Bevacizumab

Identification

Name
Bevacizumab
Accession Number
DB00112  (BTD00087, BIOD00087)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

A recombinant humanized monoclonal IgG1 antibody that binds to and inhibits the biologic activity of human vascular endothelial growth factor (VEGF). Bevacizumab contains human framework regions and the complementarity-determining regions of a murine antibody that binds to VEGF. Bevacizumab is produced in a Chinese Hamster Ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin and has a molecular weight of approximately 149 kilodaltons.

Protein structure
Db00112
Protein chemical formula
C6538H10034N1716O2033S44
Protein average weight
149000.0 Da
Sequences
>"Bevacizumab light chain"
DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>"Bevacizumab heavy chain"
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY
AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • Anti-VEGF Humanized Monoclonal Antibody
  • Anti-VEGF monoclonal antibody
  • Bevacizumab
  • bevacizumab-awwb
  • rhuMAb-VEGF
External IDs
ABP 215 / ABP-215 / R-435
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AvastinSolution25 mgIntravenousHoffmann La Roche2005-11-02Not applicableCanada
AvastinInjection, solution400 mg/16mLIntravenousGenentech, Inc.2004-02-26Not applicableUs
AvastinInjection, solution100 mg/4mLIntravenousGenentech, Inc.2004-02-26Not applicableUs
MvasiSolution25 mgIntravenousAmgen2019-08-01Not applicableCanada
MvasiInjection, solution400 mg/16mLIntravenousAMGEN INC2018-06-01Not applicableUs
MvasiInjection, solution100 mg/4mLIntravenousAMGEN INC2018-06-01Not applicableUs
MvasiSolution25 mgIntravenousAmgen2019-08-01Not applicableCanada
ZirabevSolution400 mgIntravenousPfizer Canada Ulc2019-09-25Not applicableCanada
ZirabevInjection, solution400 mg/16mLIntravenousPfizer Laboratories Div Pfizer Inc2020-01-13Not applicableUs
ZirabevSolution100 mgIntravenousPfizer Canada Ulc2019-09-25Not applicableCanada
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Categories
UNII
2S9ZZM9Q9V
CAS number
216974-75-3

Pharmacology

Indication

As a vascular endothelial growth factor (VEGF) inhibitor, bevacizumab is used in several chemotherapy regimens to treat metastatic colorectal cancer; metastatic, unresectable, locally advanced or recurrent non-squamous non-small cell lung cancer; metastatic renal cell carcinoma; metastatic, persistent, or recurrent cervical cancer; primary peritoneal cancer; epithelial ovarian cancer; and fallopian tube cancer.23 It can also be used to treat recurrent glioblastoma.23

Interestingly, bevacizumab is currently under investigation for the treatment of COVID-19 complications including acute respiratory distress syndrome (ARDS) and acute lung injury (ALI).24

Associated Conditions
Pharmacodynamics

Bevacizumab binds circulating vascular endothelial-derived growth factor (VEGF) and blocks it from binding to its associated receptors, which effectively blunts any downstream signaling.19 The effects of bevacizumab have been shown to re-establish normal vasculature at the tumor site, which improves nutrient and oxygen supply while also increasing the delivery of chemotherapeutic drugs to the target area.14,18 On the other hand, VEGF signaling is a vital component of several processes including angiogenesis, lymphangiogenesis, blood pressure regulation, wound healing, coagulation, and renal filtration.5,7,19 Although blocking VEGF may inhibit metastatic disease progression, it may also result in unintended effects due to the role of VEGF in several other physiologic processes.23

Mechanism of action

Transcription of the VEGF protein is induced by 'hypoxia inducible factor' (HIF) in a hypoxic environment.14 Various downstream effects occur when VEGF binds to VEGF receptors (VEGFR-1 and VEGFR-2) which are located on endothelial cells.5,14 VEGF also binds to the neuropilin co-receptors (NRP-1 and NRP-1), which enhances signaling.14,17 Cancer cells promote tumor angiogenesis by releasing VEGF, resulting in the creation of an immature and disorganized vascular network.9,10 The hypoxic microenvironment created by these cancer cells favors the survival of more aggressive tumor cells, and gives rise to a challenging environment for immune cells to respond appropriately.10,11,12 As a result, the angiogenic factor has become a well-known target for anti-cancer drugs like bevacizumab.6 Bevacizumab is a mAb that exerts its effects by binding and inactivating serum VEGF.14 When bound to the mAb, VEGF is prevented from interacting with its cell surface receptors, and proangiogenic signalling is inhibited.14 This prevents formation of new blood vessels, decreases tumor vasculature, and reduces tumor blood supply.14,23

There is also evidence to suggest that VEGF is upregulated in COVID-19 patients, hence, bevacizumab is being investigated for the treatment of associated complications.24 Higher levels of VEGF may contribute to pulmonary edema, leading to acute respiratory distress syndrome (ARDS) and acute lung injury (ALI).24 Researchers are hopeful that by inhibiting VEGF, bevacizumab may effectively treat ARDS and ALI - both common features of severe COVID-19.24

TargetActionsOrganism
AVascular endothelial growth factor ANot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHumans
UComplement C1r subcomponentNot AvailableHumans
UComplement C1q subcomponent subunit ANot AvailableHumans
UComplement C1q subcomponent subunit BNot AvailableHumans
UComplement C1q subcomponent subunit CNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHumans
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHumans
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHumans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

Monoclonal antibodies (mAbs) are large in size, do not readily cross cell membranes, and are unable to withstand proteolysis in the gastrointestinal tract.16,21,22 Given these characteristics, mAbs are poorly absorbed via the oral route and are instead administered intravenously, intramuscularly or subcutaneously.16,22

In a single dose (1mg/kg) pharmacokinetic study assessing the bioequivalence of bevacizumab and TAB008 (a biosimilar product), the pharmacokinetic parameters of Avastin (bevacizumab) were as follows20: Geometric mean Cmax = 17.38 ug/mL Geometric mean AUCinf = 5,358 ugxh/mL Geometric mean Tmax = 2.50 hrs

Volume of distribution

The volume of distribution of bevacizumab is approximately 3.29 L and 2.39 L for the average male and female, respectively.14

Protein binding

>97% of serum VEGF is bound to bevacizumab.14

Metabolism

There are several pathways through which monoclonal antibodies (mAbs) may be cleared.15 Non-specific clearance of mAbs refers to target independent pinocytosis, and proteolysis of the protein into small amino acids and peptides in the reticuloendothelial system (RES) and the liver.15,16 Target-mediated clearance is a result of specific interactions between the mAb and its target antigen.15 Once bound, the antibody-antigen complex may be cleared via lysosomal degradation.15,16 Additionally, the production of anti-drug antibodies (ADA), which are a result of an immunogenic response to mAb-based treatment, can form complexes with mAb’s and may impact the rate of mAb clearance.15

Route of elimination

Due to their size, monoclonal antibodies are not renally eliminated under normal physiological conditions.16 Catabolism or excretion are the primary processes of elimination.16

Half life

The half-life of bevacizumab is estimated to be 20 days (range of 11-50 days).23,13

Clearance

The clearance (CL) of bevacizumab is approximately 0.207 L/day.14 The CL of bevacizumab can increase or decrease by 30% in patients who weigh >114 kg or <49 kg respectively.14 Males tend to clear bevacizumab at a faster rate than females (26% faster on average).14 Other factors including alkaline phosphatase (ALP), serum aspartate aminotransferase (AST), serum albumin, and tumor burden may cause the CL to fluctuate.14

Toxicity

Bevacizumab toxicities are distinct from the effects of cytotoxic agents used in chemotherapy, and are normally linked to impaired VEGF function.18,19 Common toxicities associated with bevacizumab include hypertension, gastrointestinal perforation, arterial thromboembolism, reversible posterior leukoencephalopathy syndrome (RPLS), venous thromboembolism, proteinuria, bleeding/hemorrhage, and wound-healing complications.18

Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Bevacizumab Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
(R)-warfarinThe risk or severity of bleeding can be increased when (R)-warfarin is combined with Bevacizumab.
(S)-WarfarinThe risk or severity of bleeding can be increased when (S)-Warfarin is combined with Bevacizumab.
2-MethoxyethanolThe risk or severity of adverse effects can be increased when Bevacizumab is combined with 2-Methoxyethanol.
4-hydroxycoumarinThe risk or severity of bleeding can be increased when 4-hydroxycoumarin is combined with Bevacizumab.
9-(N-methyl-L-isoleucine)-cyclosporin AThe risk or severity of adverse effects can be increased when Bevacizumab is combined with 9-(N-methyl-L-isoleucine)-cyclosporin A.
AbataceptThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Abatacept.
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bevacizumab.
AbetimusThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Abetimus.
AbituzumabThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Abituzumab.
AbrilumabThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Abrilumab.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
No interactions found.

