplasms of Lip Oral Cavity and Pharynx / Malignant Neoplasms of Mesothelial and Soft Tissue / Malignant Neoplasms of Respiratory and Intrathoracic Organs1
2RecruitingTreatmentMalignant Neoplasms of Female Genital Organs1
2RecruitingTreatmentMalignant Pleural Effusions1
2RecruitingTreatmentMedulloblastomas1
2RecruitingTreatmentMelanoma1
2RecruitingTreatmentMelanoma and Other Malignant Neoplasms of Skin1
2RecruitingTreatmentMetastatic Breast Cancer (MBC)1
2RecruitingTreatmentMetastatic Colorectal Cancers6
2RecruitingTreatmentMetastatic Renal Cell Carcinoma1
2RecruitingTreatmentMucinous Adenocarcinoma of the Rectum / Signet Ring Adenocarcinoma of the Rectum / Stage IIA Rectal Cancer / Stage IIB Rectal Cancer / Stage IIC Rectal Cancer / Stage IIIA Rectal Cancer / Stage IIIB Rectal Cancer / Stage IIIC Rectal Cancer1
2RecruitingTreatmentNasopharyngeal Neoplasms1
2RecruitingTreatmentNeoplasms, Colorectal1
2RecruitingTreatmentNeoplasms, Ovarian1
2RecruitingTreatmentNeuroblastomas1
2RecruitingTreatmentOvarian Epithelial Cancer Recurrent1
2RecruitingTreatmentPeritoneal Adhesion1
2RecruitingTreatmentPulmonary Fibrosis1
2RecruitingTreatmentRadiation Necrosis1
2RecruitingTreatmentRectal Carcinoma1
2RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2RecruitingTreatmentRecurrent Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma1
2RecruitingTreatmentRecurrent Respiratory Papillomatosis1
2RecruitingTreatmentRhabdomyosarcomas1
2RecruitingTreatmentStage III Esophageal Squamous Cell Carcinoma1
2RecruitingTreatmentStage III-IV or Recurrent Endometrial Cancer1
2TerminatedTreatmentAdenocarcinoma of the Lung / Bronchioloalveolar Carcinoma / Bronchioloalveolar Lung Carcinoma / Large Cell Lung Carcinoma / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2TerminatedTreatmentAdenocarcinomas / Malignant Neoplasm of Colon1
2TerminatedTreatmentAdult Acute Basophilic Leukemia / Adult Acute Eosinophilic Leukemia / Adult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myelomonocytic Leukemia (M4) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Childhood Acute Basophilic Leukemia / Childhood Acute Eosinophilic Leukemia / Childhood Acute Erythroleukemia (M6) / Childhood Acute Megakaryocytic Leukemia (M7) / Childhood Acute Monoblastic Leukemia (M5a) / Childhood Acute Monocytic Leukemia (M5b) / Childhood Acute Myeloblastic Leukemia With Maturation (M2) / Childhood Acute Myeloblastic Leukemia Without Maturation (M1) / Childhood Acute Myelomonocytic Leukemia (M4) / Secondary Acute Myeloid Leukemia / Untreated Adult Acute Myeloid Leukemia / Untreated Childhood Acute Myeloid Leukemia and Other Myeloid Malignancies1
2TerminatedTreatmentAdvanced Non-Small Cell Lung Cancer / Non-Small Cell Lung Cancer Stage IIIB / Stage IIIB or IV Non-Small Cell Lung Cancer1
2TerminatedTreatmentAdvanced Non-squamous NSCLC1
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD)2
2TerminatedTreatmentAgnogenic Myeloid Metaplasia1
2TerminatedTreatmentBiliary Tract Cancer1
2TerminatedTreatmentBlastic Phase Chronic Myelogenous Leukemia / Chronic Myelogenous Leukemia, BCR-ABL1 Positive1
2TerminatedTreatmentBrain Cancer1
2TerminatedTreatmentCancer, Breast7
2TerminatedTreatmentCancer, Breast / Cancer, Ovarian1
2TerminatedTreatmentCancer, Breast / Locally Recurrent and Metastatic Breast Cancer / Neoplasms, Breast / Tumors, Breast1
2TerminatedTreatmentCancer, Ovarian1
2TerminatedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cancer / Stage 3 Cancer / Stage 4 Cancer1
2TerminatedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cancer1
2TerminatedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Serous Cancer1
2TerminatedTreatmentCancer, Ovarian / Peritoneal Cancer1
2TerminatedTreatmentCarcinoma, Colorectal1
2TerminatedTreatmentCervical Cancers / Uterine Cancers1
2TerminatedTreatmentColorectal Cancers8
2TerminatedTreatmentColorectal Cancers / Metastases2
2TerminatedTreatmentColorectal Cancers / Metastatic Cancers1
2TerminatedTreatmentColorectal Cancers / Neoplasms Metastasis1
2TerminatedTreatmentColorectal Liver Metastases1
2TerminatedTreatmentCystoid Macular Edema / Macular Edema (ME) / Radiation Maculopathy / Radiation Retinopathy / Uveal Melanoma1
2TerminatedTreatmentEsophageal Diseases / Neoplasms, Esophageal1
2TerminatedTreatmentFallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
2TerminatedTreatmentGlioblastoma Multiforme2
2TerminatedTreatmentGlioblastoma Multiforme / Gliosarcoma / Malignant Gliomas1
2TerminatedTreatmentHepatic Metastases / KRAS Wild Type Colorectal Cancer / Metastatic Colorectal Cancers1
2TerminatedTreatmentHepatic Metastases / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