References

General References
  1. Velcheti V, Viswanathan A, Govindan R: The proportion of patients with metastatic non-small cell lung cancer potentially eligible for treatment with bevacizumab: a single institutional survey. J Thorac Oncol. 2006 Jun;1(5):501. [PubMed:17409907]
  2. Rosen LS, Jacobs IA, Burkes RL: Bevacizumab in Colorectal Cancer: Current Role in Treatment and the Potential of Biosimilars. Target Oncol. 2017 Oct;12(5):599-610. doi: 10.1007/s11523-017-0518-1. [PubMed:28801849]
  3. Han K, Peyret T, Marchand M, Quartino A, Gosselin NH, Girish S, Allison DE, Jin J: Population pharmacokinetics of bevacizumab in cancer patients with external validation. Cancer Chemother Pharmacol. 2016 Aug;78(2):341-51. doi: 10.1007/s00280-016-3079-6. Epub 2016 Jun 21. [PubMed:27329360]
  4. Apsangikar PD, Chaudhry SR, Naik MM, Deoghare SB, Joseph J: Comparative pharmacokinetics, efficacy, and safety of bevacizumab biosimilar to reference bevacizumab in patients with metastatic colorectal cancer. Indian J Cancer. 2017 Jul-Sep;54(3):535-538. doi: 10.4103/ijc.IJC_394_17. [PubMed:29798953]
  5. Karaman S, Leppanen VM, Alitalo K: Vascular endothelial growth factor signaling in development and disease. Development. 2018 Jul 20;145(14). pii: 145/14/dev151019. doi: 10.1242/dev.151019. [PubMed:30030240]
  6. Verheul HM, Pinedo HM: The role of vascular endothelial growth factor (VEGF) in tumor angiogenesis and early clinical development of VEGF-receptor kinase inhibitors. Clin Breast Cancer. 2000 Sep;1 Suppl 1:S80-4. doi: 10.3816/cbc.2000.s.015. [PubMed:11970755]
  7. Stacker SA, Achen MG: The VEGF signaling pathway in cancer: the road ahead. Chin J Cancer. 2013 Jun;32(6):297-302. doi: 10.5732/cjc.012.10319. Epub 2013 Feb 19. [PubMed:23419196]
  8. Siveen KS, Prabhu K, Krishnankutty R, Kuttikrishnan S, Tsakou M, Alali FQ, Dermime S, Mohammad RM, Uddin S: Vascular Endothelial Growth Factor (VEGF) Signaling in Tumour Vascularization: Potential and Challenges. Curr Vasc Pharmacol. 2017;15(4):339-351. doi: 10.2174/1570161115666170105124038. [PubMed:28056756]
  9. Lee SH, Jeong D, Han YS, Baek MJ: Pivotal role of vascular endothelial growth factor pathway in tumor angiogenesis. Ann Surg Treat Res. 2015 Jul;89(1):1-8. doi: 10.4174/astr.2015.89.1.1. Epub 2015 Jun 11. [PubMed:26131438]
  10. Viallard C, Larrivee B: Tumor angiogenesis and vascular normalization: alternative therapeutic targets. Angiogenesis. 2017 Nov;20(4):409-426. doi: 10.1007/s10456-017-9562-9. Epub 2017 Jun 28. [PubMed:28660302]
  11. Rodriguez PC, Zea AH, Ochoa AC: Mechanisms of tumor evasion from the immune response. Cancer Chemother Biol Response Modif. 2003;21:351-64. doi: 10.1016/s0921-4410(03)21018-8. [PubMed:15338755]
  12. Petrova V, Annicchiarico-Petruzzelli M, Melino G, Amelio I: The hypoxic tumour microenvironment. Oncogenesis. 2018 Jan 24;7(1):10. doi: 10.1038/s41389-017-0011-9. [PubMed:29362402]
  13. Lu JF, Bruno R, Eppler S, Novotny W, Lum B, Gaudreault J: Clinical pharmacokinetics of bevacizumab in patients with solid tumors. Cancer Chemother Pharmacol. 2008 Oct;62(5):779-86. doi: 10.1007/s00280-007-0664-8. Epub 2008 Jan 19. [PubMed:18205003]
  14. Kazazi-Hyseni F, Beijnen JH, Schellens JH: Bevacizumab. Oncologist. 2010;15(8):819-25. doi: 10.1634/theoncologist.2009-0317. Epub 2010 Aug 5. [PubMed:20688807]
  15. Ovacik M, Lin K: Tutorial on Monoclonal Antibody Pharmacokinetics and Its Considerations in Early Development. Clin Transl Sci. 2018 Nov;11(6):540-552. doi: 10.1111/cts.12567. Epub 2018 Aug 7. [PubMed:29877608]
  16. Ryman JT, Meibohm B: Pharmacokinetics of Monoclonal Antibodies. CPT Pharmacometrics Syst Pharmacol. 2017 Sep;6(9):576-588. doi: 10.1002/psp4.12224. Epub 2017 Jul 29. [PubMed:28653357]
  17. Herzog B, Pellet-Many C, Britton G, Hartzoulakis B, Zachary IC: VEGF binding to NRP1 is essential for VEGF stimulation of endothelial cell migration, complex formation between NRP1 and VEGFR2, and signaling via FAK Tyr407 phosphorylation. Mol Biol Cell. 2011 Aug 1;22(15):2766-76. doi: 10.1091/mbc.E09-12-1061. Epub 2011 Jun 8. [PubMed:21653826]
  18. Randall LM, Monk BJ: Bevacizumab toxicities and their management in ovarian cancer. Gynecol Oncol. 2010 Jun;117(3):497-504. doi: 10.1016/j.ygyno.2010.02.021. Epub 2010 Apr 2. [PubMed:20363017]
  19. Brandes AA, Bartolotti M, Tosoni A, Poggi R, Franceschi E: Practical management of bevacizumab-related toxicities in glioblastoma. Oncologist. 2015 Feb;20(2):166-75. doi: 10.1634/theoncologist.2014-0330. Epub 2015 Jan 7. [PubMed:25568148]
  20. Wang J, Qi L, Liu L, Wang Z, Chen G, Wang Y, Liu X, Liu Y, Liu H, Tong Y, Liu C, Lei C, Wang X: A Phase I, Randomized, Single-Dose Study Evaluating the Biosimilarity of TAB008 to Bevacizumab in Healthy Volunteers. Front Pharmacol. 2019 Aug 15;10:905. doi: 10.3389/fphar.2019.00905. eCollection 2019. [PubMed:31474863]
  21. Yang NJ, Hinner MJ: Getting across the cell membrane: an overview for small molecules, peptides, and proteins. Methods Mol Biol. 2015;1266:29-53. doi: 10.1007/978-1-4939-2272-7_3. [PubMed:25560066]
  22. Keizer RJ, Huitema AD, Schellens JH, Beijnen JH: Clinical pharmacokinetics of therapeutic monoclonal antibodies. Clin Pharmacokinet. 2010 Aug;49(8):493-507. doi: 10.2165/11531280-000000000-00000. [PubMed:20608753]
  23. FDA Approved Drug Products: Avastin (bevacizumab) injection [Link]
  24. ClinicalTrials.gov: Bevacizumab in Severe or Critical Patients with COVID-19 Pneumonia (BEST-CP) [Link]
External Links
PubChem Substance
46504473
RxNav
253337
ChEMBL
CHEMBL1201583
Therapeutic Targets Database
DAP000393
PharmGKB
PA130232992
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Bevacizumab
ATC Codes
L01XC07 — Bevacizumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (133 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma / Metastatic Kidney Carcinoma / Metastatic Renal Cell Cancer / Renal Cancers / Stage IV Renal Cell Cancer AJCC V71
0Active Not RecruitingTreatmentDesmoplastic Small Round Cell Tumor (DSRCT) / Sarcomas1
0CompletedBasic ScienceBevacizumab-alone Maintenance Treatment Progression / Metastatic Breast Cancer1
0CompletedBasic ScienceBreast Cancer / Early-Stage Breast Carcinoma / Human Epidermal Growth Factor 2 Negative Carcinoma of Breast1
0CompletedBasic ScienceGlioblastoma Multiforme (GBM)1
0CompletedTreatmentBreast Cancer1
0CompletedTreatmentDiabetic Retinopathy (DR)1
0CompletedTreatmentDiffuse Intrinsic Pontine Glioma (DIPG) / Newly Diagnosed High-Grade Gliomas1
0CompletedTreatmentGlioblastomas / Neoplasms, Brain1
0CompletedTreatmentHead and Neck Carcinoma / Pharynx Cancer1
0Not Yet RecruitingTreatmentChildhood CNS Tumor1
0RecruitingOtherEnd Stage Renal Disease (ESRD) / Hemodialysis Vascular Access Failure1
0RecruitingPreventionTumors, Solid1
0RecruitingTreatmentGBM / Glioblastomas / Neoplasms, Brain / Recurrent Brain Tumors1
0RecruitingTreatmentPrimary Esophageal Carcinoma1
0TerminatedTreatmentGlioblastomas / Gliosarcoma / Neoplasms, Brain1
0TerminatedTreatmentHemangioblastomas / Von Hippel Lindau Disease / Von Hippel-Lindau Disease1
0Unknown StatusTreatmentGlioblastomas / Optic Neuropathies1
1Active Not RecruitingNot AvailableHealthy Volunteers1
1Active Not RecruitingDiagnosticLung Cancer Non-Small Cell Cancer (NSCLC) / Malignancies1
1Active Not RecruitingOtherHealthy Volunteers1
1Active Not RecruitingTreatmentAdult Glioblastoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Serous Adenocarcinoma / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Recurrent Uterine Corpus Carcinoma / Solid Neoplasms / Stage IIIA Fallopian Tube Cancer / Stage IIIA Fallopian Tube Cancer AJCC v7 / Stage IIIA Ovarian Cancer / Stage IIIA Ovarian Cancer AJCC v6 and v7 / Stage IIIA Primary Peritoneal Cancer / Stage IIIA Primary Peritoneal Cancer AJCC v7 / Stage IIIB Fallopian Tube Cancer / Stage IIIB Fallopian Tube Cancer AJCC v7 / Stage IIIB Ovarian Cancer / Stage IIIB Ovarian Cancer AJCC v6 and v7 / Stage IIIB Primary Peritoneal Cancer / Stage IIIB Primary Peritoneal Cancer AJCC v7 / Stage IIIC Fallopian Tube Cancer / Stage IIIC Fallopian Tube Cancer AJCC v7 / Stage IIIC Ovarian Cancer / Stage IIIC Ovarian Cancer AJCC v6 and v7 / Stage IIIC Primary Peritoneal Cancer / Stage IIIC Primary Peritoneal Cancer AJCC v7 / Stage IV Fallopian Tube Cancer / Stage IV Fallopian Tube Cancer AJCC v6 and v7 / Stage IV Ovarian Cancer / Stage IV Ovarian Cancer AJCC v6 and v7 / Stage IV Primary Peritoneal Cancer / Stage IV Primary Peritoneal Cancer AJCC v71
1Active Not RecruitingTreatmentAstrocytomas / Glioblastoma Multiforme (GBM) / Glioblastomas / Gliomas / Neoplasms, Brain1
1Active Not RecruitingTreatmentCancer, Advanced4
1Active Not RecruitingTreatmentCancer, Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Cancers / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic / Non Small Cell Lung Cancer Stage IIIB / Non-Small Cell Lung Cancer Stage IIIB / Tumors, Solid1
1Active Not RecruitingTreatmentCancer, Advanced / Tumors, Solid1
1Active Not RecruitingTreatmentCervical Carcinoma / Colorectal Adenocarcinoma / Non-Squamous Non-Small Cell Lung Cancer / Platinum-refractory Ovarian Carcinoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentColorectal Cancers1
1Active Not RecruitingTreatmentColorectal Cancers / Glioblastoma Multiforme (GBM) / Gliosarcoma / Renal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentFallopian Tube Cancer / Malignant Peritoneal Neoplasm / Ovarian Cancer1
1Active Not RecruitingTreatmentFallopian Tube Cancer / No Prior Chemotherapy / Ovarian Cancer / Primary Peritoneal Cancer1
1Active Not RecruitingTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Cancer1
1Active Not RecruitingTreatmentFallopian Tube Cancer / Ovarian Carcinoma / Primary Peritoneal Cancer1
1Active Not RecruitingTreatmentFallopian Tube Carcinosarcoma / Fallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Neoplasm / Fallopian Tube Transitional Cell Carcinoma / Fallopian Tube Undifferentiated Carcinoma / Ovarian Brenner Tumor / Ovarian Carcinosarcoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Tumor / Ovarian Mucinous Adenocarcinoma / Ovarian Seromucinous Tumor / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Ovarian Undifferentiated Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Stage IIA Fallopian Tube Cancer / Stage IIA Fallopian Tube Cancer AJCC v6 and v7 / Stage IIA Ovarian Cancer / Stage IIA Ovarian Cancer AJCC V6 and v7 / Stage IIB Fallopian Tube Cancer / Stage IIB Fallopian Tube Cancer AJCC v6 and v7 / Stage IIB Ovarian Cancer / Stage IIB Ovarian Cancer AJCC v6 and v7 / Stage IIC Fallopian Tube Cancer / Stage IIC Fallopian Tube Cancer AJCC v6 and v7 / Stage IIC Ovarian Cancer / Stage IIC Ovarian Cancer AJCC v6 and v7 / Stage IIIA Fallopian Tube Cancer / Stage IIIA Fallopian Tube Cancer AJCC v7 / Stage IIIA Ovarian Cancer / Stage IIIA Ovarian Cancer AJCC v6 and v7 / Stage IIIA Primary Peritoneal Cancer / Stage IIIA Primary Peritoneal Cancer AJCC v7 / Stage IIIB Fallopian Tube Cancer / Stage IIIB Fallopian Tube Cancer AJCC v7 / Stage IIIB Ovarian Cancer / Stage IIIB Ovarian Cancer AJCC v6 and v7 / Stage IIIB Primary Peritoneal Cancer / Stage IIIB Primary Peritoneal Cancer AJCC v7 / Stage IIIC Fallopian Tube Cancer / Stage IIIC Fallopian Tube Cancer AJCC v7 / Stage IIIC Ovarian Cancer / Stage IIIC Ovarian Cancer AJCC v6 and v7 / Stage IIIC Primary Peritoneal Cancer / Stage IIIC Primary Peritoneal Cancer AJCC v7 / Stage IV Fallopian Tube Cancer / Stage IV Fallopian Tube Cancer AJCC v6 and v7 / Stage IV Ovarian Cancer / Stage IV Ovarian Cancer AJCC v6 and v7 / Stage IV Primary Peritoneal Cancer / Stage IV Primary Peritoneal Cancer AJCC v7 / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
1Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1Active Not RecruitingTreatmentMalignancies1
1Active Not RecruitingTreatmentMalignancies / Metastatic Colorectal Cancer (MCRC) / Tumors, Solid1
1Active Not RecruitingTreatmentMalignancies / Neoplasms1
1Active Not RecruitingTreatmentMalignant Gliomas2
1Active Not RecruitingTreatmentMelanoma1
1Active Not RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
1Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1Active Not RecruitingTreatmentRetinopathy of Prematurity1
1Active Not RecruitingTreatmentSarcomas1
1Active Not RecruitingTreatmentTumors, Solid2
1Active Not RecruitingTreatmentWet Age-Related Macular Degeneration1
1CompletedNot AvailablePterygium1
1CompletedNot AvailableTumors, Solid3
1CompletedBasic ScienceHealthy Volunteers2
1CompletedBasic ScienceLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
1CompletedDiagnosticAdenomatous Polyposis Coli1
1CompletedDiagnosticDysplasia / Esophageal Cancers1
1CompletedDiagnosticRectal Carcinoma1
1CompletedOtherHealthy Volunteers2
1CompletedOtherHealthy Volunteers / Japanese / Japanese Healthy Male Volunteers / Males1
1CompletedOtherPharmacokinetics / Safety Issues1
1CompletedOtherRenal Cell Adenocarcinoma1
1CompletedScreeningHealthy Volunteers1
1CompletedTreatmentAdenocarcinoma of the Ovaries / Fallopian Tube Adenocarcinoma / Primary Peritoneal Carcinoma1
1CompletedTreatmentAdenocarcinoma of the Rectum / Stage II Rectal Cancer / Stage III Rectal Cancer1
1CompletedTreatmentAdenocarcinomas / Lung Cancer Non-Small Cell Cancer (NSCLC)1
1CompletedTreatmentAdult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Anaplastic Large-Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Childhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Grade III Lymphomatoid Granulomatosis / Childhood Immunoblastic Large Cell Lymphoma / Childhood Nasal Type Extranodal NK/T-cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Progressive Hairy Cell Leukemia, Initial Treatment / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Childhood Anaplastic Large Cell Lymphoma / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent/Refractory Childhood Hodgkin Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Adult T-Cell Leukemia/Lymphoma / Stage IV Childhood Anaplastic Large Cell Lymphoma / Stage IV Childhood Hodgkin Lymphoma / Stage IV Childhood Large Cell Lymphoma / Stage IV Childhood Lymphoblastic Lymphoma / Stage IV Childhood Small Noncleaved Cell Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IVA Mycosis Fungoides/Sezary Syndrome / Stage IVB Mycosis Fungoides/Sezary Syndrome / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific / Waldenström's Macroglobulinemia (WM)1
1CompletedTreatmentAdult Solid Tumor1
1CompletedTreatmentAdvanced Cancers4
1CompletedTreatmentAdvanced Gastrointestinal Tumors1
1CompletedTreatmentAdvanced Malignancies / Refractory Malignancy1
1CompletedTreatmentAdvanced Malignancy / Malignant Lymphomas / Plasma Cell Myeloma / Tumors, Solid1
1CompletedTreatmentAdvanced Refractory Solid Tumors Histologically or Cytologically Confirmed / Metastatic Renal Cell Carcinoma1
1CompletedTreatmentAdvanced Solid Tumors2
1CompletedTreatmentAdvanced Solid Tumors / Liver Cancer1
1CompletedTreatmentAdvanced/Metastatic Solid Tumors1
1CompletedTreatmentAnal, Colon, and Rectal Cancers / Colon/Rectal Cancer / Neoplasms, Colorectal1
1CompletedTreatmentAnaplastic Astrocytoma (AA) / Glioblastoma Multiforme (GBM)1
1CompletedTreatmentAngioid Streaks / Subfoveal Choroidal Neovascularization1
1CompletedTreatmentAstrocytoma, Oligoastrocytoma, Mixed / Ganglioglioma / Ganglioneuroma / Glioblastoma Multiforme Glioma / Gliomas1
1CompletedTreatmentBrain Arteriovenous Malformations1
1CompletedTreatmentBreast Cancer2
1CompletedTreatmentBreast Cancer / Colorectal Cancers / Esophagogastric Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Neoplasm of Pancreas / Tumors1
1CompletedTreatmentBreast Cancer / Gynecological Cancers / Head and Neck Carcinoma / Lung Cancer Non-Small Cell Cancer (NSCLC) / Non-squamous Cell Lung Cancer / Ovarian Cancer / Small Cell Lung Cancer (SCLC)1
1CompletedTreatmentBreast Cancer / Lymphedema1
1CompletedTreatmentBreast Cancer / Metastatic Breast Cancer, Locally Advanced Breast Cancer1
1CompletedTreatmentBrenner Tumor / Fallopian Tube Cancer / Ovarian Carcinosarcoma / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Carcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Ovarian Undifferentiated Adenocarcinoma / Primary Peritoneal Cavity Cancer / Stage II Ovarian Epithelial Cancer / Stage III Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
1CompletedTreatmentBrenner Tumor / Fallopian Tube Cancer / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Carcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Ovarian Undifferentiated Adenocarcinoma / Primary Peritoneal Cavity Cancer / Stage II Ovarian Epithelial Cancer / Stage III Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
1CompletedTreatmentCancer, Advanced4
1CompletedTreatmentCancer, Advanced / Liver Cancer1
1CompletedTreatmentCancer, Advanced / Metastatic Cancers1
1CompletedTreatmentCentral nervous system neoplasms malignant NEC / Recurrent or Refractory Solid Tumors1
1CompletedTreatmentClear Cell Renal Cell Carcinoma / Renal Cell Cancer, Recurrent / Stage I Renal Cell Cancer / Stage II Renal Cell Cancer / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentColorectal Cancers6
1CompletedTreatmentColorectal Cancers / Esophageal Cancers / Gastrointestinal Stromal Tumors (GISTs) / Malignant Neoplasm of Pancreas / Malignant Neoplasm of Stomach / Rectal Carcinoma1
1CompletedTreatmentCorneal Neovascularization1
1CompletedTreatmentDiabetic Retinopathy (DR) / Intravitreal Bevacizumab Injection / Pars Plana Vitrectomy / Tractional Retinal Detachment1
1CompletedTreatmentDisorders, Lymphoproliferative / Lung Cancers / Malignant Lymphomas / Small Intestine Cancer / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Cancer1
1CompletedTreatmentGlioblastoma Multiforme (GBM)2
1CompletedTreatmentGlioblastomas1
1CompletedTreatmentHead and Neck Carcinoma / Malignant Neoplasm of Thyroid / Melanoma / Parotid Gland Cancer / Stage IV Head and Neck Cancer / Thyroid neoplasms malignant1
1CompletedTreatmentHealthy Male Subjects1
1CompletedTreatmentHealthy Volunteers3
1CompletedTreatmentHemorrhagic Hereditary Telangiectasia (HHT)1
1CompletedTreatmentKRAS Mutant Metastatic Colorectal Cancer1
1CompletedTreatmentLeukemias / Refractory Solid Tumors1
1CompletedTreatmentLiver Cancer1
1CompletedTreatmentLocally Advanced Sarcoma / Metastatic Sarcoma / Sarcomas / Soft Tissue Sarcoma (STS) / Unresectable Sarcoma1
1CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)5
1CompletedTreatmentLung Cancers1
1CompletedTreatmentMalignancies1
1CompletedTreatmentMalignancies / Unspecified Adult Solid Tumor, Protocol Specific1
1CompletedTreatmentMalignant Neoplasm of Pancreas4
1CompletedTreatmentMalignant Ovarian Mixed Epithelial Tumor / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Cystadenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Ovarian Carcinoma1
1CompletedTreatmentMalignant Peritoneal Neoplasm1
1CompletedTreatmentMetastatic Colon Cancer / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage IV Rectal Cancer1
1CompletedTreatmentMetastatic Colorectal Cancer (MCRC)5
1CompletedTreatmentMetastatic Colorectal Cancer (MCRC) / Tumors, Solid1
1CompletedTreatmentMetastatic Malignant Neoplasm to Brain1
1CompletedTreatmentMetastatic Pancreas Adenocarcinoma1
1CompletedTreatmentMetastatic Renal Cell Carcinoma / Renal Cancers1
1CompletedTreatmentMetastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Lymphoepithelioma of the Oropharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1CompletedTreatmentMucinous Adenocarcinoma of the Colon / Mucinous Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Signet Ring Adenocarcinoma of the Colon / Signet Ring Adenocarcinoma of the Rectum / Stage IIIA Colon Cancer / Stage IIIA Rectal Cancer / Stage IIIB Colon Cancer / Stage IIIB Rectal Cancer / Stage IIIC Colon Cancer / Stage IIIC Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
1CompletedTreatmentMyopia1
1CompletedTreatmentMyopia, Degenerative / Pathological Myopia / Subfoveal Choroidal Neovascularization1
1CompletedTreatmentNeoplasms3
1CompletedTreatmentNeoplasms Malignant / Neoplasms, Malignant1
1CompletedTreatmentNeoplasms Metastasis1
1CompletedTreatmentNeovascular Age-Related Macular Degeneration1
1CompletedTreatmentNeuroblastomas2
1CompletedTreatmentNeuromyelitis Optica / Neuromyelitis Optica Spectrum Disorder1
1CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer3
1CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer / Ovarian Cancer1
1CompletedTreatmentOvarian Cancer1
1CompletedTreatmentRectal Carcinoma1
1CompletedTreatmentRecurrent Colon Carcinoma / Recurrent Rectal Carcinoma / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
1CompletedTreatmentRecurrent Respiratory Papillomatosis1
1CompletedTreatmentRefractory Solid Tumors in Children1
1CompletedTreatmentRenal Cell Adenocarcinoma2
1CompletedTreatmentSarcomas1
1CompletedTreatmentSolid Cancers7
1CompletedTreatmentSolid Neoplasms1
1CompletedTreatmentTumors1
1CompletedTreatmentTumors of the Central Nervous System1
1CompletedTreatmentTumors, Solid4
1CompletedTreatmentUnresectable Advanced Cancer1
1CompletedTreatmentUnspecified Adult Solid Tumor1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific5
1CompletedTreatmentUnspecified Childhood Solid Tumor, Protocol Specific1
1Enrolling by InvitationOtherOncology1
1Not Yet RecruitingDiagnosticPituitary Adenomas / Pituitary Macroadenoma / Pituitary Neoplasms1
1Not Yet RecruitingOtherPharmacokinetics1
1Not Yet RecruitingTreatmentGlioblastomas1
1Not Yet RecruitingTreatmentHealthy Males1
1Not Yet RecruitingTreatmentHealthy Volunteers1
1Not Yet RecruitingTreatmentLiver Cancer1
1Not Yet RecruitingTreatmentLocally Advanced Lung Non-Small Cell Carcinoma / Metastatic Lung Non-Small Cell Carcinoma / Recurrent Lung Non-Small Cell Carcinoma / Stage III Lung Cancer AJCC v8 / Stage IIIA Lung Cancer AJCC v8 / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
1Not Yet RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
1Not Yet RecruitingTreatmentOvarian Cancer1
1RecruitingNot AvailableHealthy Volunteers1
1RecruitingDiagnosticEsophageal Cancers1
1RecruitingDiagnosticInverted Papilloma / Molecular Fluorescence Imaging1
1RecruitingPreventionAdvanced Colorectal Carcinoma / Metastatic Colorectal Carcinoma / Stage IV Colorectal Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v81
1RecruitingTreatmentAdenosquamous carcinoma of the cervix / Cervical Adenosarcoma / Cervical Carcinosarcoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Endometrial Clear Cell Adenocarcinoma / Endometrial Endometrioid Adenocarcinoma / Endometrial Mixed Adenocarcinoma / Endometrial Mucinous Adenocarcinoma / Endometrial Squamous Cell Carcinoma / Endometrial Transitional Cell Carcinoma / Endometrial Undifferentiated Carcinoma / Fallopian Tube Adenocarcinoma / Fallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Malignant Ovarian Epithelial Tumor / Malignant Peritoneal Neoplasm / Ovarian Carcinosarcoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Melanoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Stage IV Skin Melanoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma / Uterine Corpus Carcinosarcoma1
1RecruitingTreatmentAdvanced Cancers / Advanced Malignant Neoplasm / Castleman's Disease / Digestive System Carcinoma / Erdheim-Chester Disease (ECD) / Lip and Oral Cavity Carcinoma / Lymphangioleiomyomatosis / Malignant Endocrine Neoplasm / Malignant Female Reproductive System Neoplasm / Malignant Male Reproductive System Neoplasm / Malignant respiratory tract neoplasm / Malignant Thoracic Neoplasm / Malignant Urinary System Neoplasm / Mesothelial Neoplasm / Metastatic Malignant Neoplasm / Neoplasms, Malignant / Neurofibromatosis Type 2 / Recurrent Adult Soft Tissue Sarcoma / Recurrent Breast Carcinoma / Recurrent Childhood Soft Tissue Sarcoma / Recurrent Digestive System Carcinoma / Recurrent Female Reproductive System Carcinoma / Recurrent Male Reproductive System Carcinoma / Recurrent Malignant Neoplasm / Recurrent Pharyngeal Carcinoma / Recurrent Thyroid Gland Carcinoma / Refractory Malignant Neoplasm / Soft Tissue Neoplasms / Stage III Breast Cancer AJCC V7 / Stage III Pharyngeal Cancer / Stage IIIA Breast Cancer AJCC v7 / Stage IIIB Breast Cancer AJCC v7 / Stage IIIC Breast Cancer AJCC v7 / Stage IV Breast Cancer AJCC v6 and v7 / Stage IV Pharyngeal Cancer / Stage IVA Pharyngeal Cancer / Stage IVB Pharyngeal Cancer / Stage IVC Pharyngeal Cancer / Thyroid Gland Neoplasm / Urothelial carcinoma ureter metastatic1
1RecruitingTreatmentAdvanced Solid Tumors Cancer / Malignancies, Hematologic / Tumors, Solid1
1RecruitingTreatmentBreast Cancer / Leukemia Acute Myeloid Leukemia (AML) / Malignant Neoplasm of Pancreas / Prostate Cancer1
1RecruitingTreatmentCarcinoma NOS1
1RecruitingTreatmentCarcinoma, Colorectal / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
1RecruitingTreatmentChronic Myelomonocytic Leukemia / Myelodysplastic Syndromes1
1RecruitingTreatmentColorectal Cancers / Gastroesophageal Cancer (GC) / Renal Cell Adenocarcinoma1
1RecruitingTreatmentEndometriosis1
1RecruitingTreatmentGlioblastoma Multiforme (GBM)1
1RecruitingTreatmentGlioblastomas1
1RecruitingTreatmentHealthy Volunteers1
1RecruitingTreatmentHemophilia / Synovitis1
1RecruitingTreatmentInflammatory carcinoma of the breast1
1RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1RecruitingTreatmentMalignant Gliomas1
1RecruitingTreatmentNeoplasms, Brain1
1RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
1RecruitingTreatmentNewly Diagnosed Glioblastoma / Newly Diagnosed High Grade Glioma1
1SuspendedTreatmentVestibular Schwannomas1
1TerminatedDiagnosticRecurrent Glioblastoma1
1TerminatedTreatmentAdenocarcinoma of the Lung / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Stage II Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIb Non-small Cell Lung Cancer1
1TerminatedTreatmentAdvanced Colorectal Cancer1
1TerminatedTreatmentAnaplastic Astrocytoma (AA) / Anaplastic Oligodendroglioma (AO) / High Grade Glioma: Glioblastoma (GBM) / High Grade Glioma: Gliosarcoma / Mixed Anaplastic Oligoastrocytoma (AOA)1
1TerminatedTreatmentBreast Cancer / Pleural Effusion, Malignant1
1TerminatedTreatmentCholangiocarcinomas / Hepatocellular,Carcinoma / Liver Cancer1
1TerminatedTreatmentColorectal Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
1TerminatedTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Cancer / Primary Peritoneal Carcinoma1
1TerminatedTreatmentFallopian Tube Carcinoma / Ovarian Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Carcinoma1
1TerminatedTreatmentGlioblastoma Multiforme (GBM)1
1TerminatedTreatmentGlioblastomas / Gliomas1
1TerminatedTreatmentHepatocellular,Carcinoma1
1TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1TerminatedTreatmentLung Cancers1
1TerminatedTreatmentMalignant Ascites1
1TerminatedTreatmentMalignant Glioma (WHO Grade III or IV)1
1TerminatedTreatmentMetastatic Colorectal Cancer (MCRC)2
1TerminatedTreatmentNeoplasms1
1TerminatedTreatmentRetinopathy of Prematurity1
1TerminatedTreatmentTherapeutic Agent Toxicity1
1TerminatedTreatmentTumors, Solid1
1TerminatedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1Unknown StatusTreatmentDiffuse Diabetic Macular Edema1
1Unknown StatusTreatmentLymphedema1
1Unknown StatusTreatmentRefractory Malignant Ascites1
1Unknown StatusTreatmentResistant Cystoid Macular Edema1
1WithdrawnNot AvailableNeovascular Age-Related Macular Degeneration1
1WithdrawnOtherHealthy Volunteers1
1WithdrawnTreatmentGlioblastoma Multiforme (GBM)1
1WithdrawnTreatmentGlioblastomas / Hepatocellular,Carcinoma / Renal Cell Adenocarcinoma1
1WithdrawnTreatmentTumors of the Central Nervous System1
1, 2Active Not RecruitingTreatmentAdvanced Gastrointestinal Cancers1
1, 2Active Not RecruitingTreatmentClear Cell Renal Cell Carcinoma1
1, 2Active Not RecruitingTreatmentEGFR-mutant Lung Cancers / Lung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2Active Not RecruitingTreatmentEndometrial Cancer / Fallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
1, 2Active Not RecruitingTreatmentGlioblastoma Multiforme (GBM)2
1, 2Active Not RecruitingTreatmentGlioblastomas / Malignant Gliomas1
1, 2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
1, 2Active Not RecruitingTreatmentMalignant Neoplasm of Pancreas4
1, 2Active Not RecruitingTreatmentOvarian Cancer1
1, 2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2Active Not RecruitingTreatmentSquamous Cell Carcinoma (SCC)1
1, 2Active Not RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1, 2CompletedBasic ScienceAge-Related Macular Degeneration (ARMD) / Diabetic Macular Edema (DME) / Retinal Vein Occlusion1
1, 2CompletedDiagnosticBreast Cancer1
1, 2CompletedDiagnosticSoft Tissue Sarcoma (STS)1
1, 2CompletedTreatmentAdenocarcinoma of the Rectum / Rectal Carcinoma1
1, 2CompletedTreatmentAdenocarcinomas / Malignant Neoplasm of Colon / Metastasis / Rectal Carcinoma1
1, 2CompletedTreatmentAdult Anaplastic Astrocytoma / Adult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Adult Mixed Glioma / Recurrent Adult Brain Neoplasm1
1, 2CompletedTreatmentAdult Brain Glioblastoma / Glioblastoma Multiforme (GBM)1
1, 2CompletedTreatmentBrain Cancer / Malignant Gliomas / Recurrent Glioblastoma1
1, 2CompletedTreatmentBreast Cancer4
1, 2CompletedTreatmentChromophobe Renal Cell Carcinoma / Clear Cell Renal Cell Carcinoma / Papillary Renal Cell Carcinoma / Renal Cell Carcinoma Recurrent / Sarcomatoid Renal Cell Carcinoma / Stage IV Renal Cell Cancer1
1, 2CompletedTreatmentClear Cell Renal Cell Carcinoma1
1, 2CompletedTreatmentClear Cell Renal Cell Carcinoma / Renal Cell Cancer, Recurrent / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2CompletedTreatmentClear Cell Renal Cell Carcinoma / Renal Cell Cancer, Recurrent / Stage IV Renal Cell Cancer1
1, 2CompletedTreatmentColon Cancer With Metastases to the Liver1
1, 2CompletedTreatmentColorectal Cancers3
1, 2CompletedTreatmentColorectal Cancers / Malignant Neoplasm of Colon / Metastatic Colorectal Cancer (MCRC) / Rectal Carcinoma1
1, 2CompletedTreatmentCorneal Graft Failure / Corneal Neovascularization2
1, 2CompletedTreatmentDiabetic Retinopathy (DR) / Vitreous Hemorrhage1
1, 2CompletedTreatmentGlioblastoma Multiforme (GBM) / Gliomas / Gliosarcoma / Malignant Brain Tumors1
1, 2CompletedTreatmentGlioblastomas / Neoplasms, Brain1
1, 2CompletedTreatmentLeptomeningeal Metastases1
1, 2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1, 2CompletedTreatmentLiver Cancer1
1, 2CompletedTreatmentLocally Advanced Gastric Carcinoma1
1, 2CompletedTreatmentLung Cancers2
1, 2CompletedTreatmentMale Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2CompletedTreatmentMalignant Gliomas1
1, 2CompletedTreatmentMalignant Neoplasm of Pancreas1
1, 2CompletedTreatmentMalignant Solid Tumours1
1, 2CompletedTreatmentMetastatic Colon Cancer / Metastatic Squamous Neck Cancer With Occult Primary Squamous Cell Carcinoma / Non-Small Cell Lung Cancer Recurrent / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Colon Cancer / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Metastatic Squamous Neck Cancer With Occult Primary / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Pancreatic Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Colon Cancer / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Lymphoepithelioma of the Oropharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Pancreatic Cancer / Stage III Rectal Cancer / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IIIb Non-small Cell Lung Cancer / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Non-Small Cell Lung Cancer / Stage IV Pancreatic Cancer / Stage IV Rectal Cancer / Stage IV Renal Cell Cancer / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity / Untreated Metastatic Squamous Neck Cancer With Occult Primary1
1, 2CompletedTreatmentMetastatic Colorectal Cancer (MCRC)1
1, 2CompletedTreatmentMetastatic Melanoma1
1, 2CompletedTreatmentNeoplasms, Colorectal2
1, 2CompletedTreatmentProstate Cancer2
1, 2CompletedTreatmentPulmonary Veno Occlusive Disease / Pulmonary Veno-Occlusive Disease1
1, 2CompletedTreatmentRecurrent Gliomas1
1, 2CompletedTreatmentRecurrent Melanoma / Stage III Melanoma / Stage IV Melanoma / Unspecified Adult Solid Tumor, Protocol Specific1
1, 2CompletedTreatmentRecurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Salivary Gland Squamous Cell Carcinoma / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity1
1, 2CompletedTreatmentStage IV Colorectal Cancer1
1, 2CompletedTreatmentTumors, Solid1
1, 2Not Yet RecruitingTreatmentAdvanced Colorectal Cancer1
1, 2Not Yet RecruitingTreatmentCancer of Colon / Cancer of Liver / Cancer of Pancreas / Cancer of Rectum / Cancer of the Gallbladder / Glioblastoma Multiforme (GBM) / Multiple Myeloma (MM)1
1, 2Not Yet RecruitingTreatmentLocally Recurrent Cancer / Metastatic Nasopharyngeal Cancer1
1, 2Not Yet RecruitingTreatmentPeritoneal Carcinosis1
1, 2RecruitingDiagnosticHilar Cholangiocarcinoma1
1, 2RecruitingTreatmentAdenocarcinoma of the Pancreas1
1, 2RecruitingTreatmentAdenocarcinoma of the Pancreas / Colorectal Adenocarcinoma / Metastatic Colorectal Cancer (MCRC) / Pancreatic Cancer Metastatic1
1, 2RecruitingTreatmentAdvanced (Stage IIIB-C-IV) Ovarian, Primary Peritoneal and Fallopian Tube Cancer1
1, 2RecruitingTreatmentAnaplastic Astrocytoma (AA) / Brain Stem Gliomas / Diffuse Intrinsic Pontine Glioma (DIPG) / DIPG / Glioblastoma Multiforme (GBM) / Glioma, Astrocytic / Gliosarcoma / Low-Grade Gliomas / Optic Nerve Glioma / Pilocytic Astrocytoma / Pilomyxoid Astrocytoma / Pleomorphic Xanthoastrocytoma1
1, 2RecruitingTreatmentAnaplastic Astrocytoma (AA) / Brain Stem Gliomas / Diffuse Intrinsic Pontine Glioma (DIPG) / Fibrillary Astrocytoma of Brain / Glioblastoma Multiforme (GBM) / Glioma of Brainstem / Mixed Oligodendroglioma-Astrocytoma / Pilomyxoid Astrocytoma1
1, 2RecruitingTreatmentAnaplastic Astrocytoma (AA) / Glioblastoma Multiforme (GBM)1
1, 2RecruitingTreatmentBreast / Malignant Neoplasm of Stomach / Ovarian / Small Cell Lung Cancer (SCLC)1
1, 2RecruitingTreatmentCervical Cancers1
1, 2RecruitingTreatmentClear Cell Renal Cell Carcinoma / Stage IV Renal Cell Cancer1
1, 2RecruitingTreatmentColorectal Cancers2
1, 2RecruitingTreatmentGerm Cell Tumors1
1, 2RecruitingTreatmentGlioblastoma Multiforme (GBM)1
1, 2RecruitingTreatmentGlioblastoma Multiforme (GBM) / Neoplasms, Brain1
1, 2RecruitingTreatmentKRAS Gene Mutation / Metastatic Colorectal Cancer (MCRC)1
1, 2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
1, 2RecruitingTreatmentMetastatic Cancers / Renal Cancers1
1, 2RecruitingTreatmentMetastatic Microsatellite-stable Colorectal Cancer1
1, 2RecruitingTreatmentNeoplasms, Breast1
1, 2RecruitingTreatmentNeoplasms, Ovarian / Ovarian Cancer1
1, 2RecruitingTreatmentPancreatic Adenocarcinoma Metastatic1
1, 2RecruitingTreatmentRenal Cell Adenocarcinoma1
1, 2RecruitingTreatmentTriple Negative Breast Cancer (TNBC)1
1, 2SuspendedTreatmentAnaplastic Astrocytoma (AA) / Glioblastoma Multiforme (GBM)1
1, 2TerminatedDiagnosticAdenocarcinoma of the Pancreas / Malignant Neoplasm of Pancreas1
1, 2TerminatedOtherLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2TerminatedTreatmentAdult Anaplastic Astrocytoma / Adult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Recurrent Adult Brain Tumor1
1, 2TerminatedTreatmentCentral Nervous System Neoplasms / Neoplasms, Brain1
1, 2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2TerminatedTreatmentLung Cancers1
1, 2TerminatedTreatmentMalignant Neoplasm of Pancreas1
1, 2TerminatedTreatmentMalignant Neoplasm of Pancreas / Pancreatic Ductal Adenocarcinoma1
1, 2TerminatedTreatmentMesothelioma1
1, 2TerminatedTreatmentMetastatic Colorectal Cancer (MCRC)1
1, 2TerminatedTreatmentMetastatic Colorectal Carcinoma1
1, 2TerminatedTreatmentProstate Cancer1
1, 2TerminatedTreatmentRenal Cell Adenocarcinoma / Renal Cell Cancer, Recurrent / Stage III Renal Cell Cancer / Stage IV Renal Cell Cancer1
1, 2Unknown StatusTreatmentAcute Nonarteritic Anterior Ischemic Optic Neuropathy1
1, 2Unknown StatusTreatmentAdvanced Gastric Cancer1
1, 2Unknown StatusTreatmentGlioblastoma Multiforme (GBM)1
1, 2Unknown StatusTreatmentHereditary Haemorrhagic Telangiectasia (HHT)1
1, 2Unknown StatusTreatmentMacular Degeneration1
1, 2Unknown StatusTreatmentMalignant Melanoma of Skin / Melanoma (Skin)1
1, 2Unknown StatusTreatmentRenal Cell Adenocarcinoma1
1, 2WithdrawnNot AvailableOvarian Cancer / Primary Peritoneal Cancer1
1, 2WithdrawnTreatmentColorectal Cancers1
1, 2WithdrawnTreatmentGlioblastoma Multiforme (GBM)1
1, 2WithdrawnTreatmentHead and Neck Squamous Cell Carcinoma (HNSCC)1
1, 2WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
1, 2WithdrawnTreatmentLung Cancers1
1, 2WithdrawnTreatmentMelanoma1
1, 2WithdrawnTreatmentMetastatic Melanoma / Tumors Metastatic to Brain1
1, 2WithdrawnTreatmentNeuroendocrine Carcinoma of the Skin1
1, 2WithdrawnTreatmentNon-Hodgkin's Lymphoma (NHL)1
1, 2WithdrawnTreatmentOvarian Cancer1
1, 2WithdrawnTreatmentTransitional Cell Carcinoma1
1, 2WithdrawnTreatmentTriple Negative Breast Cancer (TNBC)1
2Active Not RecruitingNot AvailableAdenocarcinoma of the Gastro-oesophageal Junction / Metastatic Gastric Cancers1
2Active Not RecruitingOtherLung Cancer Non-Small Cell Cancer (NSCLC)1
2Active Not RecruitingPreventionRetinal Detachment / Vitreoretinopathy, Proliferative1
2Active Not RecruitingSupportive CareRadionecrosis / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentAcoustic Schwannoma / Adult Anaplastic Meningioma / Adult Ependymoma / Adult Grade I Meningioma / Adult Grade II Meningioma / Adult Meningeal Hemangiopericytoma / Adult Papillary Meningioma / Neurofibromatosis Type 1 / Neurofibromatosis Type 2 / Recurrent Adult Brain Tumor1
2Active Not RecruitingTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Recurrent Cervical Carcinoma / Recurrent, IV-B Cervical cancer / Stage IV Cervical Cancer AJCC v6 and v7 / Stage IVA Cervical Cancer / Stage IVA Cervical Cancer AJCC v6 and v7 / Stage IVB Cervical Cancer / Stage IVB Cervical Cancer AJCC v6 and v71
2Active Not RecruitingTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Adenosquamous Lung Carcinoma / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Large Cell Lung Carcinoma / Lung Adenosquamous Carcinoma / Lung Large Cell Carcinoma / Lung Squamous Cell Carcinoma / Minimally Invasive Lung Adenocarcinoma / Squamous Cell Carcinoma of Lung / Squamous Cell Lung Carcinoma / Stage IIIA Lung Non-Small Cell Cancer AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v7 / Stage IIIB Lung Non-Small Cell Cancer AJCC v7 / Stage IIIb Non-small Cell Lung Cancer / Stage IIIB Non-Small Cell Lung Cancer AJCC v71
2Active Not RecruitingTreatmentAdenocarcinoma of the Ovaries / Fallopian Tube Adenocarcinoma / Fallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fallopian Tube Undifferentiated Carcinoma / Malignant Neoplasms of Female Genital Organs / Malignant Ovarian Brenner Tumor / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Ovarian Undifferentiated Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentAdult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Adult Oligodendroglioma / Giant Cell Glioblastoma / Glioblastomas / Gliosarcoma / Oligodendrogliomas / Recurrent Adult Brain Neoplasm / Recurrent Brain Neoplasm / Recurrent Glioblastoma1
2Active Not RecruitingTreatmentAdult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Recurrent Adult Brain Tumor1
2Active Not RecruitingTreatmentAdvanced Non-Clear Cell Kidney Cancer1
2Active Not RecruitingTreatmentAdvanced Ovarian Carcinoma / Ovarian Carcinosarcoma / Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentAdvanced Renal Cell Carcinoma / Renal Cell Carcinoma Recurrent / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V71
2Active Not RecruitingTreatmentAnaplastic Astrocytoma (AA) / Brain Stem Gliomas / Glial Cell Tumors / Glioblastoma Multiforme (GBM) / Gliomatosis Cerebri / Gliosarcoma / Malignant Gliomas1
2Active Not RecruitingTreatmentBrain and Central Nervous System Tumors1
2Active Not RecruitingTreatmentBreast Cancer6
2Active Not RecruitingTreatmentBreast Cancer / Cancer of the Breast / Neoplasms, Breast1
2Active Not RecruitingTreatmentBreast Cancer / HER2 Negative Breast Cancer / HER2 Positive Breast Cancers / HER2-Negative Breast Cancer / Recurrent Breast Cancer / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2Active Not RecruitingTreatmentBreast Cancer / Tumors Metastatic to Brain1
2Active Not RecruitingTreatmentCarcinoma, Colorectal / Colorectal Adenocarcinoma / Colorectal Cancers / Colorectal Tumors / Neoplasms, Colorectal1
2Active Not RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck1
2Active Not RecruitingTreatmentCervical Cancers / Endometrial Cancer1
2Active Not RecruitingTreatmentColorectal Cancer Liver Metastases1
2Active Not RecruitingTreatmentColorectal Cancers5
2Active Not RecruitingTreatmentDesmoplastic Small Round Cell Tumor (DSRCT) / Ewing Sarcoma of Bone or Soft Tissue / Localized Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor / Metastatic Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor1
2Active Not RecruitingTreatmentEGFR Activating Mutation / EGFR Exon 19 Deletion Mutation / EGFR NP_005219.2:p.L858R / Lung Non-Squamous Non-Small Cell Carcinoma / Non-Squamous Non-Small Cell Lung Carcinoma / Stage IV Lung Non-Small Cell Cancer AJCC v7 / Stage IV Non-Small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer AJCC v71
2Active Not RecruitingTreatmentEndometrial Adenocarcinomas / Endometrial Adenosquamous Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Serous Adenocarcinoma / Recurrent Uterine Corpus Carcinoma / Stage IIIA Uterine Corpus Cancer AJCC v7 / Stage IIIB Uterine Corpus Cancer AJCC v7 / Stage IIIC Uterine Corpus Cancer AJCC v7 / Stage IVA Uterine Corpus Cancer AJCC v7 / Stage IVB Uterine Corpus Cancer AJCC v71
2Active Not RecruitingTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach2
2Active Not RecruitingTreatmentEstrogen Receptor Negative / HER2/Neu Negative / Male Breast Carcinoma / Progesterone Receptor Negative / Stage IIA Breast Cancer / Stage IIA Breast Cancer AJCC v6 and v7 / Stage IIB Breast Cancer / Stage IIB Breast Cancer AJCC v6 and v7 / Stage IIIA Breast Cancer / Stage IIIA Breast Cancer AJCC v7 / Triple-Negative Breast Carcinoma1
2Active Not RecruitingTreatmentFallopian Tube Cancer / Fallopian Tube Carcinoma / Fallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Fallopian Tube Undifferentiated Carcinoma / FIGO Stage III Ovarian Cancer / FIGO Stage IIIA Ovarian Cancer / FIGO Stage IIIA1 Ovarian Cancer / FIGO Stage IIIA1(i) Ovarian Cancer / FIGO Stage IIIA1(ii) Ovarian Cancer / FIGO Stage IIIA2 Ovarian Cancer / FIGO Stage IIIB Ovarian Cancer / FIGO Stage IIIC Ovarian Cancer / FIGO Stage IVA Ovarian Cancer / FIGO Stage IVB Ovarian Cancer / Malignant Ovarian Brenner Tumor / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Epithelial Cancer / Ovarian Mucinous Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Ovarian Undifferentiated Carcinoma / Primary Peritoneal Carcinoma / Primary Peritoneal Serous Adenocarcinoma1
2Active Not RecruitingTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Cavity Cancer / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2Active Not RecruitingTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
2Active Not RecruitingTreatmentGastrinoma / Glucagonoma / Insulinoma / Pancreatic Polypeptide Tumor / Recurrent Islet Cell Carcinoma / Recurrent Pancreatic Cancer / Somatostatinoma / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2Active Not RecruitingTreatmentGiant Cell Glioblastoma / Glioblastomas / Gliosarcoma1
2Active Not RecruitingTreatmentGlioblastoma Multiforme (GBM) / Glioblastomas1
2Active Not RecruitingTreatmentGlioblastoma Multiforme (GBM) / Glioblastomas / Gliosarcoma / Malignant Gliomas1
2Active Not RecruitingTreatmentGlioblastomas3
2Active Not RecruitingTreatmentGliosarcoma / Recurrent Adult Brain Tumor / Recurrent Glioblastoma1
2Active Not RecruitingTreatmentHepatic Metastases / Malignant Neoplasm of Colon / Rectal Carcinoma1
2Active Not RecruitingTreatmentHepatocellular,Carcinoma1
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas1
2Active Not RecruitingTreatmentLiver Cancer3
2Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
2Active Not RecruitingTreatmentLung Cancers1
2Active Not RecruitingTreatmentLung Cancers / Neoplasms Metastasis1
2Active Not RecruitingTreatmentMalignant Melanoma of Skin / Melanoma (Skin)1