2TerminatedTreatmentHepatocellular,Carcinoma1
2TerminatedTreatmentHigh-Grade Gliomas1
2TerminatedTreatmentIntracranial Meningioma1
2TerminatedTreatmentKeloid Scars1
2TerminatedTreatmentKidney (Renal Cell) Cancer / Neoplasms, Kidney1
2TerminatedTreatmentLoco-regional Esophageal Cancer1
2TerminatedTreatmentLung Cancers4
2TerminatedTreatmentLymphoma, B-Cell / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentMalignant Neoplasm of Colon1
2TerminatedTreatmentMalignant Neoplasm of Pancreas1
2TerminatedTreatmentMelanoma / Metastatic Melanoma1
2TerminatedTreatmentMetastatic Breast Cancer (MBC)4
2TerminatedTreatmentMetastatic Colorectal Cancers1
2TerminatedTreatmentMetastatic Malignant Melanoma / Unresectable Malignant Melanoma1
2TerminatedTreatmentMetastatic Renal Cell Carcinoma1
2TerminatedTreatmentMultiple Myeloma (MM)1
2TerminatedTreatmentMyelodysplastic Syndromes1
2TerminatedTreatmentNeoplasms Metastasis / Neoplasms, Breast1
2TerminatedTreatmentNeoplasms, Colorectal4
2TerminatedTreatmentNon-Small-Cell Lung Cancer (NSCLC)1
2TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)8
2TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC) / Postmenopausal Women1
2TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC) / Stage IIIA (N2)1
2TerminatedTreatmentNon-Squamous Non-Small Cell Lung Cancer2
2TerminatedTreatmentPancreatic Cancer Metastatic1
2TerminatedTreatmentRectal Carcinoma1
2TerminatedTreatmentRecurrent Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2TerminatedTreatmentRenal Cancers2
2TerminatedTreatmentRenal Cell Adenocarcinoma3
2TerminatedTreatmentSarcomas / Soft Tissue Sarcoma (STS)1
2TerminatedTreatmentStage IV Colon Cancer / Stage IV Rectal Cancer1
2TerminatedTreatmentTriple Negative Metastatic Breast Cancer1
2Unknown StatusDiagnosticColorectal Cancers1
2Unknown StatusDiagnosticRecurrent Malignant Gliomas1
2Unknown StatusDiagnosticRenal Cancers1
2Unknown StatusPreventionBleb Fibrosis / Bleb Vascularity / Trabeculectomy Failure1
2Unknown StatusPreventionRetinal Detachment / Vitreoretinopathy, Proliferative1
2Unknown StatusPreventionVitreous Hemorrhage Secondary to PDR1
2Unknown StatusTreatmentBiliary Tract Cancer / Gallbladder Adenocarcinoma1
2Unknown StatusTreatmentBranch Retinal Vein Occlusion1
2Unknown StatusTreatmentCancer, Breast3
2Unknown StatusTreatmentCancer, Breast / Hormone-Sensitive Breast Cancer1
2Unknown StatusTreatmentCancer, Breast / Metastasis1
2Unknown StatusTreatmentCancer, Breast / Metastatic Breast Cancer (MBC) / Progressive Breast Cancer1
2Unknown StatusTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
2Unknown StatusTreatmentCarcinoma NOS / Metastatic Cancers / Neoplasms, Thyroid / Thyroid Cancers1
2Unknown StatusTreatmentColorectal Cancers4
2Unknown StatusTreatmentColorectal Cancers / Metastatic Cancers2
2Unknown StatusTreatmentCorneal Neovascularization1
2Unknown StatusTreatmentDiabetic Macular Edema (DME)1
2Unknown StatusTreatmentDiabetic Macular Edema (DME) / Non-Proliferative Diabetic Retinopathy / Proliferative Diabetic Retinopathy (PDR)1
2Unknown StatusTreatmentFallopian Tube Carcinoma / Ovarian Carcinoma / Primary Peritoneal Cancer1
2Unknown StatusTreatmentFibrosarcomas malignant / Fibrous Histiocytoma / Leiomyosarcomas / Liposarcoma / Soft Tissue Sarcoma (STS) / Synovial Sarcoma1
2Unknown StatusTreatmentGastric (Stomach) Cancer / Gastrointestinal Stromal Tumors (GISTs) / Malignant Neoplasm of Stomach / Neoplasm of Cardioesophageal Junction1
2Unknown StatusTreatmentGliomas1
2Unknown StatusTreatmentHER2-Negative Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Unknown StatusTreatmentHemangiosarcoma / Soft Tissue Sarcoma (STS)1
2Unknown StatusTreatmentHepatocellular,Carcinoma1
2Unknown StatusTreatmentHereditary Haemorrhagic Telangiectasia (HHT)2
2Unknown StatusTreatmentIntraocular Melanoma1
2Unknown StatusTreatmentLocally Advanced Rectal Adenocarcinoma / Rectal Neoplasms1
2Unknown StatusTreatmentLocally Advanced Rectal Cancer1
2Unknown StatusTreatmentLung Cancers3
2Unknown StatusTreatmentLung, Carcinoma1
2Unknown StatusTreatmentMacular Degeneration1
2Unknown StatusTreatmentMacular Edema (ME) / Retinopathy, Diabetic1
2Unknown StatusTreatmentMalignant Neoplasm of Prostate1
2Unknown StatusTreatmentMalignant Pleural Effusions1
2Unknown StatusTreatmentMetastatic Colorectal Cancers3
2Unknown StatusTreatmentMetastatic Renal Cell Carcinoma1
2Unknown StatusTreatmentNeoplasms, Brain1
2Unknown StatusTreatmentNeoplasms, Colorectal / Neoplasms, Hepatic1
2Unknown StatusTreatmentNeuroendocrine Carcinomas1
2Unknown StatusTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)3