2Active Not RecruitingTreatmentMalignant Neoplasm of Colon1
2Active Not RecruitingTreatmentMalignant Neoplasm of Pancreas1
2Active Not RecruitingTreatmentMalignant Neoplasm of Stomach / Unresectable1
2Active Not RecruitingTreatmentMetastatic Breast Cancer3
2Active Not RecruitingTreatmentMetastatic Colon Cancer / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage IV Rectal Cancer1
2Active Not RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)2
2Active Not RecruitingTreatmentMetastatic Colorectal Carcinoma / Recurrent Colorectal Carcinoma / Refractory Colorectal Carcinoma / Stage IV Colorectal Cancer / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
2Active Not RecruitingTreatmentMetastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic1
2Active Not RecruitingTreatmentMucinous Adenocarcinoma of the Rectum / Signet Ring Adenocarcinoma of the Rectum / Stage IIA Rectal Cancer / Stage IIB Rectal Cancer / Stage IIC Rectal Cancer / Stage IIIA Rectal Cancer / Stage IIIB Rectal Cancer / Stage IIIC Rectal Cancer1
2Active Not RecruitingTreatmentNeoplasms, Breast1
2Active Not RecruitingTreatmentNeoplasms, Colorectal1
2Active Not RecruitingTreatmentNeurofibromatosis Type 2 / Progressive Vestibular Schwannomas1
2Active Not RecruitingTreatmentOvarian Cancer1
2Active Not RecruitingTreatmentOvarian Epithelial Cancer / Relapses1
2Active Not RecruitingTreatmentOvarian Sex-cord Stromal Tumor1
2Active Not RecruitingTreatmentPancreatic Gastrinoma / Pancreatic Neuroendocrine Tumor G1 / Pancreatic Neuroendocrine Tumor G2 / Pancreatic Vipoma / Recurrent Pancreatic Neuroendocrine Carcinoma1
2Active Not RecruitingTreatmentRadiation Necrosis1
2Active Not RecruitingTreatmentRectal Carcinoma1
2Active Not RecruitingTreatmentRecurrent Childhood Medulloblastoma / Recurrent Childhood Pineoblastoma / Recurrent Childhood Supratentorial Embryonal Tumor, Not Otherwise Specified / Recurrent Childhood Supratentorial Primitive Neuroectodermal Tumor1
2Active Not RecruitingTreatmentRecurrent Glioblastoma1
2Active Not RecruitingTreatmentRenal Cancers1
2Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
2Active Not RecruitingTreatmentRetinopathy of Prematurity1
2Active Not RecruitingTreatmentStage IIIC Cutaneous Melanoma AJCC v7 / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Unresectable Melanoma1
2Active Not RecruitingTreatmentTransitional Cell Carcinoma1
2Active Not RecruitingTreatmentWet Age-Related Macular Degeneration / Wet Macular Degeneration1
2Active Not RecruitingTreatmentMCRC1
2CompletedNot AvailableDiabetic Retinopathy (DR) / Macular Degeneration / Macular Edema1
2CompletedNot AvailableMalignant Gliomas1
2CompletedBasic ScienceStage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2CompletedDiagnosticColorectal Cancers1
2CompletedDiagnosticColorectal Cancers / Neoplasms Metastasis1
2CompletedDiagnosticGBM / Glioblastoma Multiforme (GBM)1
2CompletedDiagnosticMalignancies1
2CompletedOtherMetastatic Colorectal Adenocarcinoma1
2CompletedPreventionPancreatic Cancer Metastatic1
2CompletedSupportive CareAdult Anaplastic Astrocytoma / Adult Anaplastic Ependymoma / Adult Anaplastic Meningioma / Adult Anaplastic Oligodendroglioma / Adult Brain Stem Glioma / Adult Central Nervous System Germ Cell Tumor / Adult Choroid Plexus Tumor / Adult Diffuse Astrocytoma / Adult Ependymoma / Adult Grade II Meningioma / Adult Grade III Meningioma / Adult Malignant Hemangiopericytoma / Adult Mixed Glioma / Adult Oligodendroglioma / Adult Papillary Meningioma / Adult Pineocytoma / Meningeal Melanocytoma / Neoplasms, Malignant / Radiation Toxicity / Recurrent Adenoid Cystic Carcinoma of the Oral Cavity / Recurrent Adult Brain Tumor / Recurrent Basal Cell Carcinoma of the Lip / Recurrent Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Recurrent Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Recurrent Lymphoepithelioma of the Nasopharynx / Recurrent Lymphoepithelioma of the Oropharynx / Recurrent Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Recurrent Mucoepidermoid Carcinoma of the Oral Cavity / Recurrent Salivary Gland Cancer / Recurrent Squamous Cell Carcinoma of the Hypopharynx / Recurrent Squamous Cell Carcinoma of the Larynx / Recurrent Squamous Cell Carcinoma of the Lip and Oral Cavity / Recurrent Squamous Cell Carcinoma of the Nasopharynx / Recurrent Squamous Cell Carcinoma of the Oropharynx / Recurrent Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Recurrent Verrucous Carcinoma of the Larynx / Recurrent Verrucous Carcinoma of the Oral Cavity / Stage I Adenoid Cystic Carcinoma of the Oral Cavity / Stage I Basal Cell Carcinoma of the Lip / Stage I Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage I Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage I Lymphoepithelioma of the Nasopharynx / Stage I Lymphoepithelioma of the Oropharynx / Stage I Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage I Mucoepidermoid Carcinoma of the Oral Cavity / Stage I Salivary Gland Cancer / Stage I Squamous Cell Carcinoma of the Hypopharynx / Stage I Squamous Cell Carcinoma of the Larynx / Stage I Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage I Squamous Cell Carcinoma of the Nasopharynx / Stage I Squamous Cell Carcinoma of the Oropharynx / Stage I Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage I Verrucous Carcinoma of the Larynx / Stage I Verrucous Carcinoma of the Oral Cavity / Stage III Adenoid Cystic Carcinoma of the Oral Cavity / Stage III Basal Cell Carcinoma of the Lip / Stage III Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage III Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage III Mucoepidermoid Carcinoma of the Oral Cavity / Stage III Salivary Gland Cancer / Stage III Squamous Cell Carcinoma of the Hypopharynx / Stage III Squamous Cell Carcinoma of the Larynx / Stage III Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage III Squamous Cell Carcinoma of the Oropharynx / Stage III Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage III Verrucous Carcinoma of the Larynx / Stage III Verrucous Carcinoma of the Oral Cavity / Stage IV Adenoid Cystic Carcinoma of the Oral Cavity / Stage IV Basal Cell Carcinoma of the Lip / Stage IV Esthesioneuroblastoma of the Paranasal Sinus and Nasal Cavity / Stage IV Inverted Papilloma of the Paranasal Sinus and Nasal Cavity / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Lymphoepithelioma of the Oropharynx / Stage IV Midline Lethal Granuloma of the Paranasal Sinus and Nasal Cavity / Stage IV Mucoepidermoid Carcinoma of the Oral Cavity / Stage IV Salivary Gland Cancer / Stage IV Squamous Cell Carcinoma of the Hypopharynx / Stage IV Squamous Cell Carcinoma of the Larynx / Stage IV Squamous Cell Carcinoma of the Lip and Oral Cavity / Stage IV Squamous Cell Carcinoma of the Nasopharynx / Stage IV Squamous Cell Carcinoma of the Oropharynx / Stage IV Squamous Cell Carcinoma of the Paranasal Sinus and Nasal Cavity / Stage IV Verrucous Carcinoma of the Larynx / Stage IV Verrucous Carcinoma of the Oral Cavity1
2CompletedSupportive CareColorectal Cancers1
2CompletedTreatmentAbdominal wall neoplasm / Fallopian Tube Neoplasms / Neoplasms, Ovarian1
2CompletedTreatmentAcoustic Schwannoma / Neurofibromatosis Type 2 / Vestibular Schwannomas1
2CompletedTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Adenosquamous Cell Carcinoma / Cervical Squamous Cell Carcinoma / Cervical Squamous Cell Carcinoma, Not Otherwise Specified / Stage IB Cervical Cancer / Stage IB Cervical Cancer AJCC v6 and v7 / Stage IIA Cervical Cancer / Stage IIA Cervical Cancer AJCC v7 / Stage IIB Cervical Cancer / Stage IIB Cervical Cancer AJCC v6 and v7 / Stage III Cervical Cancer / Stage III Cervical Cancer AJCC v6 and v71
2CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Advanced Colorectal Cancer1
2CompletedTreatmentAdenocarcinoma of the Esophagus / Adenocarcinomas of the Gastroesophageal Junction / Diffuse Adenocarcinoma of the Stomach / Intestinal Adenocarcinoma of the Stomach / Mixed Adenocarcinoma of the Stomach / Squamous Cell Carcinoma of the Esophagus / Stage IA Esophageal Cancer / Stage IA Gastric Cancer / Stage IB Esophageal Cancer / Stage IB Gastric Cancer / Stage IIA Esophageal Cancer / Stage IIA Gastric Cancer / Stage IIB Esophageal Cancer / Stage IIB Gastric Cancer / Stage IIIA Esophageal Cancer / Stage IIIA Gastric Cancer / Stage IIIB Esophageal Cancer / Stage IIIB Gastric Cancer / Stage IIIC Esophageal Cancer / Stage IIIC Gastric Cancer1
2CompletedTreatmentAdenocarcinoma of the Lung / Adenosquamous Cell Lung Cancer / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Non-Small Cell Lung Cancer Recurrent / Squamous Cell Carcinoma of Lung / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Malignant Neoplasm of Pancreas1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
2CompletedTreatmentAdenocarcinoma of the Pancreas / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer1
2CompletedTreatmentAdenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer1
2CompletedTreatmentAdenocarcinoma of the Prostate / Prostate Cancer1
2CompletedTreatmentAdenocarcinoma of the Prostate / Recurrent Prostate Cancer / Stage I Prostate Cancer / Stage IIA Prostate Cancer / Stage IIB Prostate Cancer / Stage III Prostate Cancer1
2CompletedTreatmentAdenocarcinoma of the Rectum / Metastatic Colon Cancer / Mucinous Adenocarcinoma of the Colon / Recurrent Colon Cancer / Recurrent Rectal Cancer / Signet Ring Adenocarcinoma of the Colon / Stage IV Rectal Cancer1
2CompletedTreatmentAdenocarcinomas of the Gastroesophageal Junction / Advanced Gastric Cancer / Diffuse Adenocarcinoma of the Stomach / Intestinal Adenocarcinoma of the Stomach / Mixed Adenocarcinoma of the Stomach / Recurrent Gastric Cancer / Stage IIIA Gastric Cancer / Stage IIIB Gastric Cancer / Stage IIIC Gastric Cancer1
2CompletedTreatmentAdenocarcinomas / Carcinoma NOS / Hypernephroid / Nephroid Carcinoma / Renal Cell / Renal Cell Adenocarcinoma1
2CompletedTreatmentAdenocarcinomas / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2CompletedTreatmentAdenosquamous Cell Lung Cancer / Drug/Agent Toxicity by Tissue/Organ / Hemoptysis / Squamous Cell Carcinoma of Lung / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2CompletedTreatmentAdult Brain Tumors / Malignant Gliomas / Recurrent Glioblastoma Multiforme1
2CompletedTreatmentAdult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Recurrent Adult Brain Tumor1
2CompletedTreatmentAdult Glioblastoma / Adult Gliosarcoma / Recurrent Adult Brain Neoplasm / Recurrent Adult Brain Tumor1
2CompletedTreatmentAdult Hepatocellular Carcinoma / Advanced Adult Hepatocellular Carcinoma / Endometrial Serous Adenocarcinoma / Localized Non-Resectable Adult Liver Carcinoma / Lung Carcinoid Tumor / Malignant Ovarian Mixed Epithelial Tumor / Malignant Pancreatic Gastrinoma / Malignant Pancreatic Glucagonoma / Malignant Pancreatic Insulinoma / Malignant Pancreatic Somatostatinoma / Metastatic Digestive System Neuroendocrine Tumor G1 / Ovarian Carcinosarcoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Surface Papillary Adenocarcinoma / Pancreatic Alpha Cell Adenoma / Pancreatic Beta Cell Adenoma / Pancreatic Delta Cell Adenoma / Pancreatic G-Cell Adenoma / Pancreatic Polypeptide Tumor / Recurrent Adult Liver Carcinoma / Recurrent Digestive System Neuroendocrine Tumor G1 / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Pancreatic Neuroendocrine Carcinoma / Recurrent Primary Peritoneal Carcinoma / Recurrent Uterine Corpus Carcinoma / Regional Digestive System Neuroendocrine Tumor G1 / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIA Uterine Corpus Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIB Uterine Corpus Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Stage IIIC Uterine Corpus Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer / Stage IVA Uterine Corpus Cancer / Stage IVB Uterine Corpus Cancer / Uterine Carcinosarcoma1
2CompletedTreatmentAdult Primary Hepatocellular Carcinoma / Advanced Adult Primary Liver Cancer / Localized Unresectable Adult Primary Liver Cancer / Recurrent Adult Primary Liver Cancer1
2CompletedTreatmentAdult Primary Hepatocellular Carcinoma / Localized Unresectable Adult Primary Liver Cancer / Recurrent Adult Primary Liver Cancer1
2CompletedTreatmentAdult Rhabdomyosarcoma / Childhood Alveolar Rhabdomyosarcoma / Childhood Pleomorphic Rhabdomyosarcoma / Childhood Rhabdomyosarcoma With Mixed Embryonal and Alveolar Features / Previously Treated Childhood Rhabdomyosarcoma / Recurrent Adult Soft Tissue Sarcoma / Recurrent Childhood Rhabdomyosarcoma1
2CompletedTreatmentAdvanced Colorectal Cancer1
2CompletedTreatmentAdvanced Colorectal Cancer / Locally Advanced Rectal Cancer1
2CompletedTreatmentAdvanced Gastric Cancer1
2CompletedTreatmentAdvanced Malignant Mesothelioma / Epithelial Mesothelioma / Localized Malignant Mesothelioma / Recurrent Malignant Mesothelioma / Sarcomatous Mesothelioma1
2CompletedTreatmentAdvanced Non Small Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Non-Small Cell Lung Cancer Recurrent1
2CompletedTreatmentAdvanced Solid Tumors / Carcinoids / Colorectal Cancers / Locally Advanced / Lung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Lymphomas / Metastatic Cancers / Sarcomas / Tumors, Solid1
2CompletedTreatmentAdverse Effect of Radiation Therapy / Brain Necrosis / Nasopharyngeal Carcinoma1
2CompletedTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)1
2CompletedTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD) / Macular Edema / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD) / Proliferative Diabetic Retinopathy (PDR)1
2CompletedTreatmentAge-Related Macular Degeneration (ARMD)1
2CompletedTreatmentAmpulla of Vater Adenocarcinoma / Gastrointestinal Cancers / Small Intestinal Adenocarcinoma / Stage III Ampulla of Vater Cancer AJCC v8 / Stage III Small Intestinal Adenocarcinoma AJCC v8 / Stage IIIA Ampulla of Vater Cancer AJCC v8 / Stage IIIA Small Intestinal Adenocarcinoma AJCC v8 / Stage IIIB Ampulla of Vater Cancer AJCC v8 / Stage IIIB Small Intestinal Adenocarcinoma AJCC v8 / Stage IV Ampulla of Vater Cancer AJCC v8 / Stage IV Small Intestinal Adenocarcinoma AJCC v81
2CompletedTreatmentAnaplastic Astrocytoma (AA) / Anaplastic Mixed Oligoastrocytoma / Anaplastic Oligodendroglioma (AO) / Glioblastomas / Gliosarcoma1
2CompletedTreatmentAnaplastic Large Cell Lymphoma / Anaplastic Large-Cell Lymphoma / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Mantle Cell Lymphoma1
2CompletedTreatmentAstrocytomas / Glioblastomas1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia / Chronic Lymphocytic Leukemia (CLL) - Refractory1
2CompletedTreatmentBasal Cell Carcinoma (BCC) / Metastatic Colorectal Cancer (MCRC) / Ovarian Cancer1
2CompletedTreatmentBiliary Tract Cancer / Gallbladder Adenocarcinoma2
2CompletedTreatmentBrain Cancer / Glioblastomas1
2CompletedTreatmentBrain Cancer / Pediatric Cancers1
2CompletedTreatmentBrain and Central Nervous System Tumors5
2CompletedTreatmentBreast Cancer44
2CompletedTreatmentBreast Cancer / Metastatic Breast Cancer1
2CompletedTreatmentBreast Cancer / Metastatic Breast Cancer / Progressive Breast Cancer1
2CompletedTreatmentBreast Cancer / Neoplasms, Breast1
2CompletedTreatmentCancer of the Gallbladder / Cholangiocarcinomas1
2CompletedTreatmentCancer of the Rectum / Colorectal Cancers / Rectal Carcinoma1
2CompletedTreatmentCancer, Bladder3
2CompletedTreatmentCarcinoid Tumors1
2CompletedTreatmentCarcinoma NOS1
2CompletedTreatmentCarcinoma of the Vulva / Cervical Cancers / Endometrial Cancer / Ovarian Cancer / Vaginal Cancers1
2CompletedTreatmentCervical Cancer, Cancer, Metastatic Cancers / Cervical Cancers1
2CompletedTreatmentCervical Cancers1
2CompletedTreatmentCervical Squamous Cell Carcinoma / Recurrent Cervical Cancer1
2CompletedTreatmentChildhood Cerebral Anaplastic Astrocytoma / Childhood Oligodendroglioma / Childhood Spinal Cord Neoplasm / Recurrent Childhood Brain Stem Glioma / Recurrent Childhood Ependymoma / Recurrent Childhood Medulloblastoma1
2CompletedTreatmentCholangiocarcinoma of the Extrahepatic Bile Duct / Cholangiocarcinoma of the Gallbladder / Gastrointestinal Cancers / Recurrent Extrahepatic Bile Duct Cancer / Recurrent Gallbladder Cancer / Unresectable Extrahepatic Bile Duct Cancer / Unresectable Gallbladder Cancer1
2CompletedTreatmentCholangiocarcinomas2
2CompletedTreatmentChoriocarcinoma1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)2
2CompletedTreatmentClear Cell Mullerian Tumor / Fallopian Tube Cancer / Ovarian Cancer / Papillary Serous Mullerian Tumor / Primary Peritoneal Cancer1
2CompletedTreatmentClear Cell Renal Cell Carcinoma / Renal Cell Cancer, Recurrent / Renal Cell Carcinoma Recurrent / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V71
2CompletedTreatmentClear Cell Renal Cell Carcinoma / Renal Cell Carcinoma Recurrent / Stage IV Renal Cell Cancer / Type 1 Papillary Renal Cell Carcinoma / Type 2 Papillary Renal Cell Carcinoma1
2CompletedTreatmentColorectal Adenocarcinoma1
2CompletedTreatmentColorectal Adenocarcinoma / KRAS wt Allele / Metastatic Colorectal Cancer (MCRC) / NRAS wt Allele / RAS Wild Type / Stage IV Colorectal Cancer / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer / Stage IVB Colorectal Cancer AJCC v71
2CompletedTreatmentColorectal Cancer (CRC)1
2CompletedTreatmentColorectal Cancer Stage II1
2CompletedTreatmentColorectal Cancers39
2CompletedTreatmentColorectal Cancers / Colorectal, Cancer1
2CompletedTreatmentColorectal Cancers / Liver Metastasis1
2CompletedTreatmentColorectal Cancers / Malignancies / Malignant Neoplasm of Colon / Metastatic Cancers / Metastatic Colorectal Cancer (MCRC) / Rectal Carcinoma1
2CompletedTreatmentColorectal Cancers / Malignant Neoplasm of Colon / Metastatic Colorectal Cancer (MCRC) / Rectal Carcinoma1
2CompletedTreatmentColorectal Cancers / Neoplasms Metastasis1
2CompletedTreatmentColorectal Cancers / Neoplasms, Colorectal1
2CompletedTreatmentColorectal Cancers / Rectal Carcinoma1
2CompletedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma1
2CompletedTreatmentDiabetes / Diabetic Macular Edema (DME) / Diabetic Retinopathy (DR)1
2CompletedTreatmentDiabetic Macular Edema (DME)4
2CompletedTreatmentDiabetic Retinopathy (DR)1
2CompletedTreatmentDiabetic Retinopathy (DR) / Macular Edema1
2CompletedTreatmentDiabetic Retinopathy (DR) / Retinal Detachment1
2CompletedTreatmentEndometrial Adenocarcinomas / Endometrial Adenosquamous Carcinoma / Endometrial Adenosquamous Cell Carcinoma / Endometrial Clear Cell Adenocarcinoma / Endometrial Clear Cell Carcinoma / Endometrial Papillary Serous Carcinoma / Endometrial Serous Adenocarcinoma / Stage I Endometrial Carcinoma / Stage IA Uterine Corpus Cancer AJCC v7 / Stage IB Uterine Corpus Cancer AJCC v7 / Stage II Endometrial Carcinoma / Stage II Uterine Corpus Cancer AJCC v7 / Stage III Endometrial Carcinoma / Stage IIIA Uterine Corpus Cancer AJCC v7 / Stage IIIB Uterine Corpus Cancer AJCC v7 / Stage IIIC Uterine Corpus Cancer AJCC v7 / Stage IV Endometrial Carcinoma / Stage IVA Uterine Corpus Cancer AJCC v7 / Stage IVB Uterine Corpus Cancer AJCC v71
2CompletedTreatmentEndometrial Cancer1
2CompletedTreatmentEndometrial Carcinoma1
2CompletedTreatmentEpistaxis / Hereditary Haemorrhagic Telangiectasia (HHT)1
2CompletedTreatmentEpistaxis / Hereditary Haemorrhagic Telangiectasia (HHT) / Morbus Osler1
2CompletedTreatmentEsophageal Cancers2
2CompletedTreatmentEsophageal Cancers / Malignant Neoplasm of Stomach4
2CompletedTreatmentEstrogen Receptor-negative Breast Cancer / HER2 Negative Breast Cancer / HER2-Negative Breast Cancer / Progesterone Receptor-negative Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer / Triple Negative Breast Cancer (TNBC) / Triple-Negative Breast Cancer (TNBC)1
2CompletedTreatmentEwing Sarcoma of Bone / Extraosseous Ewing Sarcoma / Peripheral Primitive Neuroectodermal Tumor / Recurrent Ewing Sarcoma/Peripheral Primitive Neuroectodermal Tumor1
2CompletedTreatmentExtensive Stage Small Cell Lung Cancer2
2CompletedTreatmentFallopian Tube Cancer / Malignant Peritoneal Neoplasm / Ovarian Cancer3
2CompletedTreatmentFallopian Tube Cancer / Malignant Tumor of Peritoneum / Ovarian Cancer1
2CompletedTreatmentFallopian Tube Cancer / Neoplasms, Ovarian / Primary Peritoneal Cancer1
2CompletedTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary PERITONEUM1
2CompletedTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Carcinoma2
2CompletedTreatmentFallopian Tube Cancer / Primary Peritoneal Cavity Cancer / Recurrent Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
2CompletedTreatmentFollicular Lymphoma (FL)1
2CompletedTreatmentGastric (Stomach) Cancer / Gastrointestinal Stromal Tumors (GISTs) / Malignant Neoplasm of Stomach / Neoplasm of Cardioesophageal Junction1
2CompletedTreatmentGastroesophageal Cancer (GC) / Malignant Neoplasm of Stomach1
2CompletedTreatmentGastrointestinal Cancers / Malignant Ascites1
2CompletedTreatmentGiant Cell Glioblastoma / Glioblastoma With Oligodendroglial Component / Glioblastomas / Gliosarcoma / Recurrent Glioblastoma / Relapsed Glioblastoma / Small Cell Glioblastoma1
2CompletedTreatmentGlioblastoma - Category / Glioblastoma Multiforme (GBM)1
2CompletedTreatmentGlioblastoma Multiforme (GBM)10
2CompletedTreatmentGlioblastoma Multiforme (GBM) / Glioblastomas1
2CompletedTreatmentGlioblastoma Multiforme (GBM) / Gliosarcoma2
2CompletedTreatmentGlioblastoma Multiforme (GBM) / Primary Brain Tumors1
2CompletedTreatmentGlioblastomas8
2CompletedTreatmentGlioblastomas / Gliomas / Recurrent Brain Tumors1
2CompletedTreatmentGlioblastomas / Gliosarcoma6
2CompletedTreatmentGlioblastomas / Gliosarcoma / Grade 4 Malignant Glioma / Malignant Gliomas1
2CompletedTreatmentGlioblastomas / Gliosarcoma / Neoplasms, Brain1
2CompletedTreatmentGliomas2
2CompletedTreatmentGliomas / High Grade Glioma (HGG)1
2CompletedTreatmentGliomas / Neoplasms, Brain1
2CompletedTreatmentHIV Seronegativity / Human Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)1
2CompletedTreatmentHead and Neck Carcinoma4
2CompletedTreatmentHead and Neck Carcinoma / Squamous Cell Carcinoma (SCC)1
2CompletedTreatmentHemangiosarcoma / Histiocytoma / Leiomyosarcomas / Malignant Fibrous / Sarcomas1
2CompletedTreatmentHemangiosarcoma / Paclitaxel1
2CompletedTreatmentHemorrhagic Hereditary Telangiectasia (HHT)1
2CompletedTreatmentHepatocellular,Carcinoma3
2CompletedTreatmentHepatocellular,Carcinoma / Liver Cancer1
2CompletedTreatmentHereditary Haemorrhagic Telangiectasia (HHT)2
2CompletedTreatmentHigh Grade Glioma (HGG)1
2CompletedTreatmentIdiopathic Polypoidal Choroidal Vasculopathy1
2CompletedTreatmentInvasive Breast Cancer1
2CompletedTreatmentKaposi s Sarcoma (KS)2
2CompletedTreatmentLeptomeningeal Metastasis / Neoplasms, Breast / Tumors Metastatic to Brain1
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
2CompletedTreatmentLiver Cancer5
2CompletedTreatmentLiver Only Metastasis From KRAS Exon 2 Wild Type (Under Protocol 1.0-1.2 Edition) and RAS Wild Type (Under Protocol 2.0 Edition) Colorectal Cancer1
2CompletedTreatmentLocally Advanced Breast Cancer (LABC) / Metastatic Breast Cancer1
2CompletedTreatmentLocally Advanced Non-Small Cell Lung Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2CompletedTreatmentLocally Recurrent and Metastatic Breast Cancer1
2CompletedTreatmentLocally Recurrent or Metastatic Breast Cancer1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)33
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Malignant Pleural Effusions1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasm Recurrence, Local1
2CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Brain1
2CompletedTreatmentLung Cancers22
2CompletedTreatmentLung Cancers / Small Cell Lung Cancer (SCLC)1
2CompletedTreatmentMalignant Peripheral Nerve Sheath Tumour (MPNST) / MPNST / Sarcomas1
2CompletedTreatmentMacular Degeneration2
2CompletedTreatmentMacular Degeneration / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentMale Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentMale Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer1
2CompletedTreatmentMalignancies4
2CompletedTreatmentMalignancies / Metastatic Colorectal Cancer (MCRC)1
2CompletedTreatmentMalignancies / Myeloproliferative Disorders / Transitional Cell Carcinoma1
2CompletedTreatmentMalignant Fibrous Histiocytoma (MFH) of Bone / Sarcoma, Osteogenic1
2CompletedTreatmentMalignant Gliomas1
2CompletedTreatmentMalignant Gliomas / Recurrent High-Grade Gliomas1
2CompletedTreatmentMalignant Lymphomas3
2CompletedTreatmentMalignant Melanoma of Skin / Melanoma (Skin)2
2CompletedTreatmentMalignant Neoplasm of Colon1
2CompletedTreatmentMalignant Neoplasm of Pancreas8
2CompletedTreatmentMalignant Ovarian Epithelial Tumor / Ovarian Granulosa Cell Tumor / Ovarian Gynandroblastoma / Ovarian Sertoli-Leydig Cell Tumors / Ovarian Sex Cord Tumor With Annular Tubules / Ovarian Sex Cord-Stromal Tumor / Ovarian Sex Cord-Stromal Tumor of Mixed or Unclassified Cell Types / Ovarian Steroid Cell Tumor / Ovarian Stromal Cancer1
2CompletedTreatmentMelanoma3
2CompletedTreatmentMelanoma, Malignant2
2CompletedTreatmentMesothelioma3
2CompletedTreatmentMetastases / Renal Cell Adenocarcinoma1
2CompletedTreatmentMetastatic Breast Cancer9
2CompletedTreatmentMetastatic Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentMetastatic Colorectal Cancer (MCRC)15
2CompletedTreatmentMetastatic Gastrointestinal Carcinoid Tumor / Recurrent Gastrointestinal Carcinoid Tumor / Regional Gastrointestinal Carcinoid Tumor1
2CompletedTreatmentMetastatic Hormone Refractory Prostate Cancer1
2CompletedTreatmentMetastatic Malignant Melanoma1
2CompletedTreatmentMetastatic Melanoma3
2CompletedTreatmentMetastatic Melanoma / Mucosal Melanoma / Recurrent Melanoma / Stage IV Cutaneous Melanoma AJCC v6 and v7 / Stage IV Skin Melanoma / Stage IV Uveal Melanoma / Stage IV Uveal Melanoma AJCC v7 / Unresectable Melanoma1
2CompletedTreatmentMetastatic Non-Small Cell Lung Cancer / Nonsquamous Nonsmall Cell Neoplasm of Lung1
2CompletedTreatmentMetastatic Renal Cell Carcinoma3
2CompletedTreatmentMultiple Myeloma (MM)2
2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm2
2CompletedTreatmentNaive Unresectable Glioblastoma1
2CompletedTreatmentNasopharyngeal Carcinoma1
2CompletedTreatmentNeoplasms2
2CompletedTreatmentNeoplasms Metastasis / Neoplasms, Esophageal / Stomach Neoplasms1
2CompletedTreatmentNeoplasms, Breast1
2CompletedTreatmentNeoplasms, Colorectal5
2CompletedTreatmentNeoplasms, Esophageal / Stomach Neoplasms1
2CompletedTreatmentNeoplasms, Germ Cell and Embryonal1
2CompletedTreatmentNeoplasms, Ovarian2
2CompletedTreatmentNeoplasms, Pancreatic1
2CompletedTreatmentNeovascular Age-Related Macular Degeneration1
2CompletedTreatmentNeuroblastomas1
2CompletedTreatmentNeuroblastomas / Sarcomas1
2CompletedTreatmentNeuroendocrine Carcinomas2
2CompletedTreatmentNeuroendocrine Tumors2
2CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer4
2CompletedTreatmentOvarian Cancer9
2CompletedTreatmentOvarian Carcinoma / Primary Peritoneal Carcinoma1
2CompletedTreatmentOvarian Epithelial Cancer / Primary Peritoneal Carcinoma1
2CompletedTreatmentPrimary Peritoneal Carcinoma / Recurrent Ovarian Carcinoma / Stage IV Ovarian Cancer1
2CompletedTreatmentPrimary Peritoneal Cavity Cancer / Recurrent Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
2CompletedTreatmentProstate Cancer5
2CompletedTreatmentProstatic Neoplasms1
2CompletedTreatmentPterygium2
2CompletedTreatmentRectal Adenocarcinoma1
2CompletedTreatmentRectal Adenocarcinoma / Stage II Rectal Cancer / Stage II Rectal Cancer AJCC v7 / Stage III Rectal Cancer / Stage III Rectal Cancer AJCC v71
2CompletedTreatmentRectal Carcinoma6
2CompletedTreatmentRectum Cancer1
2CompletedTreatmentRecurrent Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentRecurrent Breast Carcinoma / Stage IV Breast Cancer1
2CompletedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
2CompletedTreatmentRecurrent Endometrial Carcinoma2
2CompletedTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2CompletedTreatmentRecurrent Glioblastoma1
2CompletedTreatmentRecurrent Glioblastoma Multiforme / Recurrent Gliosarcoma1
2CompletedTreatmentRecurrent Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma1
2CompletedTreatmentRecurrent Melanoma / Stage IV Melanoma1
2CompletedTreatmentRecurrent Melanoma / Stage IV Skin Melanoma1
2CompletedTreatmentRecurrent Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2CompletedTreatmentRecurrent Ovarian Epithelial Cancer1
2CompletedTreatmentRecurrent Small-cell Lung Cancer (SCLC) / Small Cell Lung Cancer (SCLC)1
2CompletedTreatmentRenal Cancers4
2CompletedTreatmentRenal Cancers / Renal Cell Adenocarcinoma3
2CompletedTreatmentRenal Cell Adenocarcinoma4
2CompletedTreatmentRenal Cell Cancer, Recurrent / Stage IV Renal Cell Cancer1
2CompletedTreatmentRenal Cell Carcinoma Recurrent / Stage IV Renal Cell Cancer1
2CompletedTreatmentRetinal Neovascularization1
2CompletedTreatmentSarcomas3
2CompletedTreatmentSmall Cell Lung Cancer (SCLC)3
2CompletedTreatmentSquamous Cell Carcinoma of the Head and Neck (SCCHN)1
2CompletedTreatmentStage IA Pancreatic Cancer / Stage IB Pancreatic Cancer / Stage IIA Pancreatic Cancer / Stage IIB Pancreatic Cancer1
2CompletedTreatmentStage II Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage II Squamous Cell Carcinoma of the Nasopharynx / Stage III Lymphoepithelioma of the Nasopharynx / Stage III Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage III Nasopharyngeal Undifferentiated Carcinoma AJCC v7 / Stage III Squamous Cell Carcinoma of the Nasopharynx / Stage IV Lymphoepithelioma of the Nasopharynx / Stage IV Nasopharyngeal Keratinizing Squamous Cell Carcinoma AJCC v7 / Stage IV Nasopharyngeal Undifferentiated Carcinoma AJCC v7 / Stage IV Squamous Cell Carcinoma of the Nasopharynx1
2CompletedTreatmentStage III Ovarian Cancer / Stage IV Ovarian Cancer1
2CompletedTreatmentAdvanced thymic carcinoma / Thymic Cancer1
2CompletedTreatmentTumors1
2CompletedTreatmentTumors of the Central Nervous System1
2CompletedTreatmentUnknown Primary Neoplasms2
2CompletedTreatmentUntreated Mantle Cell Lymphoma1
2CompletedTreatmentUntreated Metastatic Colorectal Cancer1
2Not Yet RecruitingTreatmentALK Gene Rearrangement Positive / Non-Squamous Non-Small Cell Neoplasm of Lung1
2Not Yet RecruitingTreatmentAdenocarcinoma of Lung Stage IV1
2Not Yet RecruitingTreatmentAdvanced Non Small Cell Lung Cancer / Non-Small-Cell Lung Cancer Stage IV1
2Not Yet RecruitingTreatmentAdvanced Ovarian Cancer1
2Not Yet RecruitingTreatmentBreast Cancer1
2Not Yet RecruitingTreatmentColorectal Adenocarcinoma / Stage IVA Colorectal Cancer / Stage IVB Colorectal Cancer1
2Not Yet RecruitingTreatmentColorectal Cancers2
2Not Yet RecruitingTreatmentEGFR Activating Mutation / Leptomeningeal Metastasis / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2Not Yet RecruitingTreatmentEGFRmutant Stage IIIB/C or IV Non-squamous NSCLC1
2Not Yet RecruitingTreatmentEfficacy / Metastatic Triple Negative Breast Cancer / Safety Issues1
2Not Yet RecruitingTreatmentGlioblastomas / Gliomas1
2Not Yet RecruitingTreatmentHCC and HBV Infection1
2Not Yet RecruitingTreatmentHepatocellular Carcinoma Non-resectable1
2Not Yet RecruitingTreatmentHeptocellular Cancer / Heptocellular Carcinoma / Metastatic Hepatocellular Carcinoma1
2Not Yet RecruitingTreatmentHigh Immune Infiltrate / Metastatic Colorectal Cancer (MCRC) / Microsatellite Stable1
2Not Yet RecruitingTreatmentLiver Metastasis Colon Cancer1
2Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
2Not Yet RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)2
2Not Yet RecruitingTreatmentNSCLC Stage IIIB~IV1
2Not Yet RecruitingTreatmentNeoplasms, Colorectal1
2Not Yet RecruitingTreatmentNeovascular Age-Related Macular Degeneration1
2Not Yet RecruitingTreatmentNon-small-cell Lung Cancer Patients1
2Not Yet RecruitingTreatmentRectal Carcinoma1
2RecruitingBasic ScienceRecurrent Adult Brain Tumor1
2RecruitingDiagnosticEsophagus, Barrett1
2RecruitingOtherBreast Cancer / Estrogen Receptor Positive Breast Cancer / Estrogen Receptor-Positive Breast Cancer1
2RecruitingTreatmentALK Gene Rearrangement Positive / EGFR Gene Mutations / NSCLC Stage IIIB / NSCLC Stage IV / ROS1 Gene Mutation1
2RecruitingTreatmentAdenocarcinoma of the Lung2
2RecruitingTreatmentAdvanced Colorectal Cancer2
2RecruitingTreatmentAdvanced Colorectal Carcinoma / Metastatic Colon Adenocarcinoma / Metastatic Rectal Adenocarcinoma / Recurrent Colon Adenocarcinoma / Recurrent Colorectal Adenocarcinoma / Recurrent Rectal Adenocarcinoma / Stage III Colon Cancer AJCC v8 / Stage III Colorectal Cancer AJCC v8 / Stage III Rectal Cancer AJCC v8 / Stage IIIA Colon Cancer AJCC v8 / Stage IIIA Colorectal Cancer AJCC v8 / Stage IIIB Colorectal Cancer AJCC v8 / Stage IIIB Rectal Cancer AJCC v8 / Stage IIIC Colon Cancer AJCC v8 / Stage IIIC Colorectal Cancer AJCC v8 / Stage IV Colon Cancer AJCC v8 / Stage IVA Colorectal Cancer AJCC v8 / Stage IVA Rectal Cancer AJCC v8 / Stage IVB Colon Cancer AJCC v8 / Stage IVB Colorectal Cancer AJCC v8 / Stage IVB Rectal Cancer AJCC v8 / Stage IVC Colon Cancer AJCC v8 / Stage IVC Colorectal Cancer AJCC v8 / Stage IVC Rectal Cancer AJCC v8 / Unresectable Colon Adenocarcinoma / Unresectable Colorectal Carcinoma / Unresectable Rectal Adenocarcinoma1
2RecruitingTreatmentAnaplastic (Malignant) Meningioma / Atypical Meningioma / Grade II Meningioma / Grade III Meningioma / Recurrent Meningiomas / Supratentorial Meningioma1
2RecruitingTreatmentAnaplastic Ependymoma / Ependymomas1
2RecruitingTreatmentAnaplastic Thyroid Carcinoma / Malignant Neoplasms of Thyroid and Other Endocrine Glands / Metastatic Thyroid Gland Carcinoma / Poorly Differentiated Thyroid Cancer / Poorly Differentiated Thyroid Gland Carcinoma / Stage IVA Thyroid Gland Anaplastic Carcinoma AJCC v8 / Stage IVB Thyroid Gland Anaplastic Carcinoma AJCC v8 / Stage IVC Thyroid Gland Anaplastic Carcinoma AJCC v8 / Thyroid Gland Anaplastic Carcinoma / Unresectable Thyroid Gland Carcinoma1
2RecruitingTreatmentAppendix Adenocarcinoma / Human Papillomavirus-Related Anal Squamous Cell Carcinoma / Human Papillomavirus-Related Cervical Squamous Cell Carcinoma / Human Papillomavirus-Related Squamous Cell Carcinoma of the Penis / Human Papillomavirus-Related Vulvar Squamous Cell Carcinoma / Malignant Neoplasms of Digestive Organs / Malignant Neoplasms of Lip Oral Cavity and Pharynx / Malignant Neoplasms of Mesothelial and Soft Tissue / Malignant Neoplasms of Respiratory and Intrathoracic Organs / Neuroendocrine Carcinomas / Progressive Neuroendocrine Tumors of pancreatic origin / Recurrent Merkel Cell Carcinoma / Recurrent Nasopharynx Carcinoma / Recurrent Peritoneal Malignant Mesothelioma / Recurrent Pleural Malignant Mesothelioma / Stage III Merkel Cell Carcinoma AJCC v7 / Stage III Nasopharyngeal Carcinoma AJCC v7 / Stage III Pleural Malignant Mesothelioma AJCC v7 / Stage IV Merkel Cell Carcinoma AJCC v7 / Stage IV Nasopharyngeal Carcinoma AJCC v7 / Stage IV Pleural Malignant Mesothelioma AJCC v7 / Stage IVA Nasopharyngeal Carcinoma AJCC v7 / Stage IVB Nasopharyngeal Carcinoma AJCC v7 / Stage IVC Nasopharyngeal Carcinoma AJCC v7 / Vaginal Squamous Cell Carcinoma, Not Otherwise Specified1
2RecruitingTreatmentAstrocytomas1
2RecruitingTreatmentBRAF V600 Wild Type / Clinical Stage IV Cutaneous Melanoma AJCC v8 / Intracranial Melanoma / Metastatic Malignant Neoplasm in the Brain / Metastatic Melanoma / Pathologic Stage IV Cutaneous Melanoma AJCC v8 / Refractory Melanoma1
2RecruitingTreatmentBevacizumab / Lung Cancer Non-Small Cell Cancer (NSCLC) / Sintilimab / Tumors Metastatic to Brain1
2RecruitingTreatmentBevacizumab / Non Squamous Non-small Cell Lung Cancer / Non-Squamous Non-Small Cell Lung Cancer / Tumors Metastatic to Brain1
2RecruitingTreatmentBrain Metastasis / Lung Cancer Non-Small Cell Cancer (NSCLC) / Melanoma1
2RecruitingTreatmentBreast Cancer / Estrogen Receptor Negative / HER2/Neu Negative / Invasive Breast Carcinoma / Progesterone Receptor Negative / Triple-Negative Breast Carcinoma1
2RecruitingTreatmentBreast Cancer / Renal Cell Adenocarcinoma1
2RecruitingTreatmentCancer of Unknown Primary Site1
2RecruitingTreatmentCarcinoma, Breast1
2RecruitingTreatmentCervical Cancer Metastatic / Cervical Cancers / Recurrent Cervical Cancer1
2RecruitingTreatmentCervical Cancers1
2RecruitingTreatmentCollecting Duct Carcinoma (Kidney)1
2RecruitingTreatmentColonic Neoplasms / Neoplasms Metastasis / Neoplasms, Colorectal / Rectal Neoplasms1
2RecruitingTreatmentColorectal Cancers2
2RecruitingTreatmentCancer treatment / Colorectal Cancers / MSI / Resistance, APC1
2RecruitingTreatmentColorectal Cancers / Metastatic Cancers1
2RecruitingTreatmentColorectal Cancers / Neoplasms / Neoplasms, Metastatic1
2RecruitingTreatmentColorectal Cancers / Peritoneal Metastasis1
2RecruitingTreatmentDIPG1
2RecruitingTreatmentDigestive System Neoplasms / Intestinal Neoplasms / Neoplasms, Colorectal / Neoplasms, Gastrointestinal1
2RecruitingTreatmentEGFR Activating Mutation / EGFR Exon 19 Deletion Mutation / EGFR NP_005219.2:p.L858R / EGFR NP_005219.2:p.T790M / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Carcinoma Metastatic in the Brain / Lung Non-Small Cell Carcinoma / Metastatic Malignant Neoplasm in the Brain / Recurrent Non-Small Cell Lung Carcinoma1
2RecruitingTreatmentEGFR Activating Mutation / NSCLC Stage IIIB / NSCLC Stage IV1
2RecruitingTreatmentEGFR Positive Non-small Cell Lung Cancer1
2RecruitingTreatmentEndometrial Cancer1
2RecruitingTreatmentEndometrial Cancer / Uterine Carcinosarcoma1
2RecruitingTreatmentExtranodal NK/T-cell Lymphoma, Nasal Type1
2RecruitingTreatmentFallopian Tube Cancer / Malignant Neoplasms of Female Genital Organs / Ovarian Cancer / Primary Peritoneal Cancer1
2RecruitingTreatmentFallopian Tube Cancer / Malignant Peritoneal Neoplasm / Ovarian Cancer1
2RecruitingTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Carcinoma1
2RecruitingTreatmentFallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
2RecruitingTreatmentFallopian Tube Endometrioid Adenocarcinoma / High Grade Fallopian Tube Serous Adenocarcinoma / High Grade Ovarian Serous Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Platinum-Resistant Ovarian Carcinoma / Primary Peritoneal High Grade Serous Adenocarcinoma / Refractory Fallopian Tube Carcinoma / Refractory Ovarian Carcinoma / Refractory Primary Peritoneal Carcinoma1
2RecruitingTreatmentGBM / Glioblastoma Multiforme (GBM) / Glioblastomas / Malignant Gliomas1
2RecruitingTreatmentGlioblastomas2
2RecruitingTreatmentGlioblastomas / Gliosarcoma1
2RecruitingTreatmentGliomas1
2RecruitingTreatmentHLRCC / Metastatic Papillary RCC / Sporadic Papillary Renal Cell Cancer1
2RecruitingTreatmentHigh Grade Recurrent Glioma and Newly Diagnosed Glioblastoma1
2RecruitingTreatmentHuman Epidermal Growth Factor 2 Negative Carcinoma of Breast / Metastatic Breast Cancer1
2RecruitingTreatmentLiver Metastasis / Lung Metastasis / Rectal Carcinoma1
2RecruitingTreatmentLow Grade Glioma (LGG)1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Neoplasms, Brain1
2RecruitingTreatmentLung Cancer Stage III1
2RecruitingTreatmentMetastatic Colorectal Cancer (MCRC) / MSI1
2RecruitingTreatmentMalignancies / Neoplasms / Tumors1
2RecruitingTreatmentMalignant Neoplasm of Pancreas1
2RecruitingTreatmentMalignant Pleural Effusions1
2RecruitingTreatmentMedulloblastomas1
2RecruitingTreatmentMelanoma2
2RecruitingTreatmentMesothelioma malignant / Mesothelioma, Malignant1
2RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)9
2RecruitingTreatmentMetastatic Gastric Adenocarcinoma1
2RecruitingTreatmentMetastatic Renal Cell Carcinoma1
2RecruitingTreatmentMicrosatellite Stable / Mismatch Repair Protein Proficient / Stage III Colorectal Cancer AJCC v7 / Stage IIIB Colorectal Cancer AJCC v7 / Stage IIIC Colorectal Cancer AJCC v7 / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer AJCC v71
2RecruitingTreatmentNSCLC Stage IV / NSCLC, Recurrent1
2RecruitingTreatmentNasopharyngeal Neoplasms1
2RecruitingTreatmentNeoplasms, Colorectal1
2RecruitingTreatmentCancer treatment / Neoplasms, Colorectal1
2RecruitingTreatmentNeoplasms, Head and Neck1
2RecruitingTreatmentNeoplasms, Ovarian1
2RecruitingTreatmentNeuroblastomas1
2RecruitingTreatmentNeuroendocrine Carcinomas1
2RecruitingTreatmentOvarian Epithelial Cancer1
2RecruitingTreatmentPeritoneal Adhesion1
2RecruitingTreatmentPulmonary Fibrosis1
2RecruitingTreatmentRas-mutated Metastatic Colorectal Cancer1
2RecruitingTreatmentRectal Carcinoma1
2RecruitingTreatmentRecurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2RecruitingTreatmentRecurrent Ovarian Cancer1
2RecruitingTreatmentRecurrent Respiratory Papillomatosis1
2RecruitingTreatmentRhabdomyosarcomas1
2RecruitingTreatmentStage III Esophageal Squamous Cell Carcinoma1
2RecruitingTreatmentStage III-IV or Recurrent Endometrial Cancer1
2RecruitingTreatmentTransitional Cell Carcinoma1
2RecruitingTreatmentMetastatic Lung Adenocarcinoma1
2SuspendedTreatmentGerm Cell Tumors1
2TerminatedTreatmentAge-Related Macular Degeneration (AMD) / AMD / Eye Diseases / Macular Degeneration / Macular Degeneration, Age-related, 10 / Neovascular Age-Related Macular Degeneration / Retinal Degenerations / Retinal Diseases1
2TerminatedTreatmentAdenocarcinoma of the Lung / Bronchioloalveolar Carcinoma / Bronchioloalveolar Lung Carcinoma / Large Cell Lung Carcinoma / Recurrent Non-Small Cell Lung Carcinoma / Stage IV Non-Small Cell Lung Cancer1
2TerminatedTreatmentAdenocarcinoma of the Lung / Lung Cancer Non-Small Cell Cancer (NSCLC)1
2TerminatedTreatmentAdenocarcinomas / Malignant Neoplasm of Colon1
2TerminatedTreatmentAdult Acute Basophilic Leukemia / Adult Acute Eosinophilic Leukemia / Adult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myelomonocytic Leukemia (M4) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Childhood Acute Basophilic Leukemia / Childhood Acute Eosinophilic Leukemia / Childhood Acute Erythroleukemia (M6) / Childhood Acute Megakaryocytic Leukemia (M7) / Childhood Acute Monoblastic Leukemia (M5a) / Childhood Acute Monocytic Leukemia (M5b) / Childhood Acute Myeloblastic Leukemia With Maturation (M2) / Childhood Acute Myeloblastic Leukemia Without Maturation (M1) / Childhood Acute Myelomonocytic Leukemia (M4) / Secondary Acute Myeloid Leukemia (Secondary AML, sAML) / Untreated Adult Acute Myeloid Leukemia / Untreated Childhood Acute Myeloid Leukemia and Other Myeloid Malignancies1
2TerminatedTreatmentAdult Anaplastic Astrocytoma / Adult Anaplastic Ependymoma / Adult Anaplastic Oligodendroglioma / Adult Giant Cell Glioblastoma / Adult Glioblastoma1
2TerminatedTreatmentAdvanced Non Small Cell Lung Cancer1
2TerminatedTreatmentAdvanced Non Small Cell Lung Cancer / Non-Small Cell Lung Cancer Stage IIIB / Stage IIIB or IV Non-Small Cell Lung Cancer1
2TerminatedTreatmentAdvanced Non-squamous NSCLC1
2TerminatedTreatmentAge-Related Macular Degeneration (ARMD)2
2TerminatedTreatmentAgnogenic Myeloid Metaplasia1
2TerminatedTreatmentBiliary Tract Cancer1
2TerminatedTreatmentBlastic Phase Chronic Myelogenous Leukemia / Chronic Myelogenous Leukemia, BCR-ABL1 Positive1
2TerminatedTreatmentBrain Cancer1
2TerminatedTreatmentBreast Cancer8
2TerminatedTreatmentBreast Cancer / Locally Recurrent and Metastatic Breast Cancer / Neoplasms, Breast / Tumors, Breast1
2TerminatedTreatmentBreast Cancer / Ovarian Cancer1
2TerminatedTreatmentCarcinoma NOS / Metastatic Cancers / Neoplasms, Thyroid / Thyroid Cancers1
2TerminatedTreatmentCarcinoma, Colorectal1
2TerminatedTreatmentCervical Cancers / Uterine Malignancies1
2TerminatedTreatmentChoriocarcinoma / Epithelioid Trophoblastic Tumor / Gestational Trophoblastic Neoplasia / Placental Site Trophoblastic Tumor1
2TerminatedTreatmentColorectal Cancers10
2TerminatedTreatmentColorectal Cancers / Metastases2
2TerminatedTreatmentColorectal Cancers / Metastatic Cancers1
2TerminatedTreatmentColorectal Cancers / Neoplasms Metastasis1
2TerminatedTreatmentColorectal Liver Metastases1
2TerminatedTreatmentCystoid Macular Edema / Macular Edema / Melanoma, Uveal / Radiation Maculopathy / Radiation Retinopathy1
2TerminatedTreatmentDiffuse Intrinsic Pontine Glioma (DIPG)1
2TerminatedTreatmentEsophageal Diseases / Neoplasms, Esophageal1
2TerminatedTreatmentFallopian Tube Cancer / Malignant Peritoneal Neoplasm / Ovarian Cancer / Stage 3 Cancer / Stage 4 Cancer1
2TerminatedTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Cancer1
2TerminatedTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Serous Cancer1