2Unknown StatusTreatmentOvarian Cancer With Malignant Ascites1
2Unknown StatusTreatmentRectal Carcinoma1
2Unknown StatusTreatmentRefractory Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
2Unknown StatusTreatmentRenal Cancers1
2Unknown StatusTreatmentRetinovascular Disease1
2Unknown StatusTreatmentUntreated Advanced Non-Small Cell Lung Cancer1
2Unknown StatusTreatmentUntreated Mantle Cell Lymphoma1
2WithdrawnPreventionAcute Respiratory Distress Syndrome (ARDS) / Severe Sepsis1
2WithdrawnPreventionMalignant Ascites1
2WithdrawnTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
2WithdrawnTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage I Pancreatic Cancer / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer1
2WithdrawnTreatmentAdrenocortical Carcinoma1
2WithdrawnTreatmentAdult Brain Glioblastoma / Recurrent Adult Brain Neoplasm1
2WithdrawnTreatmentB-Cell Chronic Lymphocytic Leukemia / Refractory Chronic Lymphocytic Leukemia1
2WithdrawnTreatmentCancer, Breast1
2WithdrawnTreatmentCancer, Ovarian / Fallopian Tube Neoplasms / Primary Peritoneal1
2WithdrawnTreatmentCervical Cancers1
2WithdrawnTreatmentColon Cancer Liver Metastasis1
2WithdrawnTreatmentColorectal Cancers2
2WithdrawnTreatmentColorectal Cancers / Metastatic Cancers2
2WithdrawnTreatmentGlioblastomas1
2WithdrawnTreatmentLung Cancer Small Cell Lung Cancer (SCLC)1
2WithdrawnTreatmentLung Cancers1
2WithdrawnTreatmentMetastatic Colorectal Cancers2
2WithdrawnTreatmentNeoplasms, Colorectal1
2WithdrawnTreatmentNeoplasms, Head and Neck1
2WithdrawnTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2WithdrawnTreatmentOesophageal Carcinoma1
2WithdrawnTreatmentRenal Cell Adenocarcinoma1
2WithdrawnTreatmentRetinopathy of Prematurity1
2WithdrawnTreatmentUnknown Primary Tumors1
2, 3Active Not RecruitingTreatmentAnaplastic Astrocytoma (AA) / Glioblastoma Multiforme1
2, 3Active Not RecruitingTreatmentCarcinoid tumour of the gastrointestinal tract / Islet Cell Tumor / Lung Cancers / Neoplastic Syndrome / Neuroendocrine Tumors1
2, 3Active Not RecruitingTreatmentChildhood Cerebellar Anaplastic Astrocytoma / Childhood Cerebral Anaplastic Astrocytoma / Childhood Spinal Cord Neoplasm / Untreated Childhood Brain Stem Glioma / Untreated Childhood Cerebral Astrocytoma1
2, 3Active Not RecruitingTreatmentColorectal Cancers1
2, 3Active Not RecruitingTreatmentProliferative Diabetic Retinopathy (PDR)1
2, 3CompletedDiagnosticColorectal Cancers1
2, 3CompletedTreatmentAdenocarcinoma of the Lung / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Recurrent Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2, 3CompletedTreatmentColorectal Cancers1
2, 3CompletedTreatmentCorneal Neovascularization1
2, 3CompletedTreatmentGlaucoma3
2, 3CompletedTreatmentHER-2 Positive Breast Cancer / Inflammatory carcinoma of breast stage IV / Inflammatory carcinoma of the breast / Invasive Ductal Breast Carcinoma / Malignant Neoplasm of Female Breast / Mucinous Breast Cancer Stage II / Tubular Breast Cancer Stage II / Tubular Breast Cancer Stage III1
2, 3CompletedTreatmentMacular Degeneration1
2, 3CompletedTreatmentMacular Edema (ME)1
2, 3CompletedTreatmentNon-Ischemic Central Retinal Vein Occlusion1
2, 3CompletedTreatmentRecurrent Pterygium1
2, 3Not Yet RecruitingTreatmentAbdominal wall neoplasm / Carcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal / Peritoneal Diseases1
2, 3Not Yet RecruitingTreatmentDiabetic Macular Edema (DME)1
2, 3Not Yet RecruitingTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / High Grade Fallopian Tube Serous Adenocarcinoma / High Grade Ovarian Serous Adenocarcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Primary Peritoneal High Grade Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
2, 3RecruitingBasic ScienceAge Related Macular Degeneration (ARMD)1
2, 3RecruitingTreatmentDiabetic Macular Edema (DME)2
2, 3RecruitingTreatmentOesophagogastric Cancer1
2, 3RecruitingTreatmentProgression Free Survival1
2, 3RecruitingTreatmentRetinal Vein Occlusions(RVO)1
2, 3TerminatedTreatmentHereditary Haemorrhagic Telangiectasia (HHT) / Nasal Bleeding1
2, 3TerminatedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2, 3Unknown StatusNot AvailableMacular Edema (ME) / Retinopathy, Diabetic1
2, 3WithdrawnTreatmentCarcinoma, Colorectal / Hepatic Metastases1
3Active Not RecruitingTreatmentAbdominal wall neoplasm / Fallopian Tube Neoplasms / Genital Diseases, Female / Neoplasms, Ovarian / Ovarian Diseases1