2TerminatedTreatmentFallopian Tube Cancer / Ovarian Epithelial Cancer / Primary Peritoneal Cancer1
2TerminatedTreatmentFallopian Tube Carcinoma / Ovarian Carcinoma / Primary Peritoneal Cancer1
2TerminatedTreatmentGlioblastoma Multiforme (GBM)2
2TerminatedTreatmentGlioblastoma Multiforme (GBM) / Gliosarcoma1
2TerminatedTreatmentGlioblastoma Multiforme (GBM) / Gliosarcoma / Malignant Gliomas1
2TerminatedTreatmentGlioblastomas / Gliomas / Gliosarcoma1
2TerminatedTreatmentHER2 Negative Breast Cancer / HER2-Negative Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
2TerminatedTreatmentHepatic Metastases / KRAS Wild Type Colorectal Cancer / Metastatic Colorectal Cancer (MCRC)1
2TerminatedTreatmentHepatic Metastases / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
2TerminatedTreatmentHepatocellular,Carcinoma1
2TerminatedTreatmentHigh-Grade Gliomas1
2TerminatedTreatmentIntracranial Meningioma1
2TerminatedTreatmentKeloid Scars1
2TerminatedTreatmentKidney (Renal Cell) Cancer / Neoplasms, Kidney1
2TerminatedTreatmentLoco-regional Esophageal Cancer1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)10
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Postmenopausal Women1
2TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Stage IIIA (N2)1
2TerminatedTreatmentLung Cancers4
2TerminatedTreatmentLymphoma, B-Cell / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentLymphoma, Hodgkins1
2TerminatedTreatmentMalignant Neoplasm of Colon1
2TerminatedTreatmentMalignant Neoplasm of Pancreas2
2TerminatedTreatmentMalignant Peritoneal Neoplasm / Ovarian Cancer1
2TerminatedTreatmentMelanoma / Metastatic Melanoma1
2TerminatedTreatmentMetastatic Breast Cancer4
2TerminatedTreatmentMetastatic Colon Cancer / Stage IV Rectal Cancer1
2TerminatedTreatmentMetastatic Colorectal Cancer (MCRC)3
2TerminatedTreatmentMetastatic Malignant Melanoma / Unresectable Malignant Melanoma1
2TerminatedTreatmentMetastatic Renal Cell Carcinoma1
2TerminatedTreatmentMultiple Myeloma (MM)1
2TerminatedTreatmentMyelodysplastic Syndromes1
2TerminatedTreatmentNeoplasms1
2TerminatedTreatmentNeoplasms Metastasis / Neoplasms, Breast1
2TerminatedTreatmentNeoplasms, Colorectal5
2TerminatedTreatmentNeoplasms, Colorectal / Neoplasms, Hepatic1
2TerminatedTreatmentNon-Small Cell Lung Cancer Recurrent / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2TerminatedTreatmentNon-Squamous Non-Small Cell Lung Cancer2
2TerminatedTreatmentOvarian Cancer2
2TerminatedTreatmentPancreatic Cancer Metastatic1
2TerminatedTreatmentRectal Carcinoma1
2TerminatedTreatmentRenal Cancers2
2TerminatedTreatmentRenal Cell Adenocarcinoma3
2TerminatedTreatmentSarcomas / Soft Tissue Sarcoma (STS)1
2TerminatedTreatmentTriple Negative Metastatic Breast Cancer1
2Unknown StatusDiagnosticRecurrent Malignant Gliomas1
2Unknown StatusDiagnosticRenal Cancers1
2Unknown StatusPreventionBleb Fibrosis / Bleb Vascularity / Trabeculectomy Failure1
2Unknown StatusPreventionVitreous Hemorrhage Secondary to PDR1
2Unknown StatusTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)2
2Unknown StatusTreatmentBranch Retinal Vein Occlusion1
2Unknown StatusTreatmentBreast Cancer4
2Unknown StatusTreatmentBreast Cancer / Hormone-Sensitive Breast Cancer1
2Unknown StatusTreatmentBreast Cancer / Metastasis1
2Unknown StatusTreatmentColorectal Cancers4
2Unknown StatusTreatmentColorectal Cancers / Hepatic Metastases1
2Unknown StatusTreatmentColorectal Cancers / Metastatic Cancers2
2Unknown StatusTreatmentCorneal Neovascularization1
2Unknown StatusTreatmentDiabetic Macular Edema (DME) / NPDR - Non Proliferative Diabetic Retinopathy / Proliferative Diabetic Retinopathy (PDR)1
2Unknown StatusTreatmentDiabetic Retinopathy (DR) / Macular Edema1
2Unknown StatusTreatmentFibrosarcomas malignant / Fibrous Histiocytoma / Leiomyosarcomas / Liposarcoma / Soft Tissue Sarcoma (STS) / Synovial Sarcoma1
2Unknown StatusTreatmentGliomas1
2Unknown StatusTreatmentHemangiosarcoma / Soft Tissue Sarcoma (STS)1
2Unknown StatusTreatmentHepatocellular,Carcinoma1
2Unknown StatusTreatmentInfiltrating Duct and Lobular Carcinoma In Situ / Inflammatory Breast Carcinoma / Invasive Lobular Breast Carcinoma1
2Unknown StatusTreatmentIntraocular Melanoma1
2Unknown StatusTreatmentLocally Advanced Rectal Adenocarcinoma / Rectal Neoplasms1
2Unknown StatusTreatmentLocally Advanced Rectal Cancer1
2Unknown StatusTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
2Unknown StatusTreatmentLung Cancers2
2Unknown StatusTreatmentLung, Carcinoma1
2Unknown StatusTreatmentMacular Degeneration1
2Unknown StatusTreatmentMalignant Pleural Effusions1
2Unknown StatusTreatmentMetastatic Colorectal Cancer (MCRC)2
2Unknown StatusTreatmentMetastatic Renal Cell Carcinoma1
2Unknown StatusTreatmentNeoplasms, Brain1
2Unknown StatusTreatmentNeoplasms, Colorectal / Neoplasms, Hepatic1
2Unknown StatusTreatmentNeovascular Age-Related Macular Degeneration1
2Unknown StatusTreatmentNeuroendocrine Carcinomas1
2Unknown StatusTreatmentNon-Arteritic Anterior Ischemic Optic Neuropathy1
2Unknown StatusTreatmentOvarian Cancer With Malignant Ascites1
2Unknown StatusTreatmentProstate Cancer1
2Unknown StatusTreatmentRefractory Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
2Unknown StatusTreatmentRenal Cancers1
2Unknown StatusTreatmentRetinovascular Disease1
2Unknown StatusTreatmentUntreated Advanced Non-Small Cell Lung Cancer1
2WithdrawnPreventionAcute Respiratory Distress Syndrome (ARDS) / Severe Sepsis1
2WithdrawnPreventionMalignant Ascites1
2WithdrawnTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
2WithdrawnTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage I Pancreatic Cancer / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer1
2WithdrawnTreatmentAdrenocortical Carcinoma1
2WithdrawnTreatmentAdult Brain Glioblastoma / Recurrent Adult Brain Neoplasm1
2WithdrawnTreatmentB-Cell Chronic Lymphocytic Leukemia / Chronic Lymphocytic Leukemia (CLL) - Refractory1
2WithdrawnTreatmentBreast Cancer1
2WithdrawnTreatmentCervical Cancers1
2WithdrawnTreatmentColon Cancer Liver Metastasis1
2WithdrawnTreatmentColorectal Cancers3
2WithdrawnTreatmentColorectal Cancers / Metastatic Cancers2
2WithdrawnTreatmentColorectal Carcinomatosis1
2WithdrawnTreatmentEndometrial Adenocarcinomas / Endometrial Cancer / Endometrial Clear Cell Adenocarcinoma / Endometrial Serous Adenocarcinoma1
2WithdrawnTreatmentEsophageal Carcinoma1
2WithdrawnTreatmentFallopian Tube Neoplasms / Ovarian Cancer / Primary Peritoneal1
2WithdrawnTreatmentGlioblastoma Multiforme (GBM)1
2WithdrawnTreatmentGlioblastomas1
2WithdrawnTreatmentGlioblastomas / Gliomas1
2WithdrawnTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2WithdrawnTreatmentLung Cancers1
2WithdrawnTreatmentMetastatic Colorectal Cancer (MCRC)2
2WithdrawnTreatmentNeoplasms, Colorectal1
2WithdrawnTreatmentNeoplasms, Head and Neck1
2WithdrawnTreatmentPancreatic Cancer Metastatic1
2WithdrawnTreatmentRectal Cancer Patients1
2WithdrawnTreatmentRenal Cell Adenocarcinoma1
2WithdrawnTreatmentRetinopathy of Prematurity1
2WithdrawnTreatmentSmall Cell Lung Cancer (SCLC)1
2WithdrawnTreatmentUnknown Primary Tumors1
2, 3Active Not RecruitingTreatmentColorectal Cancers1
2, 3CompletedNot AvailableProliferative Diabetic Retinopathy (PDR) / Subfoveal Choroidal Neovascularization / Vascular Vein Oclussion1
2, 3CompletedDiagnosticColorectal Cancers1
2, 3CompletedTreatmentActive Photocoagulated Diabetic Retinopathy / Proliferative Diabetic Retinopathy (PDR) / Severe Nonproliferative1
2, 3CompletedTreatmentAdenocarcinoma of the Lung / Bronchoalveolar Cell Lung Cancer / Large Cell Lung Cancer / Non-Small Cell Lung Cancer Recurrent / Stage IIIb Non-small Cell Lung Cancer / Stage IV Non-Small Cell Lung Cancer1
2, 3CompletedTreatmentBrain Stem Gliomas / Cerebral Astrocytoma / Childhood Cerebellar Anaplastic Astrocytoma / Childhood Cerebral Anaplastic Astrocytoma / Childhood Spinal Cord Neoplasm / Untreated Childhood Brain Stem Glioma / Untreated Childhood Cerebral Astrocytoma1
2, 3CompletedTreatmentColorectal Cancers2
2, 3CompletedTreatmentCorneal Neovascularization1
2, 3CompletedTreatmentDiabetic Macular Edema (DME) / Macular Edema1
2, 3CompletedTreatmentGlaucoma3
2, 3CompletedTreatmentHER2 Positive Breast Cancers / Inflammatory carcinoma of breast stage IV / Inflammatory carcinoma of the breast / Invasive Ductal Breast Carcinoma / Malignant Neoplasm of Female Breast / Mucinous Breast Cancer Stage II / Tubular Breast Cancer Stage II / Tubular Breast Cancer Stage III1
2, 3CompletedTreatmentMacular Degeneration1
2, 3CompletedTreatmentMesothelioma1
2, 3CompletedTreatmentMetastatic Colorectal Cancer (MCRC)1
2, 3CompletedTreatmentNon-Ischemic Central Retinal Vein Occlusion1
2, 3CompletedTreatmentProgression Free Survival1
2, 3CompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
2, 3CompletedTreatmentRecurrent Pterygium1
2, 3CompletedTreatmentSmall Cell Lung Cancer (SCLC)1
2, 3Not Yet RecruitingTreatmentDiabetic Macular Edema (DME)1
2, 3Not Yet RecruitingTreatmentHepatocellular,Carcinoma1
2, 3RecruitingBasic ScienceAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)1
2, 3RecruitingTreatmentAbdominal wall neoplasm / Carcinoma, Colorectal / Colorectal Adenocarcinoma / Colorectal Cancers / Colorectal neoplasms malignant / Colorectal Tumors / Malignant Peritoneal Neoplasm / Metastases to peritoneum / Neoplasms, Colorectal / Peritoneal Carcinomatosis / Peritoneal Diseases / Peritoneal Neoplasm Malignant Secondary / Peritoneal Neoplasm Malignant Secondary Carcinomatosis1
2, 3RecruitingTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)1
2, 3RecruitingTreatmentColorectal neoplasms malignant1
2, 3RecruitingTreatmentCoronavirus Infections1
2, 3RecruitingTreatmentDiabetic Macular Edema (DME)2
2, 3RecruitingTreatmentDisease Free Survival1
2, 3RecruitingTreatmentOesophagogastric Cancer1
2, 3RecruitingTreatmentRefractory Diabetic Macular Edema1
2, 3RecruitingTreatmentRetinal Vein Occlusion2
2, 3RecruitingTreatmentRetinal Vein Occlusion With Macular Edema1
2, 3SuspendedTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Undifferentiated Carcinoma / High Grade Fallopian Tube Serous Adenocarcinoma / High Grade Ovarian Serous Adenocarcinoma / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Undifferentiated Carcinoma / Platinum-Resistant Ovarian Carcinoma / Primary Peritoneal High Grade Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma1
2, 3TerminatedTreatmentAnaplastic Astrocytoma (AA) / Glioblastoma Multiforme (GBM)1
2, 3TerminatedTreatmentCarcinoid tumour of the gastrointestinal tract / Islet Cell Tumor / Lung Cancers / Neoplastic Syndrome / Neuroendocrine Tumors1
2, 3TerminatedTreatmentEpistaxis / Hereditary Haemorrhagic Telangiectasia (HHT)1
2, 3TerminatedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
2, 3Unknown StatusNot AvailableDiabetic Retinopathy (DR) / Macular Edema1
2, 3Unknown StatusTreatmentCentral Serous Chorioretinopathy (CSC)1
2, 3Unknown StatusTreatmentDiabetic Retinopathy (DR)1
2, 3Unknown StatusTreatmentGlaucoma1
2, 3WithdrawnTreatmentCarcinoma, Colorectal / Hepatic Metastases1
3Active Not RecruitingOtherColorectal Cancers1
3Active Not RecruitingTreatmentAbdominal wall neoplasm / Fallopian Tube Cancer / Ovarian Cancer1
3Active Not RecruitingTreatmentAbdominal wall neoplasm / Fallopian Tube Neoplasms / Genital Diseases, Female / Neoplasms, Ovarian / Ovarian Diseases1
3Active Not RecruitingTreatmentAdenocarcinoma of Lung Stage IV / Recurrent Large Cell Lung Carcinoma / Recurrent Lung Adenocarcinoma / Recurrent Squamous Cell Lung Carcinoma / Stage IV Large Cell Lung Carcinoma / Stage IV Squamous Cell Lung Carcinoma1
3Active Not RecruitingTreatmentAdenocarcinoma, Mucinous / Carcinoma, Undifferentiated / Clear Cell Adenocarcinoma / Fallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Fallopian Tube Undifferentiated Carcinoma / Malignant Ovarian Mixed Epithelial Tumor / Ovarian Brenner Tumor / Ovarian Clear Cell Adenocarcinofibroma / Ovarian Endometrioid Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Adenocarcinoma / Ovarian Undifferentiated Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
3Active Not RecruitingTreatmentAdvanced Non Small Cell Lung Cancer1
3Active Not RecruitingTreatmentAdvanced Urothelial Carcinoma / Metastatic Bladder Urothelial Carcinoma / Metastatic Hormone Refractory Prostate Cancer / Metastatic Renal Pelvis Urothelial Carcinoma / Metastatic Ureter Urothelial Carcinoma / Metastatic Urethral Urothelial Carcinoma / Stage IV Bladder Urothelial Carcinoma AJCC v7 / Stage IV Prostate Cancer AJCC v7 / Stage IV Renal Pelvis Cancer AJCC v7 / Stage IV Ureter Cancer AJCC v7 / Stage IV Urethral Cancer AJCC v7 / Unresectable Urothelial Carcinoma / Urothelial carcinoma ureter metastatic1
3Active Not RecruitingTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)1
3Active Not RecruitingTreatmentAge-Related Macular Degeneration (ARMD) / Neovascular Age-Related Macular Degeneration / Wet Macular Degeneration1
3Active Not RecruitingTreatmentAtypical Carcinoid Tumor / Carcinoid Tumors / Colorectal Neuroendocrine Tumor G1 / Gastric Neuroendocrine Tumor G1 / Neuroendocrine Neoplasms1
3Active Not RecruitingTreatmentBorderline Ovarian Mucinous Tumor / Ovarian Mucinous Cystadenocarcinoma / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Stage IA Fallopian Tube Cancer / Stage IA Fallopian Tube Cancer AJCC v6 and v7 / Stage IA Ovarian Cancer / Stage IA Ovarian Cancer AJCC v6 and v7 / Stage IB Fallopian Tube Cancer / Stage IB Fallopian Tube Cancer AJCC v6 and v7 / Stage IB Ovarian Cancer / Stage IB Ovarian Cancer AJCC v6 and v7 / Stage IC Fallopian Tube Cancer / Stage IC Fallopian Tube Cancer AJCC v6 and v7 / Stage IC Ovarian Cancer / Stage IC Ovarian Cancer AJCC v6 and v7 / Stage IIA Fallopian Tube Cancer / Stage IIA Fallopian Tube Cancer AJCC v6 and v7 / Stage IIA Ovarian Cancer / Stage IIA Ovarian Cancer AJCC V6 and v7 / Stage IIB Fallopian Tube Cancer / Stage IIB Fallopian Tube Cancer AJCC v6 and v7 / Stage IIB Ovarian Cancer / Stage IIB Ovarian Cancer AJCC v6 and v7 / Stage IIC Fallopian Tube Cancer / Stage IIC Fallopian Tube Cancer AJCC v6 and v7 / Stage IIC Ovarian Cancer / Stage IIC Ovarian Cancer AJCC v6 and v7 / Stage IIIA Fallopian Tube Cancer / Stage IIIA Fallopian Tube Cancer AJCC v7 / Stage IIIA Ovarian Cancer / Stage IIIA Ovarian Cancer AJCC v6 and v7 / Stage IIIB Fallopian Tube Cancer / Stage IIIB Fallopian Tube Cancer AJCC v7 / Stage IIIB Ovarian Cancer / Stage IIIB Ovarian Cancer AJCC v6 and v7 / Stage IIIC Fallopian Tube Cancer / Stage IIIC Fallopian Tube Cancer AJCC v7 / Stage IIIC Ovarian Cancer / Stage IIIC Ovarian Cancer AJCC v6 and v7 / Stage IV Fallopian Tube Cancer / Stage IV Fallopian Tube Cancer AJCC v6 and v7 / Stage IV Ovarian Cancer / Stage IV Ovarian Cancer AJCC v6 and v71
3Active Not RecruitingTreatmentBreast Adenocarcinoma / Estrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Negative / Male Breast Carcinoma / Stage IA Breast Cancer / Stage IB Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
3Active Not RecruitingTreatmentBreast Cancer2
3Active Not RecruitingTreatmentCarcinoma, Colorectal1
3Active Not RecruitingTreatmentCentral Retinal Vein Occlusion (CRVO)1
3Active Not RecruitingTreatmentCervical Cancers1
3Active Not RecruitingTreatmentChoroidal Subfoveal/Juxtafoveal Neovascularization in High Myopia1
3Active Not RecruitingTreatmentCognition Disorders / Disability Evaluation / Glioblastoma Multiforme (GBM)1
3Active Not RecruitingTreatmentColon Mucinous Adenocarcinoma / Colon Signet Ring Cell Adenocarcinoma / Lynch Syndrome / Stage IIA Colon Cancer / Stage IIA Colon Cancer AJCC v7 / Stage IIB Colon Cancer / Stage IIB Colon Cancer AJCC v7 / Stage IIC Colon Cancer / Stage IIC Colon Cancer AJCC v71
3Active Not RecruitingTreatmentColorectal Cancers3
3Active Not RecruitingTreatmentDiabetic Macular Edema (DME)1
3Active Not RecruitingTreatmentEstrogen Receptor Negative / Estrogen Receptor Positive / HER2/Neu Negative / HER2/Neu Positive / Progesterone Receptor Negative / Progesterone Receptor Positive / Recurrent Breast Carcinoma / Stage IIIC Breast Cancer AJCC v6 / Stage IV Breast Cancer AJCC v6 and v71
3Active Not RecruitingTreatmentEstrogen Receptor Positive / Invasive Breast Carcinoma / One to five years postmenopausal / Progesterone Receptor Positive / Recurrent Breast Carcinoma / Stage III Breast Cancer AJCC v6 / Stage IIIB Breast Cancer / Stage IIIB Breast Cancer AJCC v7 / Stage IV Breast Cancer / Stage IV Breast Cancer AJCC v6 and v71
3Active Not RecruitingTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Cancer1
3Active Not RecruitingTreatmentFallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Ovarian Brenner Tumor / Ovarian Clear Cell Adenocarcinofibroma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Ovarian Undifferentiated Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Stage IIA Fallopian Tube Cancer AJCC v6 and v7 / Stage IIA Ovarian Cancer AJCC V6 and v7 / Stage IIB Fallopian Tube Cancer AJCC v6 and v7 / Stage IIB Ovarian Cancer AJCC v6 and v7 / Stage IIC Fallopian Tube Cancer AJCC v6 and v7 / Stage IIC Ovarian Cancer AJCC v6 and v7 / Stage IIIA Fallopian Tube Cancer AJCC v7 / Stage IIIA Ovarian Cancer AJCC v6 and v7 / Stage IIIA Primary Peritoneal Cancer AJCC v7 / Stage IIIB Fallopian Tube Cancer AJCC v7 / Stage IIIB Ovarian Cancer AJCC v6 and v7 / Stage IIIB Primary Peritoneal Cancer AJCC v7 / Stage IIIC Fallopian Tube Cancer AJCC v7 / Stage IIIC Ovarian Cancer AJCC v6 and v7 / Stage IIIC Primary Peritoneal Cancer AJCC v7 / Stage IV Fallopian Tube Cancer AJCC v6 and v7 / Stage IV Ovarian Cancer AJCC v6 and v7 / Stage IV Primary Peritoneal Cancer AJCC v71
3Active Not RecruitingTreatmentGlaucoma1
3Active Not RecruitingTreatmentHemorrhagic Hereditary Telangiectasia (HHT)1
3Active Not RecruitingTreatmentHepatocellular,Carcinoma1
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)6
3Active Not RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentLung Cancers1
3Active Not RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
3Active Not RecruitingTreatmentNon-Squamous Non-Small Cell Lung Cancer1
3Active Not RecruitingTreatmentOvarian Brenner Tumor / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Seromucinous Carcinoma / Ovarian Serous Cystadenocarcinoma / Ovarian Undifferentiated Carcinoma / Stage IIA Fallopian Tube Cancer AJCC v6 and v7 / Stage IIA Ovarian Cancer AJCC V6 and v7 / Stage IIB Fallopian Tube Cancer AJCC v6 and v7 / Stage IIB Ovarian Cancer AJCC v6 and v7 / Stage IIC Fallopian Tube Cancer AJCC v6 and v7 / Stage IIC Ovarian Cancer AJCC v6 and v7 / Stage IIIA Fallopian Tube Cancer AJCC v7 / Stage IIIA Ovarian Cancer AJCC v6 and v7 / Stage IIIA Primary Peritoneal Cancer AJCC v7 / Stage IIIB Fallopian Tube Cancer AJCC v7 / Stage IIIB Ovarian Cancer AJCC v6 and v7 / Stage IIIB Primary Peritoneal Cancer AJCC v7 / Stage IIIC Fallopian Tube Cancer AJCC v7 / Stage IIIC Ovarian Cancer AJCC v6 and v7 / Stage IIIC Primary Peritoneal Cancer AJCC v71
3Active Not RecruitingTreatmentOvarian Cancer2
3Active Not RecruitingTreatmentRecurrent Glioblastoma1
3Active Not RecruitingTreatmentRecurrent Hypopharyngeal Squamous Cell Carcinoma / Recurrent Laryngeal Squamous Cell Carcinoma / Recurrent Laryngeal Verrucous Carcinoma / Recurrent Lip and Oral Cavity Squamous Cell Carcinoma / Recurrent Metastatic Squamous Cell Carcinoma in the Neck With Occult Primary / Recurrent Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma / Recurrent Oral Cavity Verrucous Carcinoma / Recurrent Oropharyngeal Squamous Cell Carcinoma / Recurrent Salivary Gland Carcinoma / Salivary Gland Squamous Cell Carcinoma / Squamous Cell Carcinoma Metastatic in the Neck With Occult Primary / Stage IV Hypopharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IV Major Salivary Gland Cancer AJCC v7 / Stage IVA Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVA Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVA Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVA Major Salivary Gland Cancer AJCC v7 / Stage IVA Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVA Oral Cavity Cancer AJCC v6 and v7 / Stage IVA Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVB Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVB Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVB Major Salivary Gland Cancer AJCC v7 / Stage IVB Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVB Oral Cavity Cancer AJCC v6 and v7 / Stage IVB Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Laryngeal Squamous Cell Carcinoma AJCC v7 / Stage IVC Laryngeal Verrucous Carcinoma AJCC v7 / Stage IVC Lip and Oral Cavity Squamous Cell Carcinoma AJCC v6 and v7 / Stage IVC Major Salivary Gland Cancer AJCC v7 / Stage IVC Nasal Cavity and Paranasal Sinus Squamous Cell Carcinoma AJCC v7 / Stage IVC Oral Cavity Cancer AJCC v6 and v7 / Stage IVC Oropharyngeal Squamous Cell Carcinoma AJCC v7 / Tongue Carcinoma1
3Active Not RecruitingTreatmentRecurrent Ovarian Cancer1
3Active Not RecruitingTreatmentRecurrent Platinum-sensitive Ovarian Cancer1
3Active Not RecruitingTreatmentRenal Cell Adenocarcinoma1
3Active Not RecruitingTreatmentStage IB Non-Small Cell Lung Carcinoma / Stage IB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIA Non-Small Cell Lung Carcinoma / Stage IIA Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIB Non-Small Cell Lung Carcinoma / Stage IIB Non-Small Cell Lung Carcinoma AJCC v7 / Stage IIIA Non-Small Cell Lung Cancer / Stage IIIA Non-Small Cell Lung Cancer AJCC v71
3CompletedOtherDiabetic Macular Edema (DME)1
3CompletedOtherRectal Adenocarcinoma1
3CompletedPreventionAnti-VEGF / Bevacizumab / Pterygium / VEGF1
3CompletedPreventionCataracts / Cystoid Macular Edema / Diabetes Mellitus1
3CompletedSupportive CareColorectal Cancers / Fevers / Locally Advanced / Malignancies / Malignant Neoplasm of Colon / Metastatic Colorectal Cancer (MCRC) / Neutropenia / Rectal Carcinoma1
3CompletedTreatmentAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Cervical Squamous Cell Carcinoma / Recurrent Cervical Carcinoma / Stage IVB Cervical Cancer1
3CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Metastatic Colon Cancer / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage III Colon Cancer / Stage III Rectal Cancer / Stage IV Rectal Cancer1
3CompletedTreatmentAdenocarcinoma of the Colon / Colon Adenocarcinoma / Stage IIA Colon Cancer / Stage IIA Colon Cancer AJCC v7 / Stage IIB Colon Cancer / Stage IIB Colon Cancer AJCC v7 / Stage IIC Colon Cancer / Stage IIC Colon Cancer AJCC v7 / Stage IIIA Colon Cancer / Stage IIIA Colon Cancer AJCC v7 / Stage IIIB Colon Cancer / Stage IIIB Colon Cancer AJCC v7 / Stage IIIC Colon Cancer / Stage IIIC Colon Cancer AJCC v71
3CompletedTreatmentAdenocarcinoma of the Pancreas / Recurrent Pancreatic Cancer / Stage II Pancreatic Cancer / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
3CompletedTreatmentAdenocarcinoma of the Prostate / Hormone-Resistant Prostate Cancer / Recurrent Prostate Cancer / Stage IV Prostate Cancer1
3CompletedTreatmentAdenocarcinomas1
3CompletedTreatmentAdult Giant Cell Glioblastoma / Adult Glioblastoma / Adult Gliosarcoma / Cognitive Side Effects of Cancer Therapy / Glioblastomas / Gliosarcoma / Supratentorial Glioblastoma1
3CompletedTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)2
3CompletedTreatmentAge-Related Macular Degeneration (ARMD)1
3CompletedTreatmentBranch Retinal Vein Occlusion1
3CompletedTreatmentBreast Cancer11
3CompletedTreatmentBreast Cancer / Colorectal Cancers / Metastases1
3CompletedTreatmentCentral Retinal Vein Occlusion (CRVO)1
3CompletedTreatmentColorectal Cancers17
3CompletedTreatmentColorectal Cancers / Metastases1
3CompletedTreatmentCorneal Newvessels1
3CompletedTreatmentDiabetic Macular Edema (DME)4
3CompletedTreatmentDiabetic Macular Edema (DME) / Diabetic Retinopathy (DR) / Proliferative Diabetic Retinopathy (PDR)1
3CompletedTreatmentDiabetic Retinopathy (DR) / Macular Edema1
3CompletedTreatmentDigestive System Neoplasms / Intestinal Neoplasms / Neoplasms Metastasis / Neoplasms, Colorectal / Neoplasms, Gastrointestinal1
3CompletedTreatmentFallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Cavity Cancer1
3CompletedTreatmentFallopian Tube Clear Cell Adenocarcinoma / Fallopian Tube Endometrioid Adenocarcinoma / Fallopian Tube Mucinous Adenocarcinoma / Fallopian Tube Serous Adenocarcinoma / Fallopian Tube Transitional Cell Carcinoma / Malignant Ovarian Mixed Epithelial Tumor / Ovarian Brenner Tumor / Ovarian Clear Cell Adenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mucinous Adenocarcinoma / Ovarian Serous Adenocarcinoma / Ovarian Transitional Cell Carcinoma / Primary Peritoneal Serous Adenocarcinoma / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer / Undifferentiated Fallopian Tube Carcinoma / Undifferentiated Ovarian Carcinoma1
3CompletedTreatmentGastrointestinal Stromal Tumors1
3CompletedTreatmentGlioblastomas2
3CompletedTreatmentHuman Epidermal Growth Factor 2 Negative Carcinoma of Breast / Metastatic Breast Cancer1
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)5
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
3CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Non-Squamous Non-Small Cell Lung Cancer1
3CompletedTreatmentMacular Edema / Retinal Vein Occlusion1
3CompletedTreatmentMalignant Neoplasm of Pancreas1
3CompletedTreatmentMalignant Neoplasm of Stomach1
3CompletedTreatmentMalignant Pleural Effusions1
3CompletedTreatmentMetastatic Breast Cancer4
3CompletedTreatmentMetastatic Colorectal Cancer (MCRC)5
3CompletedTreatmentMetastatic Non-Small Cell Lung Cancer1
3CompletedTreatmentMultifocal Choroiditis / Serpiginous Choroiditis / Vogt Koyanagi Harada Disease / Vogt-Koyanagi-Harada Disease1
3CompletedTreatmentMyopia / Subfoveal Choroidal Neovascularization1
3CompletedTreatmentNeoplasms, Breast1
3CompletedTreatmentNeoplasms, Colorectal3
3CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer5
3CompletedTreatmentOvarian Cancer3
3CompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
3CompletedTreatmentRenal Cancers1
3CompletedTreatmentRenal Cell Adenocarcinoma2
3CompletedTreatmentRetinal Diseases1
3CompletedTreatmentRetinal Vein Occlusion1
3CompletedTreatmentRetina / Telangiectasias1
3CompletedTreatmentSubfoveal Choroidal Neovascularization1
3CompletedTreatmentTractional Retinal Detachment Secondary to Proliferative Diabetic Retinopathy1
3CompletedTreatmentTumors, Solid1
3Not Yet RecruitingPreventionChemotherapy Induced Peripheral Neuropathy (CIPN) / Chemotherapy-induced Peripheral Neuropathy (CIPN) / Fallopian Tube Cancer / Ovarian Cancer / Primary Peritoneal Carcinoma / Recurrent Ovarian Carcinoma1
3Not Yet RecruitingTreatmentAdvanced Lung Non-Squamous Non-Small Cell Carcinoma / Metastatic Lung Non-Squamous Non-Small Cell Carcinoma / Recurrent Lung Non-Squamous Non-Small Cell Carcinoma / Stage IIIB Lung Cancer AJCC v8 / Stage IIIC Lung Cancer AJCC v8 / Stage IV Lung Cancer AJCC v8 / Stage IVA Lung Cancer AJCC v8 / Stage IVB Lung Cancer AJCC v81
3Not Yet RecruitingTreatmentAdvanced Non-squamous NSCLC1
3Not Yet RecruitingTreatmentCarcinoma NOS / Non-Small-Cell Lung1
3Not Yet RecruitingTreatmentCervical Cancers1
3Not Yet RecruitingTreatmentColorectal Adenocarcinoma1
3Not Yet RecruitingTreatmentColorectal Cancers1
3Not Yet RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)3
3Not Yet RecruitingTreatmentMetastatic Colorectal Cancer (MCRC) / RAS Mutation1
3Not Yet RecruitingTreatmentNon-Squamous Cell Non-small Cell Lung Cancer1
3Not Yet RecruitingTreatmentOvarian Cancer1
3Not Yet RecruitingTreatmentOvarian Epithelial Cancer1
3Not Yet RecruitingTreatmentPatients With Metastatic Colorectal Cancer1
3RecruitingOtherElderly Patients / Metastatic Colorectal Cancer (MCRC) / Quality of Life1
3RecruitingPreventionRecurrent Ovarian Carcinoma1
3RecruitingTreatmentAbdominal wall neoplasm / Fallopian Tube Cancer / Ovarian Cancer1
3RecruitingTreatmentAdenocarcinoma of the Lung1
3RecruitingTreatmentAdvanced Ovarian Cancer1
3RecruitingTreatmentAge-Related Macular Degeneration (ARMD) / Neovascular Age-Related Macular Degeneration / Wet Macular Degeneration1
3RecruitingTreatmentBreast Cancer / HER 2 Negative Breast Cancer / Hormone Receptor Positive Tumor1
3RecruitingTreatmentCarcinoma of the Cervix, Stage IVB1
3RecruitingTreatmentCoats Disease / Retinal Telangiectasis1
3RecruitingTreatmentColorectal Adenocarcinoma1
3RecruitingTreatmentColorectal Cancers2
3RecruitingTreatmentColorectal Cancers / Hepatic Metastases1
3RecruitingTreatmentDigestive System Neoplasms / Intestinal Neoplasms / Neoplasms Metastasis / Neoplasms, Colorectal / Neoplasms, Gastrointestinal1
3RecruitingTreatmentGlioblastomas / Progression / Recurrences1
3RecruitingTreatmentHepatocellular,Carcinoma3
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)2
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
3RecruitingTreatmentLung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Non Small Cell Lung Cancer Metastatic / Non-Small Cell Lung Cancer Recurrent / Recurrent Non Small Cell Lung Cancer1
3RecruitingTreatmentMalignant Neoplasm of Colon / Primary Tumour / Rectal Carcinoma1
3RecruitingTreatmentMetastatic Colorectal Adenocarcinoma / Stage IV Colorectal Cancer AJCC v7 / Stage IVA Colorectal Cancer AJCC v7 / Stage IVB Colorectal Cancer AJCC v71
3RecruitingTreatmentMetastatic Colorectal Cancer (MCRC)5
3RecruitingTreatmentNeoplasms, Colorectal2
3RecruitingTreatmentNon-Squamous Non-Small Cell Lung Cancer2
3RecruitingTreatmentPleural Mesothelioma Malignant Advanced1
3RecruitingTreatmentRectal Carcinoma1
3RecruitingTreatmentRecurrent Ovarian Carcinoma1
3TerminatedOtherAdenocarcinoma of Lung Metastatic to Brain / Bevacizumab / Brain Radiotherapy / Cerebral Metastases / Cerebral Radiotherapy / Lung Cancer Non-Small Cell Cancer (NSCLC) / Metastatic Non-Small Cell Lung Cancer / Non Epidermoid1
3TerminatedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Rectum / Metastatic Colon Cancer / Recurrent Colon Cancer / Recurrent Rectal Cancer / Stage III Colon Cancer / Stage III Rectal Cancer / Stage IV Rectal Cancer1
3TerminatedTreatmentAdenocarcinoma of the Rectum / Stage II Rectal Cancer / Stage III Rectal Cancer1
3TerminatedTreatmentAge-Related Macular Degeneration (ARMD)1
3TerminatedTreatmentBreast Cancer2
3TerminatedTreatmentCarcinoma, Breast / HER2/Neu Positive / Male Breast Carcinoma / Recurrent Breast Carcinoma / Stage IV Breast Cancer1
3TerminatedTreatmentClear Cell Renal Cell Carcinoma / Renal Cell Carcinoma Recurrent / Stage III Renal Cell Cancer / Stage III Renal Cell Cancer AJCC v7 / Stage IV Renal Cell Cancer / Stage IV Renal Cell Cancer AJCC V71
3TerminatedTreatmentCognitive/Functional Effects / Colorectal Cancers / Neurologic toxicity1
3TerminatedTreatmentColorectal Cancers2
3TerminatedTreatmentColorectal Cancers / Hepatic Metastases1
3TerminatedTreatmentFirst Line Metastatic Breast Cancer1
3TerminatedTreatmentLymphoma, B-Cell1
3TerminatedTreatmentMacular Edema / Retinal Vein Occlusion1
3TerminatedTreatmentRecurrent Colon Cancer / Recurrent Rectal Cancer / Stage IVA Colon Cancer / Stage IVA Rectal Cancer / Stage IVB Colon Cancer / Stage IVB Rectal Cancer1
3TerminatedTreatmentRecurrent Uterine Corpus Sarcoma / Stage IIIA Uterine Sarcoma / Stage IIIB Uterine Sarcoma / Stage IIIC Uterine Sarcoma / Stage IVA Uterine Sarcoma / Stage IVB Uterine Sarcoma / Uterine Corpus Leiomyosarcoma1
3TerminatedTreatmentUveitis1
3Unknown StatusNot AvailableCystoid Macular Edema1
3Unknown StatusTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)2
3Unknown StatusTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
3Unknown StatusTreatmentAge-Related Neovascular Macular Degeneration1
3Unknown StatusTreatmentAngioid Streaks / Subfoveal Choroidal Neovascularization1
3Unknown StatusTreatmentBreast Cancer / Cardiac Toxicity / Perioperative/Postoperative Complications1
3Unknown StatusTreatmentChoroidal Neovascularisation / Polypoidal Choroidal Vasculopathy (PCV)1
3Unknown StatusTreatmentColorectal Cancers2
3Unknown StatusTreatmentColorectal Cancers / Neoplasms Metastasis1
3Unknown StatusTreatmentDiabetic Macular Edema (DME)3
3Unknown StatusTreatmentDiabetic Macular Edema (DME) / Type 2 Diabetes Mellitus1
3Unknown StatusTreatmentDiabetic Retinopathy (DR)1
3Unknown StatusTreatmentDiffuse Diabetic Macular Edema1
3Unknown StatusTreatmentInflammatory Reaction / Pterygium1
3Unknown StatusTreatmentMalignant Neoplasm of Colon / Metastatic Colorectal Cancer (MCRC) / Rectal Carcinoma1
3Unknown StatusTreatmentMetastatic Breast Cancer1
3Unknown StatusTreatmentMetastatic Colorectal Cancer (MCRC)2
3Unknown StatusTreatmentNeovascular Age-Related Macular Degeneration2
3Unknown StatusTreatmentNon-squamous Nonsmall Cell Neoplasm of Lung1
3Unknown StatusTreatmentRefractory Glaucoma1
3Unknown StatusTreatmentTelangiectasias1
3WithdrawnTreatmentAge-Related Macular Degeneration (ARMD)1
3WithdrawnTreatmentColorectal Cancers1
3WithdrawnTreatmentRenal Cell Adenocarcinoma2
3WithdrawnTreatmentWet Age-Related Macular Degeneration1
4Active Not RecruitingHealth Services ResearchMalignant Neoplasm of Colon / Unresectable Metastasis Originating in Colonic Cancer1
4Active Not RecruitingTreatmentOvarian Cancer1
4Active Not RecruitingTreatmentRecurrent Pterygium1
4CompletedNot AvailableDiabetic Macular Edema (DME) / Diabetic Retinopathy (DR)1
4CompletedNot AvailableMacular Degeneration1
4CompletedHealth Services ResearchAge-Related Macular Degeneration (ARMD)1
4CompletedOtherEye Diseases / Premature Births / Retinal Diseases / Retinopathy of Prematurity Both Eyes / Type 1 Retinopathy of Prematurity Both Eyes1
4CompletedOtherHER2/Neu-negative Carcinoma of Breast / Hormone Receptor Positive Malignant Neoplasm of Breast / Recurrent Breast Cancer1
4CompletedTreatmentAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)1
4CompletedTreatmentAge-Related Macular Degeneration (ARMD)1
4CompletedTreatmentBreast Cancer2
4CompletedTreatmentColorectal Cancer, Neoplasm Metastasis / Colorectal Cancers1
4CompletedTreatmentColorectal Cancers2
4CompletedTreatmentColorectal Cancers / Neoplasms, Colorectal1
4CompletedTreatmentCorneal Neovascularization1
4CompletedTreatmentDiabetic Macular Edema (DME)5
4CompletedTreatmentDiabetic Macular Edema (DME) / Ischemic Maculopathy1
4CompletedTreatmentDiabetic Retinopathy (DR)1
4CompletedTreatmentDiabetic Traction Retinal Detachment / Proliferative Diabetic Retinopathy (PDR) / Vitreous Hemorrhage1
4CompletedTreatmentFibrosis / Glaucoma / Optic Neuropathies1
4CompletedTreatmentGlaucoma / Iris Neovascularization1
4CompletedTreatmentLung Cancer Non-Small Cell Cancer (NSCLC)1
4CompletedTreatmentMacular Edema1
4CompletedTreatmentMacular Edema Caused by Retinal Vein Occlusion1
4CompletedTreatmentNeoplasms1
4CompletedTreatmentNeoplasms, Colorectal1
4CompletedTreatmentNeovascular Age-Related Macular Degeneration1
4CompletedTreatmentNon-Squamous Non-Small Cell Lung Cancer1
4CompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
4CompletedTreatmentProliferative Diabetic Retinopathy (PDR) / Vitreous Hemorrhage1
4CompletedTreatmentPterygium1
4CompletedTreatmentRetinal Vein Occlusion1
4Enrolling by InvitationTreatmentDiabetic Macular Edema (DME)1
4Not Yet RecruitingTreatmentCorneal Neovascularization1
4Not Yet RecruitingTreatmentPterygium of Conjunctiva and Cornea1
4RecruitingTreatmentBranch Retinal Vein Occlusion With Macular Edema1
4RecruitingTreatmentCataracts / Diabetic Macular Edema (DME)1
4RecruitingTreatmentEpistaxis / Hereditary Haemorrhagic Telangiectasia (HHT)1
4RecruitingTreatmentMacular Edema / Retinal Neovascularization1
4TerminatedTreatmentColorectal Cancers1
4TerminatedTreatmentColorectal Cancers / Neoplasms Metastasis1
4Unknown StatusSupportive CareGlaucoma1
4Unknown StatusTreatmentBleb Vascularity / Conjunctival Scarring1
4Unknown StatusTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema1
4Unknown StatusTreatmentDiabetic Macular Edema (DME) / NPDR - Non Proliferative Diabetic Retinopathy / Proliferative Diabetic Retinopathy (PDR)1
4Unknown StatusTreatmentDiffuse Diabetic Macular Edema1
4Unknown StatusTreatmentGlaucoma1
4Unknown StatusTreatmentLiver Metastasis / Malignant Neoplasm of Stomach1
4Unknown StatusTreatmentMacular Edema1
4WithdrawnTreatmentBreast Cancer2
Not AvailableActive Not RecruitingNot AvailableBreast Cancer / Metastatic1
Not AvailableActive Not RecruitingTreatmentRadiation Necrosis1
Not AvailableCompletedNot AvailableAMD1
Not AvailableCompletedNot AvailableAdenocarcinoma of the Lung1
Not AvailableCompletedNot AvailableBreast Cancer1
Not AvailableCompletedNot AvailableBreast Cancer / Metastatic Breast Cancer1
Not AvailableCompletedNot AvailableCancer, Anal / Malignant Neoplasm of Colon / Neoplasms, Colorectal / Rectal Carcinoma1
Not AvailableCompletedNot AvailableColorectal Cancers6
Not AvailableCompletedNot AvailableColorectal Cancers / Metastasis1
Not AvailableCompletedNot AvailableColorectal Liver Metastases1
Not AvailableCompletedNot AvailableEndothelial Dysfunction / High Blood Pressure (Hypertension) / Malignancies1
Not AvailableCompletedNot AvailableHigh Blood Pressure (Hypertension) / Malignancies1
Not AvailableCompletedNot AvailableIntraocular Pressure1
Not AvailableCompletedNot AvailableLung Cancers2
Not AvailableCompletedNot AvailableMacular Edema1
Not AvailableCompletedNot AvailableMacular Edema / Retinal Vein Occlusion1
Not AvailableCompletedNot AvailableMalignancies1
Not AvailableCompletedNot AvailableMetastatic Colorectal Cancer (MCRC)4
Not AvailableCompletedNot AvailableNeovascular Age-Related Macular Degeneration2
Not AvailableCompletedNot AvailableNon-Squamous Non-Small Cell Lung Cancer1
Not AvailableCompletedNot AvailableNonsquamous Nonsmall Cell Neoplasm of Lung1
Not AvailableCompletedNot AvailableOvarian Cancer2
Not AvailableCompletedNot AvailableOvarian Epithelial Cancer1
Not AvailableCompletedNot AvailablePunctate Inner Choroidopathy1
Not AvailableCompletedNot AvailablePunctate Inner Choroidopathy / Subfoveal Choroidal Neovascularization1
Not AvailableCompletedNot AvailableRecurrent Pterygium1
Not AvailableCompletedNot AvailableRenal Cell Adenocarcinoma4
Not AvailableCompletedNot AvailableRetinopathy of Prematurity1
Not AvailableCompletedBasic ScienceClear Cell Renal Cell Carcinoma1
Not AvailableCompletedBasic ScienceGlioblastomas / Gliomas1
Not AvailableCompletedBasic ScienceProliferative Diabetic Retinopathy (PDR)1
Not AvailableCompletedDiagnosticRecurrent Glioblastoma1
Not AvailableCompletedHealth Services ResearchDiabetic Macular Edema (DME) / Exudative Macular Degeneration1
Not AvailableCompletedTreatmentAcne Rosacea / Herpetic Keratopathy / Lipid Keratopathy / Penetrating Keratoplasty1
Not AvailableCompletedTreatmentAdvanced Non-Squamous Non-Small Cell Lung Cancer1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD)1
Not AvailableCompletedTreatmentAge-Related Macular Degeneration (ARMD) / Central Retinal Vein Occlusion (CRVO) / Diabetic Macular Edema (DME)1
Not AvailableCompletedTreatmentBreast Cancer2
Not AvailableCompletedTreatmentCentral Retinal Vein Occlusion (CRVO) / Macular Edema1
Not AvailableCompletedTreatmentCentral Serous Chorioretinopathy (CSC)1
Not AvailableCompletedTreatmentColonic Neoplasms / Rectal Neoplasms1
Not AvailableCompletedTreatmentColorectal Cancers1
Not AvailableCompletedTreatmentColorectal Cancers / Liver Metastasis1
Not AvailableCompletedTreatmentCorneal Neovascularization1
Not AvailableCompletedTreatmentDiabetic Macular Edema (DME)3
Not AvailableCompletedTreatmentDiabetic Retinopathy (DR)1
Not AvailableCompletedTreatmentDiabetic Retinopathy (DR) / Retinal Detachment1
Not AvailableCompletedTreatmentFallopian Tubes Cancer / Malignant Peritoneal Neoplasm / Ovarian Cancer1
Not AvailableCompletedTreatmentGlaucoma / Neovascular1
Not AvailableCompletedTreatmentLung Cancers1
Not AvailableCompletedTreatmentMacular Edema / Retinal Vein Occlusion1
Not AvailableCompletedTreatmentMalignant Gliomas1
Not AvailableCompletedTreatmentMelanoma, Uveal1
Not AvailableCompletedTreatmentMetastatic Colorectal Cancer (MCRC)1
Not AvailableCompletedTreatmentNeovascular Age-Related Macular Degeneration2
Not AvailableCompletedTreatmentProliferative Diabetic Retinopathy (PDR)1
Not AvailableCompletedTreatmentProliferative Diabetic Retinopathy (PDR) / Vitreous Hemorrhage1
Not AvailableCompletedTreatmentProstate Cancer1
Not AvailableCompletedTreatmentPterygium of the Conjunctiva and Cornea1
Not AvailableNot Yet RecruitingNot AvailableHepatic Metastases / Malignant Neoplasm of Colon / Rectal Carcinoma1
Not AvailableNot Yet RecruitingNot AvailableLung Cancers / Melanoma / Renal Cancers1
Not AvailableNot Yet RecruitingNot AvailableMetastatic Colorectal Cancer (MCRC)1
Not AvailableNot Yet RecruitingDiagnosticGlioma of Brain / Metastatic Melanoma / Neoplasms, Brain / Tumors Metastatic to Brain1
Not AvailableNot Yet RecruitingDiagnosticLung Cancer Non-Small Cell Cancer (NSCLC)1
Not AvailableNot Yet RecruitingTreatmentCataracts / Diabetic Macular Edema (DME)1
Not AvailableNot Yet RecruitingTreatmentRecurrent High-grade Glioma1
Not AvailableRecruitingNot AvailableBreast Cancer1
Not AvailableRecruitingNot AvailableElderly Metastatic Colorectal Cancer Patients1
Not AvailableRecruitingNot AvailableLung Cancer Non-Small Cell Cancer (NSCLC)2
Not AvailableRecruitingNot AvailableMetastatic Colorectal Cancer (MCRC)2
Not AvailableRecruitingNot AvailableMetastatic Colorectal Cancer (MCRC) / Quality of Life1
Not AvailableRecruitingBasic ScienceNeoplasms, Colorectal1
Not AvailableRecruitingTreatment2019 Novel Coronavirus Pneumonia1
Not AvailableRecruitingTreatmentBrain Cancer / Recurrent Brain Neoplasm1
Not AvailableRecruitingTreatmentDiabetic Retinopathy (DR) / Proliferative Diabetic Retinopathy, Pars Plana Vitrectomy, Intravitreal Bevacizumab1
Not AvailableRecruitingTreatmentMetastatic Colorectal Cancer (MCRC)1
Not AvailableRecruitingTreatmentMulti-organ Metastatic Colorectal Cancer1
Not AvailableRecruitingTreatmentRenal Cell Adenocarcinoma1
Not AvailableTemporarily Not AvailableNot AvailableRetinopathy of Prematurity1
Not AvailableTerminatedNot AvailableBreast Cancer2
Not AvailableTerminatedNot AvailableColorectal Cancers / Hepatocellular Cancer / Lung Cancer Non-Small Cell Cancer (NSCLC) / Renal Cell Adenocarcinoma1
Not AvailableTerminatedNot AvailableGlioma Patients1
Not AvailableTerminatedNot AvailableMalignancies1
Not AvailableTerminatedBasic ScienceGlioblastomas1
Not AvailableTerminatedBasic ScienceMacular Degeneration / Regional Blood Flow / Vascular Endothelial Growth Factor1
Not AvailableTerminatedTreatmentDiabetic Macular Edema (DME)1
Not AvailableTerminatedTreatmentMalignant Neoplasm of Colon1
Not AvailableUnknown StatusNot AvailableAge Related Macular Degeneration (ARMD) / Age-Related Macular Degeneration (ARMD)1
Not AvailableUnknown StatusNot AvailableBevacizumab / Breast Cancer / Molecular Targeted Therapy / Neoadjuvant Chemotherapy1
Not AvailableUnknown StatusNot AvailableMetastatic Colorectal Cancer (MCRC)1
Not AvailableUnknown StatusNot AvailableNeovascular Age Related Macular Degeneration / Neovascular Age-Related Macular Degeneration1
Not AvailableUnknown StatusNot AvailableUnspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
Not AvailableUnknown StatusDiagnosticMultiple Myeloma (MM)1
Not AvailableUnknown StatusPreventionDiabetic Retinopathy (DR)1
Not AvailableUnknown StatusTreatmentBreast Cancer1
Not AvailableUnknown StatusTreatmentComplications of Diabetes Mellitus1
Not AvailableUnknown StatusTreatmentDiabetes Complications1
Not AvailableUnknown StatusTreatmentDiabetic Retinopathy With Premacular Hemorrhage1
Not AvailableUnknown StatusTreatmentMacular Edema / Proliferative Diabetic Retinopathy (PDR) / Wet AMD1
Not AvailableUnknown StatusTreatmentPolypoidal Choroidal Vasculopathy (PCV)1
Not AvailableUnknown StatusTreatmentRetinal Detachment / Vitreoretinopathy Proliferative / Vitreoretinopathy, Proliferative1
Not AvailableUnknown StatusTreatmentSubfoveal Choroidal Neovascularization1
Not AvailableWithdrawnBasic ScienceCorneal Neovascularization1
Not AvailableWithdrawnTreatmentAngioid Streaks / Central Serous Chorioretinopathy (CSC) / Multifocal Choroiditis / Myopia / Ocular Histoplasmosis Syndrome / Punctate Inner Choroidopathy (PIC) / Subfoveal Choroidal Neovascularization / Trauma, or Hereditary Eye Diseases1
Not AvailableWithdrawnTreatmentBreast Cancer1
Not AvailableWithdrawnTreatmentMacular Degeneration1
Not AvailableWithdrawnTreatmentMalignant Neoplasm of Pancreas1
Not AvailableWithdrawnTreatmentShock, Septic1