3Active Not RecruitingTreatmentAdenocarcinoma, Mucinous / Carcinoma, Undifferentiated / Clear Cell Adenocarcinoma / Fallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Malignant Ovarian Mixed Epithelial Tumor / Ovarian Brenner Tumor / Ovarian Clear Cell Adenocarcinofibroma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Adenocarcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
3Active Not RecruitingTreatmentAdult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Cognitive Side Effects of Cancer Therapy1
3Active Not RecruitingTreatmentAdvanced Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentAge Related Macular Degeneration (ARMD)1
3Active Not RecruitingTreatmentAge-Related Macular Degeneration (ARMD)1
3Active Not RecruitingTreatmentBladder Urothelial Carcinoma / Distal Urethral Carcinoma / Infiltrating Bladder Urothelial Carcinoma Associated With Urethral Carcinoma / Metastatic Urothelial Carcinoma of the Renal Pelvis and Ureter / Proximal Urethral Carcinoma / Recurrent Bladder Carcinoma / Recurrent Prostate Carcinoma / Recurrent Urethra Carcinoma / Recurrent Urothelial Carcinoma of the Renal Pelvis and Ureter / Regional Urothelial Carcinoma of the Renal Pelvis and Ureter / Stage IV Bladder Cancer / Stage IV Prostate Cancer / Stage IV Urethral Cancer / Ureter Carcinoma1
3Active Not RecruitingTreatmentBorderline Ovarian Mucinous Tumor / Ovarian Mucinous Cystadenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Stage IA Fallopian Tube Cancer / Stage IA Ovarian Cancer / Stage IB Fallopian Tube Cancer / Stage IB Ovarian Cancer / Stage IC Fallopian Tube Cancer / Stage IC Ovarian Cancer / Stage IIA Fallopian Tube Cancer / Stage IIA Ovarian Cancer / Stage IIB Fallopian Tube Cancer / Stage IIB Ovarian Cancer / Stage IIC Fallopian Tube Cancer / Stage IIC Ovarian Cancer / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer1
3Active Not RecruitingTreatmentCancer, Breast3
3Active Not RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO)1
3Active Not RecruitingTreatmentChoroidal Subfoveal/Juxtafoveal Neovascularization in High Myopia1
3Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Renal Cell Carcinoma Recurrent / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
3Active Not RecruitingTreatmentCognition Disorders / Disability Evaluation / Glioblastoma Multiforme1
3Active Not RecruitingTreatmentCognitive/Functional Effects / Colorectal Cancers / Neurotoxicity1
3Active Not RecruitingTreatmentColon Mucinous Adenocarcinoma / Colon Signet Ring Cell Adenocarcinoma / Lynch Syndrome / Stage IIA Colon Cancer / Stage IIB Colon Cancer / Stage IIC Colon Cancer1
3Active Not RecruitingTreatmentColorectal Cancers3
3Active Not RecruitingTreatmentColorectal Cancers / Metastases1
3Active Not RecruitingTreatmentDigestive System Neoplasms / Intestinal Neoplasms / Neoplasms Metastasis / Neoplasms, Colorectal / Neoplasms, Gastrointestinal1
3Active Not RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Negative / HER2/Neu Positive / Male Breast Carcinoma / Progesterone Receptor Negative / Progesterone Receptor Positive / Recurrent Breast Carcinoma / Stage IIIC Breast Cancer AJCC v6 / Stage IV Breast Cancer1
3Active Not RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Negative / Male Breast Carcinoma / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
3Active Not RecruitingTreatmentEstrogen Receptor Positive / Progesterone Receptor Positive / Recurrent Breast Carcinoma / Stage IIIB Breast Cancer / Stage IV Breast Cancer1
3Active Not RecruitingTreatmentFallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Malignant Ovarian Mixed Epithelial Tumor / Ovarian Brenner Tumor / Ovarian Clear Cell Adenocarcinofibroma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Stage IIA Fallopian Tube Cancer / Stage IIA Ovarian Cancer / Stage IIB Fallopian Tube Cancer / Stage IIB Ovarian Cancer / Stage IIC Fallopian Tube Cancer / Stage IIC Ovarian Cancer / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer / Undifferentiated Ovarian Carcinoma1
3Active Not RecruitingTreatmentGlioblastomas1
3Active Not RecruitingTreatmentLung Cancers1
3Active Not RecruitingTreatmentMalignant Ovarian Mixed Epithelial Tumor / Ovarian Brenner Tumor / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Stage IIA Fallopian Tube Cancer / Stage IIA Ovarian Cancer / Stage IIB Fallopian Tube Cancer / Stage IIB Ovarian Cancer / Stage IIC Fallopian Tube Cancer / Stage IIC Ovarian Cancer / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Undifferentiated Ovarian Carcinoma1
3Active Not RecruitingTreatmentMetastatic Breast Cancer (MBC)1
3Active Not RecruitingTreatmentMetastatic Colorectal Cancers1
3Active Not RecruitingTreatmentNeuroendocrine Carcinomas1
3Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)2
3Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentNon-Squamous Non-Small Cell Lung Cancer2
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentRecurrent Hypopharyngeal Squamous Cell Carcinoma / Recurrent Laryngeal Squamous Cell Carcinoma / Recurrent Laryngeal Verrucous Carcinoma / Recurrent Lip and Oral Cavity Squamous Cell Carcinoma / Recurrent Metastatic Squamous Cell Carcinoma in the Neck With Occult Primary / Recurrent Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Recurrent Oral Cavity Verrucous Carcinoma / Recurrent Oropharyngeal Squamous Cell Carcinoma / Recurrent Salivary Gland Carcinoma / Salivary Gland Squamous Cell Carcinoma / Squamous Cell Carcinoma Metastatic in the Neck With Occult Primary / Stage IV Hypopharyngeal Squamous Cell Carcinoma / Stage IV Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Major Salivary Gland Cancer AJCC v7 / Stage IV Major Salivary Gland Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Verrucous Carcinoma / Stage IVA Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Major Salivary Gland Cancer AJCC v7 / Stage IVA Major Salivary Gland Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Verrucous Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Verrucous Carcinoma / Stage IVB Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Major Salivary Gland Cancer AJCC v7 / Stage IVB Major Salivary Gland Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Verrucous Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Laryngeal Squamous Cell Carcinoma / Stage IVC Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Laryngeal Verrucous Carcinoma / Stage IVC Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVC Major Salivary Gland Cancer AJCC v7 / Stage IVC Major Salivary Gland Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVC Oral Cavity Verrucous Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma / Stage IVC Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Tongue Carcinoma / Untreated Metastatic Squamous Cell Carcinoma to Neck With Occult Primary1
3Active Not RecruitingTreatmentRecurrent Large Cell Lung Carcinoma / Recurrent Lung Adenocarcinoma / Recurrent Squamous Cell Lung Carcinoma / Stage IV Large Cell Lung Carcinoma / Stage IV Lung Adenocarcinoma / Stage IV Squamous Cell Lung Carcinoma1
3Active Not RecruitingTreatmentRecurrent Ovarian Cancer1
3Active Not RecruitingTreatmentRecurrent Platinum-sensitive Ovarian Cancer1
3Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentStage IB Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIIA Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentTumors, Solid1
3CompletedNot AvailableDiabetic Macular Edema (DME)1
3CompletedPreventionCataracts / Cystoid Macular Edema / Diabetes Mellitus (DM)1
3CompletedSupportive CareCancers / Colorectal Cancers / Fevers / Locally Advanced / Malignant Neoplasm of Colon / Metastatic Colorectal Cancers / Neutropenias / Rectal Carcinoma1
3CompletedTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Recurrent Cervical Carcinoma / Stage IVB Cervical Cancer1
3CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage III Colon Cancer / Stage III Rectal Cancer / Stage IV Colon Cancer / Stage IV Rectal Cancer1
3CompletedTreatmentAdenocarcinoma of the Colon / Stage IIA Colon Cancer / Stage IIB Colon Cancer / Stage IIC Colon Cancer / Stage IIIA Colon Cancer / Stage IIIB Colon Cancer / Stage IIIC Colon Cancer1
3CompletedTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
3CompletedTreatmentAdenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer1
3CompletedTreatmentAdenocarcinomas1
3CompletedTreatmentAge Related Macular Degeneration (ARMD)2
3CompletedTreatmentBranch Retinal Vein Occlusion1
3CompletedTreatmentCancer, Breast8
3CompletedTreatmentCancer, Breast / Colorectal Cancers / Metastases1
3CompletedTreatmentCancer, Ovarian3
3CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cavity Cancer1
3CompletedTreatmentCentral Retinal Vein Occlusion (CRVO)1
3CompletedTreatmentColorectal Cancers16
3CompletedTreatmentDiabetic Macular Edema (DME)3
3CompletedTreatmentDiabetic Macular Edema (DME) / Proliferative Diabetic Retinopathy (PDR) / Retinopathy, Diabetic1
3CompletedTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Malignant Ovarian Mixed Epithelial Tumor / Ovarian Brenner Tumor / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
3CompletedTreatmentGastrointestinal Stromal Tumors1
3CompletedTreatmentGlioblastomas1
3CompletedTreatmentMacular Edema (ME) / Retinal Vein Occlusions(RVO)1
3CompletedTreatmentMacular Edema (ME) / Retinopathy, Diabetic1
3CompletedTreatmentMalignant Neoplasm of Pancreas1
3CompletedTreatmentMalignant Neoplasm of Stomach1
3CompletedTreatmentMalignant Pleural Effusions1
3CompletedTreatmentMetastatic Breast Cancer (MBC)3
3CompletedTreatmentMetastatic Colorectal Cancers2
3CompletedTreatmentMetastatic Non-Small Cell Lung Cancer1
3CompletedTreatmentMultifocal Choroiditis / Serpiginous Choroiditis / Vogt Koyanagi Harada Disease1
3CompletedTreatmentMyopia / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentNeoplasms, Breast1
3CompletedTreatmentNeoplasms, Colorectal2
3CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)3
3CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer4
3CompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
3CompletedTreatmentRecurrent Uterine Corpus Sarcoma / Stage IIIA Uterine Sarcoma / Stage IIIB Uterine Sarcoma / Stage IIIC Uterine Sarcoma / Stage IVA Uterine Sarcoma / Stage IVB Uterine Sarcoma / Uterine Corpus Leiomyosarcoma1
3CompletedTreatmentRenal Cancers1
3CompletedTreatmentRenal Cell Adenocarcinoma2
3CompletedTreatmentRetinal Diseases1
3CompletedTreatmentRetinal Vein Occlusions(RVO)1
3CompletedTreatmentSubfoveal Choroidal Neovascularization1
3Not Yet RecruitingTreatmentColorectal Adenocarcinoma / High-Frequency Microsatellite Instability / Stage IV Colorectal Cancer / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
3Not Yet RecruitingTreatmentGlaucoma1
3RecruitingNot AvailableAdenocarcinoma of Lung Metastatic to Brain / Bevacizumab / Brain Radiotherapy / Cerebral Metastases / Cerebral Radiotherapy / Metastatic Non-Small Cell Lung Cancer / Non Epidermoid / Non-Small-Cell Lung Carcinoma (NSCLC)1
3RecruitingTreatmentAbdominal wall neoplasm / Cancer, Ovarian / Fallopian Tube Cancer1
3RecruitingTreatmentCarcinoma, Colorectal1
3RecruitingTreatmentColorectal Cancers1
3RecruitingTreatmentCorneal Newvessels1
3RecruitingTreatmentGlioblastomas / Progression / Recurrences1
3RecruitingTreatmentLung Cancers / Non-Small-Cell Lung Carcinoma (NSCLC)1
3RecruitingTreatmentMetastatic Colorectal Cancers3
3RecruitingTreatmentNeoplasms, Colorectal1
3RecruitingTreatmentNon-Small Cell Lung Carcinoma (NSCLC)1
3RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)3
3RecruitingTreatmentNon-Squamous Non-Small Cell Lung Cancer2
3TerminatedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage III Colon Cancer / Stage III Rectal Cancer / Stage IV Colon Cancer / Stage IV Rectal Cancer1
3TerminatedTreatmentAdenocarcinoma of the Rectum / Stage II Rectal Cancer / Stage III Rectal Cancer1
3TerminatedTreatmentCancer, Breast2
3TerminatedTreatmentCarcinoma, Breast / HER2/Neu Positive / Male Breast Carcinoma / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
3TerminatedTreatmentColorectal Cancers1
3TerminatedTreatmentColorectal Cancers / Hepatic Metastases1
3TerminatedTreatmentFirst Line Metastatic Breast Cancer1
3TerminatedTreatmentLymphoma, B-Cell1
3TerminatedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
3TerminatedTreatmentUveitis1
3Unknown StatusNot AvailableCystoid Macular Edema1
3Unknown StatusTreatmentAge Related Macular Degeneration (ARMD)2
3Unknown StatusTreatmentAge-Related Neovascular Macular Degeneration1
3Unknown StatusTreatmentCancer, Breast / Cardiac Toxicity / Perioperative/Postoperative Complications1
3Unknown StatusTreatmentChoroidal Neovascularisation / Polypoidal Choroidal Vasculopathy (PCV)1
3Unknown StatusTreatmentColorectal Cancers2
3Unknown StatusTreatmentColorectal Cancers / Neoplasms Metastasis1
3Unknown StatusTreatmentDiabetic Macular Edema (DME)3
3Unknown StatusTreatmentDiffuse Diabetic Macular Edema1
3Unknown StatusTreatmentInflammatory Reaction / Pterygium1
3Unknown StatusTreatmentMalignant Neoplasm of Colon / Metastatic Colorectal Cancers / Rectal Carcinoma1
3Unknown StatusTreatmentMetastatic Breast Cancer (MBC)1
3Unknown StatusTreatmentMetastatic Colorectal Cancers2
3Unknown StatusTreatmentNeovascular Age-Related Macular Degeneration1
3Unknown StatusTreatmentRetinopathy, Diabetic1
3Unknown StatusTreatmentTelangiectasias1
3WithdrawnTreatmentAge-Related Macular Degeneration (ARMD)1
3WithdrawnTreatmentColorectal Cancers1
3WithdrawnTreatmentRenal Cell Adenocarcinoma1
3WithdrawnTreatmentWet Age-Related Macular Degeneration1
4Active Not RecruitingTreatmentCancer, Ovarian1
4CompletedNot AvailableDiabetic Macular Edema (DME) / Retinopathy, Diabetic1
4CompletedNot AvailableMacular Degeneration1
4CompletedTreatmentAge Related Macular Degeneration (ARMD)1
4CompletedTreatmentAge-Related Macular Degeneration (ARMD)1
4CompletedTreatmentCancer, Breast2
4CompletedTreatmentColorectal Cancer, Neoplasm Metastasis / Colorectal Cancers1
4CompletedTreatmentColorectal Cancers3
4CompletedTreatmentCorneal Neovascularization1
4CompletedTreatmentDiabetic Macular Edema (DME)4
4CompletedTreatmentDiabetic Traction Retinal Detachment / Proliferative Diabetic Retinopathy (PDR) / Vitreous Hemorrhage1
4CompletedTreatmentFibrosis / Glaucoma / Optic Neuropathies1
4CompletedTreatmentGlaucoma / Iris Neovascularization1
4CompletedTreatmentMacular Edema (ME)1
4CompletedTreatmentMacular Edema Caused by Retinal Vein Occlusion1
4CompletedTreatmentNeovascular Age-Related Macular Degeneration1
4CompletedTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
4CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer1
4CompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
4CompletedTreatmentProliferative Diabetic Retinopathy (PDR) / Vitreous Hemorrhage1
4CompletedTreatmentPterygium1
4CompletedTreatmentRetinal Vein Occlusions(RVO)1
4CompletedTreatmentRetinopathy, Diabetic1
4Enrolling by InvitationTreatmentDiabetic Macular Edema (DME)1
4Not Yet RecruitingTreatmentCorneal Neovascularization1
4Not Yet RecruitingTreatmentEye Diseases / Premature Births / Retinal Diseases / Type 1 Retinopathy of Prematurity Both Eyes1
4Not Yet RecruitingTreatmentPterygium of Conjunctiva and Cornea1
4Not Yet RecruitingTreatmentRecurrent Pterygium1
4RecruitingNot AvailableBreast Cancer Recurrent / HER2/Neu-negative Carcinoma of Breast / Hormone Receptor Positive Malignant Neoplasm of Breast1
4RecruitingHealth Services ResearchMalignant Neoplasm of Colon / Unresectable Metastasis Originating in Colonic Cancer1
4RecruitingTreatmentHemophilia / Synovitis1
4RecruitingTreatmentHereditary Haemorrhagic Telangiectasia (HHT) / Nasal Bleeding1
4RecruitingTreatmentNeoplasms1
4TerminatedTreatmentColorectal Cancers1
4TerminatedTreatmentColorectal Cancers / Neoplasms Metastasis1
4Unknown StatusSupportive CareGlaucoma1
4Unknown StatusTreatmentBleb Vascularity / Conjunctival Scarring1
4Unknown StatusTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
4Unknown StatusTreatmentDiabetic Macular Edema (DME) / Non-Proliferative Diabetic Retinopathy / Proliferative Diabetic Retinopathy (PDR)1
4Unknown StatusTreatmentDiffuse Diabetic Macular Edema1
4Unknown StatusTreatmentLiver Metastasis / Malignant Neoplasm of Stomach1
4Unknown StatusTreatmentMacular Edema (ME)1
4WithdrawnTreatmentCancer, Breast2
Not AvailableActive Not RecruitingTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Squamous Cell Carcinoma of Lung / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer1
Not AvailableActive Not RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cancer1
Not AvailableActive Not RecruitingTreatmentCancer, Ovarian / Fallopian Tubes Cancer / Peritoneal Cancer1
Not AvailableActive Not RecruitingTreatmentColorectal Cancers / Liver Metastasis1
Not AvailableCompletedNot AvailableAnal Carcinoma / Malignant Neoplasm of Colon / Neoplasms, Colorectal / Rectal Carcinoma1
Not AvailableCompletedNot AvailableCancer, Breast1
Not AvailableCompletedNot AvailableCancers1
Not AvailableCompletedNot AvailableCancers / Endothelial Dysfunction / Hypertensive1
Not AvailableCompletedNot AvailableCancers / Hypertensive1
Not AvailableCompletedNot AvailableColorectal Cancers3
Not AvailableCompletedNot AvailableColorectal Liver Metastases1
Not AvailableCompletedNot AvailableLung Cancers2
Not AvailableCompletedNot AvailableMacular Edema (ME) / Retinal Vein Occlusions(RVO)1
Not AvailableCompletedNot AvailableMetastatic Colorectal Cancers2
Not AvailableCompletedNot AvailableNon-Squamous Non-Small Cell Lung Cancer1
Not AvailableCompletedNot AvailableNonsquamous Nonsmall Cell Neoplasm of Lung1
Not AvailableCompletedNot AvailableOvarian Epithelial Cancer1
Not AvailableCompletedNot AvailableRenal Cell Adenocarcinoma3
Not AvailableCompletedBasic ScienceClear Cell Renal Cell Carcinoma1
Not AvailableCompletedBasic ScienceGlioblastomas / Gliomas1
Not AvailableCompletedBasic ScienceProliferative Diabetic Retinopathy (PDR)1
Not AvailableCompletedHealth Services ResearchDiabetic Macular Edema (DME) / Exudative Macular Degeneration1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD)1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD) / Central Retinal Vein Occlusion (CRVO) / Diabetic Macular Edema (DME)1
Not AvailableCompletedTreatmentCancer, Breast2
Not AvailableCompletedTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema (ME)1
Not AvailableCompletedTreatmentCentral Serous Chorioretinopathy (CSC)1
Not AvailableCompletedTreatmentColonic Neoplasms / Rectal Neoplasms1
Not AvailableCompletedTreatmentColorectal Cancers1
Not AvailableCompletedTreatmentCorneal Neovascularization1
Not AvailableCompletedTreatmentDiabetic Macular Edema (DME)1
Not AvailableCompletedTreatmentGlaucoma / Neovascular1
Not AvailableCompletedTreatmentHerpetic Keratopathy / Lipid Keratopathy / Penetrating Keratoplasty / Rosaceas1
Not AvailableCompletedTreatmentMalignant Gliomas1
Not AvailableCompletedTreatmentMalignant Neoplasm of Prostate1
Not AvailableCompletedTreatmentMetastatic Colorectal Cancers1
Not AvailableCompletedTreatmentNeovascular Age-Related Macular Degeneration2
Not AvailableCompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
Not AvailableCompletedTreatmentProliferative Diabetic Retinopathy (PDR) / Vitreous Hemorrhage1
Not AvailableCompletedTreatmentPterygium of the Conjunctiva and Cornea1
Not AvailableCompletedTreatmentRetinal Detachment / Retinopathy, Diabetic1
Not AvailableCompletedTreatmentRetinopathy, Diabetic1
Not AvailableCompletedTreatmentUveal Melanoma1
Not AvailableNot Yet RecruitingNot AvailableColorectal Cancers1
Not AvailableNot Yet RecruitingDiagnosticNon-Small-Cell Lung Carcinoma (NSCLC)1
Not AvailableNot Yet RecruitingTreatmentGlioblastoma Multiforme (GBM)1
Not AvailableRecruitingNot AvailableAdenocarcinoma of the Lung1
Not AvailableRecruitingNot AvailableCancer, Ovarian1
Not AvailableRecruitingNot AvailableMetastatic Breast Cancer (MBC)1
Not AvailableRecruitingNot AvailableMetastatic Colorectal Cancers2
Not AvailableRecruitingNot AvailableMetastatic Colorectal Cancers / Quality of Life1
Not AvailableRecruitingTreatmentMetastatic Colorectal Cancers1
Not AvailableRecruitingTreatmentMulti-organ Metastatic Colorectal Cancer1
Not AvailableRecruitingTreatmentRadiation Necrosis1
Not AvailableTemporarily Not AvailableNot AvailableRetinopathy of Prematurity1
Not AvailableTerminatedNot AvailableCancer, Breast2
Not AvailableTerminatedNot AvailableColorectal Cancers / Hepatocellular Cancer / Non-Small-Cell Lung Carcinoma (NSCLC) / Renal Cell Adenocarcinoma1
Not AvailableTerminatedNot AvailableGlioma Patients1
Not AvailableTerminatedBasic ScienceGlioblastomas1
Not AvailableTerminatedTreatmentMalignant Neoplasm of Colon1
Not AvailableUnknown StatusNot AvailableAge Related Macular Degeneration (ARMD)1
Not AvailableUnknown StatusNot AvailableBevacizumab / Cancer, Breast / Molecular Targeted Therapy / Neoadjuvant Chemotherapy1
Not AvailableUnknown StatusNot AvailableCancer, Breast / Metastatic1
Not AvailableUnknown StatusNot AvailableNeovascular Age Related Macular Degeneration1
Not AvailableUnknown StatusNot AvailableUnspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
Not AvailableUnknown StatusPreventionRetinopathy, Diabetic1
Not AvailableUnknown StatusTreatmentCancer, Breast1
Not AvailableUnknown StatusTreatmentDiabetes Complications1
Not AvailableUnknown StatusTreatmentMacular Edema (ME) / Retinal Vein Occlusions(RVO)1
Not AvailableUnknown StatusTreatmentMacular Oedema / Proliferative Diabetic Retinopathy (PDR) / Wet AMD1
Not AvailableUnknown StatusTreatmentRetinal Detachment / Vitreoretinopathy Proliferative1
Not AvailableUnknown StatusTreatmentSubfoveal Choroidal Neovascularization1
Not AvailableWithdrawnBasic ScienceCorneal Neovascularization1
Not AvailableWithdrawnTreatmentAngioid Streaks / Central Serous Chorioretinopathy (CSC) / Multifocal Choroiditis / Myopia / Ocular Histoplasmosis Syndrome / Punctate Inner Choroidopathy (PIC) / Subfoveal Choroidal Neovascularization / Trauma, or Hereditary Eye Diseases1
Not AvailableWithdrawnTreatmentCancer, Breast1
Not AvailableWithdrawnTreatmentMalignant Neoplasm of Pancreas1
Not AvailableWithdrawnTreatmentShock, Septic1
Pharmacoeconomics
Manufacturers
  • Roche Pharmaceuticals
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous100 mg/4mL
Injection, solutionIntravenous400 mg/16mL
SolutionIntravenous25 mg
Prices
Unit descriptionCostUnit
Avastin 400 mg/16ml Solution 16ml Vial2786.78USD vial
Avastin 100 mg/4ml Solution 4ml Vial696.7USD vial
Avastin 100 mg/4 ml vial167.48USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2145985 No2003-09-162012-10-28Canada
CA2286330 No2008-06-102018-04-03Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Vascular endothelial growth factor receptor binding
Specific Function:
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activ...
Gene Name:
VEGFA
Uniprot ID:
P15692
Molecular Weight:
27042.205 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Gerber HP, Ferrara N: Pharmacology and pharmacodynamics of bevacizumab as monotherapy or in combination with cytotoxic therapy in preclinical studies. Cancer Res. 2005 Feb 1;65(3):671-80. [PubMed:15705858 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23