Pharmacoeconomics

Manufacturers
  • Roche Pharmaceuticals
Packagers
  • F Hoffmann-La Roche Ltd.
  • Genentech Inc.
Dosage forms
FormRouteStrength
Injection, solutionIntravenous100 mg/4mL
Injection, solutionIntravenous400 mg/16mL
SolutionIntravenous25 mg
SolutionIntravenous100 mg
SolutionIntravenous400 mg
Prices
Unit descriptionCostUnit
Avastin 400 mg/16ml Solution 16ml Vial2786.78USD vial
Avastin 100 mg/4ml Solution 4ml Vial696.7USD vial
Avastin 100 mg/4 ml vial167.48USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2286330No2008-06-102018-04-03Canada
CA2145985No2003-09-162012-10-28Canada
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
Vascular endothelial growth factor receptor binding
Specific Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of...
Gene Name
VEGFA
Uniprot ID
P15692
Uniprot Name
Vascular endothelial growth factor A
Molecular Weight
27042.205 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  2. Gerber HP, Ferrara N: Pharmacology and pharmacodynamics of bevacizumab as monotherapy or in combination with cytotoxic therapy in preclinical studies. Cancer Res. 2005 Feb 1;65(3):671-80. [PubMed:15705858]
  3. Han K, Peyret T, Marchand M, Quartino A, Gosselin NH, Girish S, Allison DE, Jin J: Population pharmacokinetics of bevacizumab in cancer patients with external validation. Cancer Chemother Pharmacol. 2016 Aug;78(2):341-51. doi: 10.1007/s00280-016-3079-6. Epub 2016 Jun 21. [PubMed:27329360]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]

Drug created on June 13, 2005 07:24 / Updated on April 09, 2020 22:31

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates