You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameBevacizumab
Accession NumberDB00112  (BTD00087, BIOD00087)
TypeBiotech
GroupsApproved, Investigational
DescriptionA recombinant humanized monoclonal IgG1 antibody that binds to and inhibits the biologic activity of human vascular endothelial growth factor (VEGF). Bevacizumab contains human framework regions and the complementarity-determining regions of a murine antibody that binds to VEGF. Bevacizumab is produced in a Chinese Hamster Ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin and has a molecular weight of approximately 149 kilodaltons.
Protein structureDb00112
Related Articles
Protein chemical formulaC6538H10034N1716O2033S44
Protein average weight149000.0 Da
Sequences
>"Bevacizumab light chain"
DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>"Bevacizumab heavy chain"
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY
AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
antiVEGF
Avastin
External Identifiers
  • R-435
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AvastinInjection, solution100 mg/4mLIntravenousGenentech, Inc.2004-02-26Not applicableUs
AvastinInjection, solution400 mg/16mLIntravenousGenentech, Inc.2004-02-26Not applicableUs
AvastinSolution25 mgIntravenousHoffmann La Roche Limited2005-11-02Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII2S9ZZM9Q9V
CAS number216974-75-3
Pharmacology
IndicationAs part of combination therapy for metastatic colorectal cancer and HER2-negative metastatic breast cancer.
Structured Indications Not Available
PharmacodynamicsBevacizumab is an antineoplastic agent and prevents or reduces the formation of blood vessels (angiogenesis) thereby preventing or reducing metatstatic disease progressing. Bevacizumab binds VEGF and prevents vascular endothelial growth and endothelial cell proliferation.
Mechanism of actionBevacizumab contains human framework regions with antigen binding regions of a humanised murine antibody that binds to VEGF. Bevacizumab is produced by recombinant DNA technology in a Chinese hamster ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin and is purified by a process that includes specific viral inactivation and removal steps. Bevacizumab binds VEGF and prevents the interaction of VEGF to its receptors (Flt-1 and KDR) on the surface of endothelial cells. This prevents blood vessel proliferation and in response retardation of metastatic tumor growth occurs.
TargetKindPharmacological actionActionsOrganismUniProt ID
Vascular endothelial growth factor AProteinyesNot AvailableHumanP15692 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Related Articles
AbsorptionNot Available
Volume of distribution

Vd: 46 mL/kg

Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to endothelial cells, or by human antimurine antibody production

Route of eliminationNot Available
Half lifeapproximately 20 days (range: 11–50 days)
Clearance
  • 0.26 L/day [Male patients who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.21 L/day [Female patients who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.25 L/day [Patients with higher tumor burden who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.2 L/day [patients with tumor burdens below the median who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]

Clearance varies by body weight, gender, and tumor burden. Increased clearance observed in men and in patients with higher tumor burden; however, no evidence of reduced efficacy.

ToxicityCategory C in pregnancy. No studies on lactating patients: recommended to discontinue the drug or discontinue lactation. No extensive studies in pediatrics. In geriatrics: increased risk of proteinuria, arterial thromboembolic events, as well as GI bleeding and sepsis among others.
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Bevacizumab Action PathwayDrug actionSMP00420
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
2-(4-Chlorophenyl)-5-QuinoxalinecarboxamideBevacizumab may increase the cardiotoxic activities of 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide.Experimental
2-MethoxyestradiolBevacizumab may increase the cardiotoxic activities of 2-Methoxyestradiol.Investigational
3-MethoxybenzamideBevacizumab may increase the cardiotoxic activities of 3-Methoxybenzamide.Experimental
3,4-Dihydroxybenzoic AcidBevacizumab may increase the cardiotoxic activities of 3,4-Dihydroxybenzoic Acid.Experimental
5,10-Dideazatetrahydrofolic AcidBevacizumab may increase the cardiotoxic activities of 5,10-Dideazatetrahydrofolic Acid.Experimental
7-HydroxystaurosporineBevacizumab may increase the cardiotoxic activities of 7-Hydroxystaurosporine.Experimental
8-azaguanineBevacizumab may increase the cardiotoxic activities of 8-azaguanine.Experimental
9-(2-phosphonylmethoxyethyl)-2,6-diaminopurineBevacizumab may increase the cardiotoxic activities of 9-(2-phosphonylmethoxyethyl)-2,6-diaminopurine.Investigational
AbirateroneBevacizumab may increase the cardiotoxic activities of Abiraterone.Approved
ABT-263Bevacizumab may increase the cardiotoxic activities of ABT-263.Investigational
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Bevacizumab.Approved
AclarubicinBevacizumab may increase the cardiotoxic activities of Aclarubicin.Investigational
ActeosideBevacizumab may increase the cardiotoxic activities of Acteoside.Investigational
AfatinibBevacizumab may increase the cardiotoxic activities of Afatinib.Approved
AfimoxifeneBevacizumab may increase the cardiotoxic activities of Afimoxifene.Investigational
AfliberceptBevacizumab may increase the cardiotoxic activities of Aflibercept.Approved
AlatrofloxacinBevacizumab may increase the cardiotoxic activities of Alatrofloxacin.Withdrawn
AlbendazoleBevacizumab may increase the cardiotoxic activities of Albendazole.Approved, Vet Approved
AldesleukinBevacizumab may increase the cardiotoxic activities of Aldesleukin.Approved
AlemtuzumabBevacizumab may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
AlitretinoinBevacizumab may increase the cardiotoxic activities of Alitretinoin.Approved, Investigational
Alpha-DifluoromethylornithineBevacizumab may increase the cardiotoxic activities of Alpha-Difluoromethylornithine.Experimental
ALT-110The therapeutic efficacy of ALT-110 can be decreased when used in combination with Bevacizumab.Investigational
AltretamineBevacizumab may increase the cardiotoxic activities of Altretamine.Approved
Amg 386Bevacizumab may increase the cardiotoxic activities of Amg 386.Investigational
AminocamptothecinBevacizumab may increase the cardiotoxic activities of Aminocamptothecin.Investigational
AminoglutethimideBevacizumab may increase the cardiotoxic activities of Aminoglutethimide.Approved
Aminolevulinic acidBevacizumab may increase the cardiotoxic activities of Aminolevulinic acid.Approved
AmonafideBevacizumab may increase the cardiotoxic activities of Amonafide.Investigational
AmrubicinBevacizumab may increase the cardiotoxic activities of Amrubicin.Approved, Investigational
AmsacrineBevacizumab may increase the cardiotoxic activities of Amsacrine.Approved
AnagrelideBevacizumab may increase the cardiotoxic activities of Anagrelide.Approved
AnastrozoleBevacizumab may increase the cardiotoxic activities of Anastrozole.Approved, Investigational
AnecortaveBevacizumab may increase the cardiotoxic activities of Anecortave.Investigational
annamycinBevacizumab may increase the cardiotoxic activities of annamycin.Investigational
AnvirzelAnvirzel may decrease the cardiotoxic activities of Bevacizumab.Investigational
AP 12009Bevacizumab may increase the cardiotoxic activities of AP 12009.Investigational
AP24534Bevacizumab may increase the cardiotoxic activities of AP24534.Investigational
ApaziquoneBevacizumab may increase the cardiotoxic activities of Apaziquone.Investigational
Arsenic trioxideBevacizumab may increase the cardiotoxic activities of Arsenic trioxide.Approved, Investigational
ASA404Bevacizumab may increase the cardiotoxic activities of ASA404.Investigational
AsparaginaseBevacizumab may increase the cardiotoxic activities of Asparaginase.Approved
AT-101Bevacizumab may increase the cardiotoxic activities of AT-101.Investigational
AxitinibBevacizumab may increase the cardiotoxic activities of Axitinib.Approved, Investigational
AzacitidineBevacizumab may increase the cardiotoxic activities of Azacitidine.Approved, Investigational
AzathioprineBevacizumab may increase the cardiotoxic activities of Azathioprine.Approved
AZD2171Bevacizumab may increase the cardiotoxic activities of AZD2171.Investigational
Azd4547Bevacizumab may increase the cardiotoxic activities of Azd4547.Investigational
Azelaic AcidBevacizumab may increase the cardiotoxic activities of Azelaic Acid.Approved
BatimastatBevacizumab may increase the cardiotoxic activities of Batimastat.Experimental
BcgThe therapeutic efficacy of Bcg can be decreased when used in combination with Bevacizumab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Belimumab.Approved
BelinostatBevacizumab may increase the cardiotoxic activities of Belinostat.Approved, Investigational
BelotecanBevacizumab may increase the cardiotoxic activities of Belotecan.Investigational
BendamustineBevacizumab may increase the cardiotoxic activities of Bendamustine.Approved, Investigational
BesifloxacinBevacizumab may increase the cardiotoxic activities of Besifloxacin.Approved
Betulinic AcidBevacizumab may increase the cardiotoxic activities of Betulinic Acid.Investigational
BexaroteneBevacizumab may increase the cardiotoxic activities of Bexarotene.Approved, Investigational
Bgj398Bevacizumab may increase the cardiotoxic activities of Bgj398.Investigational
BicalutamideBevacizumab may increase the cardiotoxic activities of Bicalutamide.Approved
BizelesinBevacizumab may increase the cardiotoxic activities of Bizelesin.Investigational
BleomycinBevacizumab may increase the cardiotoxic activities of Bleomycin.Approved
BlinatumomabBevacizumab may increase the cardiotoxic activities of Blinatumomab.Approved
Bmn 673Bevacizumab may increase the cardiotoxic activities of Bmn 673.Investigational
BortezomibBevacizumab may increase the cardiotoxic activities of Bortezomib.Approved, Investigational
BosutinibBevacizumab may increase the cardiotoxic activities of Bosutinib.Approved
Brentuximab vedotinBevacizumab may increase the cardiotoxic activities of Brentuximab vedotin.Approved
BroxuridineBevacizumab may increase the cardiotoxic activities of Broxuridine.Investigational
Bryostatin 1Bevacizumab may increase the cardiotoxic activities of Bryostatin 1.Investigational
BSI-201Bevacizumab may increase the cardiotoxic activities of BSI-201.Investigational
BusulfanBevacizumab may increase the cardiotoxic activities of Busulfan.Approved, Investigational
Buthionine SulfoximineBevacizumab may increase the cardiotoxic activities of Buthionine Sulfoximine.Investigational
CabazitaxelBevacizumab may increase the cardiotoxic activities of Cabazitaxel.Approved
CabergolineBevacizumab may increase the cardiotoxic activities of Cabergoline.Approved
CabozantinibBevacizumab may increase the cardiotoxic activities of Cabozantinib.Approved
CaiBevacizumab may increase the cardiotoxic activities of Cai.Investigational
CalcipotriolBevacizumab may increase the cardiotoxic activities of Calcipotriol.Approved
CamptothecinBevacizumab may increase the cardiotoxic activities of Camptothecin.Experimental
CapecitabineBevacizumab may increase the cardiotoxic activities of Capecitabine.Approved, Investigational
CarboplatinBevacizumab may increase the cardiotoxic activities of Carboplatin.Approved
CarfilzomibBevacizumab may increase the cardiotoxic activities of Carfilzomib.Approved
CarmofurBevacizumab may increase the cardiotoxic activities of Carmofur.Withdrawn
CarmustineBevacizumab may increase the cardiotoxic activities of Carmustine.Approved
CatumaxomabBevacizumab may increase the cardiotoxic activities of Catumaxomab.Investigational
CB1954Bevacizumab may increase the cardiotoxic activities of CB1954.Experimental
CDX-110The therapeutic efficacy of CDX-110 can be decreased when used in combination with Bevacizumab.Investigational
CediranibBevacizumab may increase the cardiotoxic activities of Cediranib.Investigational
CelecoxibBevacizumab may increase the cardiotoxic activities of Celecoxib.Approved, Investigational
CeritinibBevacizumab may increase the cardiotoxic activities of Ceritinib.Approved
CetuximabBevacizumab may increase the cardiotoxic activities of Cetuximab.Approved
ChlorambucilBevacizumab may increase the cardiotoxic activities of Chlorambucil.Approved
ChlorotrianiseneBevacizumab may increase the cardiotoxic activities of Chlorotrianisene.Withdrawn
CinoxacinBevacizumab may increase the cardiotoxic activities of Cinoxacin.Approved, Withdrawn
CiprofloxacinBevacizumab may increase the cardiotoxic activities of Ciprofloxacin.Approved, Investigational
CisplatinBevacizumab may increase the cardiotoxic activities of Cisplatin.Approved
CladribineBevacizumab may increase the cardiotoxic activities of Cladribine.Approved, Investigational
ClofarabineBevacizumab may increase the cardiotoxic activities of Clofarabine.Approved, Investigational
clorarabineBevacizumab may increase the cardiotoxic activities of clorarabine.Investigational
ClozapineThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Clozapine.Approved
ColchicineBevacizumab may increase the cardiotoxic activities of Colchicine.Approved
CordycepinBevacizumab may increase the cardiotoxic activities of Cordycepin.Investigational
CrenolanibBevacizumab may increase the cardiotoxic activities of Crenolanib.Investigational
CrizotinibBevacizumab may increase the cardiotoxic activities of Crizotinib.Approved
CurcuminBevacizumab may increase the cardiotoxic activities of Curcumin.Investigational
CyclophosphamideBevacizumab may increase the cardiotoxic activities of Cyclophosphamide.Approved, Investigational
Cyproterone acetateBevacizumab may increase the cardiotoxic activities of Cyproterone acetate.Approved, Investigational
CytarabineBevacizumab may increase the cardiotoxic activities of Cytarabine.Approved, Investigational
DabrafenibBevacizumab may increase the cardiotoxic activities of Dabrafenib.Approved
DacarbazineBevacizumab may increase the cardiotoxic activities of Dacarbazine.Approved, Investigational
DactinomycinBevacizumab may increase the cardiotoxic activities of Dactinomycin.Approved
DaratumumabBevacizumab may increase the cardiotoxic activities of Daratumumab.Approved
DasatinibBevacizumab may increase the cardiotoxic activities of Dasatinib.Approved, Investigational
DaunorubicinBevacizumab may increase the cardiotoxic activities of Daunorubicin.Approved
DecitabineBevacizumab may increase the cardiotoxic activities of Decitabine.Approved, Investigational
Denileukin diftitoxBevacizumab may increase the cardiotoxic activities of Denileukin diftitox.Approved, Investigational
DeoxyspergualinBevacizumab may increase the cardiotoxic activities of Deoxyspergualin.Investigational
DeslanosideDeslanoside may decrease the cardiotoxic activities of Bevacizumab.Approved
DexamethasoneBevacizumab may increase the cardiotoxic activities of Dexamethasone.Approved, Investigational, Vet Approved
DexrazoxaneBevacizumab may increase the cardiotoxic activities of Dexrazoxane.Approved, Withdrawn
DienogestBevacizumab may increase the cardiotoxic activities of Dienogest.Approved
DiethylstilbestrolBevacizumab may increase the cardiotoxic activities of Diethylstilbestrol.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Bevacizumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Bevacizumab.Approved
DiindolylmethaneBevacizumab may increase the cardiotoxic activities of Diindolylmethane.Investigational
DinutuximabBevacizumab may increase the cardiotoxic activities of Dinutuximab.Approved
DocetaxelBevacizumab may increase the cardiotoxic activities of Docetaxel.Approved, Investigational
DoxifluridineBevacizumab may increase the cardiotoxic activities of Doxifluridine.Investigational
DoxorubicinBevacizumab may increase the cardiotoxic activities of Doxorubicin.Approved, Investigational
EcabetBevacizumab may increase the cardiotoxic activities of Ecabet.Approved, Investigational
efaproxiralBevacizumab may increase the cardiotoxic activities of efaproxiral.Investigational
EflornithineBevacizumab may increase the cardiotoxic activities of Eflornithine.Approved, Withdrawn
EG009Bevacizumab may increase the cardiotoxic activities of EG009.Investigational
ElsamitrucinBevacizumab may increase the cardiotoxic activities of Elsamitrucin.Investigational
EndostatinBevacizumab may increase the cardiotoxic activities of Endostatin.Investigational
EnoxacinBevacizumab may increase the cardiotoxic activities of Enoxacin.Approved
EnrofloxacinBevacizumab may increase the cardiotoxic activities of Enrofloxacin.Vet Approved
EntinostatBevacizumab may increase the cardiotoxic activities of Entinostat.Investigational
EpirubicinBevacizumab may increase the cardiotoxic activities of Epirubicin.Approved
EpofolateBevacizumab may increase the cardiotoxic activities of Epofolate.Investigational
Epothilone BBevacizumab may increase the cardiotoxic activities of Epothilone B.Experimental, Investigational
EribulinBevacizumab may increase the cardiotoxic activities of Eribulin.Approved, Investigational
ErlotinibBevacizumab may increase the cardiotoxic activities of Erlotinib.Approved, Investigational
EstramustineBevacizumab may increase the cardiotoxic activities of Estramustine.Approved
EtanidazoleBevacizumab may increase the cardiotoxic activities of Etanidazole.Investigational
Ethiodized oilBevacizumab may increase the cardiotoxic activities of Ethiodized oil.Approved
Ethyl carbamateBevacizumab may increase the cardiotoxic activities of Ethyl carbamate.Withdrawn
EtoposideBevacizumab may increase the cardiotoxic activities of Etoposide.Approved
EverolimusBevacizumab may increase the cardiotoxic activities of Everolimus.Approved
ExatecanBevacizumab may increase the cardiotoxic activities of Exatecan.Investigational
ExemestaneBevacizumab may increase the cardiotoxic activities of Exemestane.Approved, Investigational
exisulindBevacizumab may increase the cardiotoxic activities of exisulind.Investigational
FenretinideBevacizumab may increase the cardiotoxic activities of Fenretinide.Investigational
FiacitabineBevacizumab may increase the cardiotoxic activities of Fiacitabine.Investigational
FlavopiridolBevacizumab may increase the cardiotoxic activities of Flavopiridol.Experimental, Investigational
FleroxacinBevacizumab may increase the cardiotoxic activities of Fleroxacin.Approved
FloxuridineBevacizumab may increase the cardiotoxic activities of Floxuridine.Approved
FludarabineBevacizumab may increase the cardiotoxic activities of Fludarabine.Approved
FlumequineBevacizumab may increase the cardiotoxic activities of Flumequine.Withdrawn
FluorouracilBevacizumab may increase the cardiotoxic activities of Fluorouracil.Approved
FlutamideBevacizumab may increase the cardiotoxic activities of Flutamide.Approved
FormestaneBevacizumab may increase the cardiotoxic activities of Formestane.Approved, Investigational, Withdrawn
FormycinBevacizumab may increase the cardiotoxic activities of Formycin.Experimental
FotemustineBevacizumab may increase the cardiotoxic activities of Fotemustine.Experimental
FulvestrantBevacizumab may increase the cardiotoxic activities of Fulvestrant.Approved, Investigational
FumagillinBevacizumab may increase the cardiotoxic activities of Fumagillin.Experimental
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Bevacizumab.Investigational
Gallium nitrateBevacizumab may increase the cardiotoxic activities of Gallium nitrate.Approved, Investigational
GarenoxacinBevacizumab may increase the cardiotoxic activities of Garenoxacin.Investigational
GatifloxacinBevacizumab may increase the cardiotoxic activities of Gatifloxacin.Approved, Investigational
GefitinibBevacizumab may increase the cardiotoxic activities of Gefitinib.Approved, Investigational
GeldanamycinBevacizumab may increase the cardiotoxic activities of Geldanamycin.Experimental
GemcitabineBevacizumab may increase the cardiotoxic activities of Gemcitabine.Approved
GemifloxacinBevacizumab may increase the cardiotoxic activities of Gemifloxacin.Approved, Investigational
Gemtuzumab ozogamicinBevacizumab may increase the cardiotoxic activities of Gemtuzumab ozogamicin.Approved, Investigational, Withdrawn
GenisteinBevacizumab may increase the cardiotoxic activities of Genistein.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Bevacizumab.Investigational
Ginsenoside CBevacizumab may increase the cardiotoxic activities of Ginsenoside C.Nutraceutical
GoserelinBevacizumab may increase the cardiotoxic activities of Goserelin.Approved
GrepafloxacinBevacizumab may increase the cardiotoxic activities of Grepafloxacin.Withdrawn
GusperimusBevacizumab may increase the cardiotoxic activities of Gusperimus.Investigational
HadacidinBevacizumab may increase the cardiotoxic activities of Hadacidin.Experimental
HalofuginoneBevacizumab may increase the cardiotoxic activities of Halofuginone.Investigational, Vet Approved
HexestrolBevacizumab may increase the cardiotoxic activities of Hexestrol.Withdrawn
Hydroxyprogesterone caproateBevacizumab may increase the cardiotoxic activities of Hydroxyprogesterone caproate.Approved
HydroxyureaBevacizumab may increase the cardiotoxic activities of Hydroxyurea.Approved
IbrutinibBevacizumab may increase the cardiotoxic activities of Ibrutinib.Approved
IdarubicinBevacizumab may increase the cardiotoxic activities of Idarubicin.Approved
IdelalisibBevacizumab may increase the cardiotoxic activities of Idelalisib.Approved
IfosfamideBevacizumab may increase the cardiotoxic activities of Ifosfamide.Approved
Il 4Bevacizumab may increase the cardiotoxic activities of Il 4.Investigational
ImatinibBevacizumab may increase the cardiotoxic activities of Imatinib.Approved
ImiquimodBevacizumab may increase the cardiotoxic activities of Imiquimod.Approved, Investigational
IndirubinBevacizumab may increase the cardiotoxic activities of Indirubin.Investigational
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Bevacizumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Bevacizumab.Investigational
Interferon beta-1aBevacizumab may increase the cardiotoxic activities of Interferon beta-1a.Approved, Investigational
Interferon beta-1bBevacizumab may increase the cardiotoxic activities of Interferon beta-1b.Approved
IobenguaneBevacizumab may increase the cardiotoxic activities of Iobenguane.Approved
IpilimumabBevacizumab may increase the cardiotoxic activities of Ipilimumab.Approved
IrinotecanThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Irinotecan.Approved, Investigational
IrofulvenBevacizumab may increase the cardiotoxic activities of Irofulven.Investigational
IxabepiloneBevacizumab may increase the cardiotoxic activities of Ixabepilone.Approved, Investigational
IxazomibBevacizumab may increase the cardiotoxic activities of Ixazomib.Approved
KOS-1584Bevacizumab may increase the cardiotoxic activities of KOS-1584.Investigational
L-alanosineBevacizumab may increase the cardiotoxic activities of L-alanosine.Investigational
LanreotideBevacizumab may increase the cardiotoxic activities of Lanreotide.Approved
LapatinibBevacizumab may increase the cardiotoxic activities of Lapatinib.Approved, Investigational
LeflunomideBevacizumab may increase the cardiotoxic activities of Leflunomide.Approved, Investigational
LenalidomideBevacizumab may increase the cardiotoxic activities of Lenalidomide.Approved
LenvatinibBevacizumab may increase the cardiotoxic activities of Lenvatinib.Approved
LetrozoleBevacizumab may increase the cardiotoxic activities of Letrozole.Approved, Investigational
LeuprolideBevacizumab may increase the cardiotoxic activities of Leuprolide.Approved, Investigational
LevofloxacinBevacizumab may increase the cardiotoxic activities of Levofloxacin.Approved, Investigational
LiarozoleBevacizumab may increase the cardiotoxic activities of Liarozole.Investigational
LomefloxacinBevacizumab may increase the cardiotoxic activities of Lomefloxacin.Approved
LomustineBevacizumab may increase the cardiotoxic activities of Lomustine.Approved
LonidamineBevacizumab may increase the cardiotoxic activities of Lonidamine.Approved, Investigational
Ly2801653Bevacizumab may increase the cardiotoxic activities of Ly2801653.Investigational
LycopeneBevacizumab may increase the cardiotoxic activities of Lycopene.Approved
MafosfamideBevacizumab may increase the cardiotoxic activities of Mafosfamide.Investigational
MasitinibBevacizumab may increase the cardiotoxic activities of Masitinib.Vet Approved
MasoprocolBevacizumab may increase the cardiotoxic activities of Masoprocol.Approved
MaxacalcitolBevacizumab may increase the cardiotoxic activities of Maxacalcitol.Approved
MDX-1106Bevacizumab may increase the cardiotoxic activities of MDX-1106.Investigational
MebendazoleBevacizumab may increase the cardiotoxic activities of Mebendazole.Approved, Vet Approved
MechlorethamineBevacizumab may increase the cardiotoxic activities of Mechlorethamine.Approved
MedrogestoneBevacizumab may increase the cardiotoxic activities of Medrogestone.Approved
Medroxyprogesterone acetateBevacizumab may increase the cardiotoxic activities of Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateBevacizumab may increase the cardiotoxic activities of Megestrol acetate.Approved, Vet Approved
MelphalanBevacizumab may increase the cardiotoxic activities of Melphalan.Approved
MequinolBevacizumab may increase the cardiotoxic activities of Mequinol.Approved
MercaptopurineBevacizumab may increase the cardiotoxic activities of Mercaptopurine.Approved
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Bevacizumab.Withdrawn
MethotrexateBevacizumab may increase the cardiotoxic activities of Methotrexate.Approved
Methyl aminolevulinateBevacizumab may increase the cardiotoxic activities of Methyl aminolevulinate.Approved
MethylprednisoloneBevacizumab may increase the cardiotoxic activities of Methylprednisolone.Approved, Vet Approved
MethyltestosteroneBevacizumab may increase the cardiotoxic activities of Methyltestosterone.Approved
MGI-114Bevacizumab may increase the cardiotoxic activities of MGI-114.Investigational
MidostaurinBevacizumab may increase the cardiotoxic activities of Midostaurin.Investigational
MiltefosineBevacizumab may increase the cardiotoxic activities of Miltefosine.Approved
MisonidazoleBevacizumab may increase the cardiotoxic activities of Misonidazole.Investigational
MitoguazoneBevacizumab may increase the cardiotoxic activities of Mitoguazone.Investigational
MitolactolBevacizumab may increase the cardiotoxic activities of Mitolactol.Investigational
MitomycinBevacizumab may increase the cardiotoxic activities of Mitomycin.Approved
MitotaneBevacizumab may increase the cardiotoxic activities of Mitotane.Approved
MitoxantroneBevacizumab may increase the cardiotoxic activities of Mitoxantrone.Approved, Investigational
MizoribineBevacizumab may increase the cardiotoxic activities of Mizoribine.Investigational
MLN576Bevacizumab may increase the cardiotoxic activities of MLN576.Investigational
MolgramostimBevacizumab may increase the cardiotoxic activities of Molgramostim.Investigational
motexafin gadoliniumBevacizumab may increase the cardiotoxic activities of motexafin gadolinium.Investigational
MoxifloxacinBevacizumab may increase the cardiotoxic activities of Moxifloxacin.Approved, Investigational
Mycophenolic acidBevacizumab may increase the cardiotoxic activities of Mycophenolic acid.Approved
Nalidixic AcidBevacizumab may increase the cardiotoxic activities of Nalidixic Acid.Approved
NamitecanBevacizumab may increase the cardiotoxic activities of Namitecan.Investigational
NavitoclaxBevacizumab may increase the cardiotoxic activities of Navitoclax.Investigational
NecitumumabBevacizumab may increase the cardiotoxic activities of Necitumumab.Approved
NelarabineBevacizumab may increase the cardiotoxic activities of Nelarabine.Approved, Investigational
NiguldipineBevacizumab may increase the cardiotoxic activities of Niguldipine.Experimental
NilotinibBevacizumab may increase the cardiotoxic activities of Nilotinib.Approved, Investigational
NilutamideBevacizumab may increase the cardiotoxic activities of Nilutamide.Approved
NimustineBevacizumab may increase the cardiotoxic activities of Nimustine.Investigational
NintedanibBevacizumab may increase the cardiotoxic activities of Nintedanib.Approved
NivolumabBevacizumab may increase the cardiotoxic activities of Nivolumab.Approved
Nk012Bevacizumab may increase the cardiotoxic activities of Nk012.Investigational
nocodazoleBevacizumab may increase the cardiotoxic activities of nocodazole.Experimental
NolatrexedBevacizumab may increase the cardiotoxic activities of Nolatrexed.Investigational
NorfloxacinBevacizumab may increase the cardiotoxic activities of Norfloxacin.Approved
ObinutuzumabBevacizumab may increase the cardiotoxic activities of Obinutuzumab.Approved
OctreotideBevacizumab may increase the cardiotoxic activities of Octreotide.Approved, Investigational
OfatumumabBevacizumab may increase the cardiotoxic activities of Ofatumumab.Approved
OfloxacinBevacizumab may increase the cardiotoxic activities of Ofloxacin.Approved
OlaparibBevacizumab may increase the cardiotoxic activities of Olaparib.Approved
Omacetaxine mepesuccinateBevacizumab may increase the cardiotoxic activities of Omacetaxine mepesuccinate.Approved
OprelvekinBevacizumab may increase the cardiotoxic activities of Oprelvekin.Approved, Investigational
OsimertinibBevacizumab may increase the cardiotoxic activities of Osimertinib.Approved
OuabainOuabain may decrease the cardiotoxic activities of Bevacizumab.Approved
OxaliplatinBevacizumab may increase the cardiotoxic activities of Oxaliplatin.Approved, Investigational
PaclitaxelBevacizumab may increase the cardiotoxic activities of Paclitaxel.Approved, Vet Approved
PalbociclibBevacizumab may increase the cardiotoxic activities of Palbociclib.Approved
PalifosfamideBevacizumab may increase the cardiotoxic activities of Palifosfamide.Investigational
PamidronateBevacizumab may increase the cardiotoxic activities of Pamidronate.Approved
PanitumumabBevacizumab may increase the cardiotoxic activities of Panitumumab.Approved, Investigational
PanobinostatBevacizumab may increase the cardiotoxic activities of Panobinostat.Approved, Investigational
PARP inhibitorBevacizumab may increase the cardiotoxic activities of PARP inhibitor.Investigational
PazopanibBevacizumab may increase the cardiotoxic activities of Pazopanib.Approved
PazufloxacinBevacizumab may increase the cardiotoxic activities of Pazufloxacin.Investigational
PefloxacinBevacizumab may increase the cardiotoxic activities of Pefloxacin.Approved
PegaspargaseBevacizumab may increase the cardiotoxic activities of Pegaspargase.Approved, Investigational
PembrolizumabBevacizumab may increase the cardiotoxic activities of Pembrolizumab.Approved
PemetrexedBevacizumab may increase the cardiotoxic activities of Pemetrexed.Approved, Investigational
PenclomedineBevacizumab may increase the cardiotoxic activities of Penclomedine.Investigational
PentostatinBevacizumab may increase the cardiotoxic activities of Pentostatin.Approved, Investigational
PertuzumabBevacizumab may increase the cardiotoxic activities of Pertuzumab.Approved
Phenylacetic acidBevacizumab may increase the cardiotoxic activities of Phenylacetic acid.Approved
PipobromanBevacizumab may increase the cardiotoxic activities of Pipobroman.Approved
PirarubicinBevacizumab may increase the cardiotoxic activities of Pirarubicin.Investigational
PirfenidoneBevacizumab may increase the cardiotoxic activities of Pirfenidone.Investigational
PirlindoleBevacizumab may increase the cardiotoxic activities of Pirlindole.Approved
PixantroneBevacizumab may increase the cardiotoxic activities of Pixantrone.Investigational
PlevitrexedBevacizumab may increase the cardiotoxic activities of Plevitrexed.Investigational
PlicamycinBevacizumab may increase the cardiotoxic activities of Plicamycin.Approved, Withdrawn
PodofiloxBevacizumab may increase the cardiotoxic activities of Podofilox.Approved
PodophyllinBevacizumab may increase the cardiotoxic activities of Podophyllin.Approved
polyacrylic acidBevacizumab may increase the cardiotoxic activities of polyacrylic acid.Investigational
PomalidomideBevacizumab may increase the cardiotoxic activities of Pomalidomide.Approved
PonatinibBevacizumab may increase the cardiotoxic activities of Ponatinib.Approved
PorfimerBevacizumab may increase the cardiotoxic activities of Porfimer.Approved, Investigational
porfiromycinBevacizumab may increase the cardiotoxic activities of porfiromycin.Investigational
PralatrexateBevacizumab may increase the cardiotoxic activities of Pralatrexate.Approved
PrednimustineBevacizumab may increase the cardiotoxic activities of Prednimustine.Investigational
PrednisoloneBevacizumab may increase the cardiotoxic activities of Prednisolone.Approved, Vet Approved
PrednisoneBevacizumab may increase the cardiotoxic activities of Prednisone.Approved, Vet Approved
ProcarbazineBevacizumab may increase the cardiotoxic activities of Procarbazine.Approved
Purine RibosideBevacizumab may increase the cardiotoxic activities of Purine Riboside.Experimental
PuromycinBevacizumab may increase the cardiotoxic activities of Puromycin.Experimental
PyrazoloacridineBevacizumab may increase the cardiotoxic activities of Pyrazoloacridine.Investigational
Qlt091001Bevacizumab may increase the cardiotoxic activities of Qlt091001.Investigational
QuinacrineBevacizumab may increase the cardiotoxic activities of Quinacrine.Approved
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Bevacizumab.Approved
Radium Ra 223 DichlorideBevacizumab may increase the cardiotoxic activities of Radium Ra 223 Dichloride.Approved, Investigational
RaltitrexedBevacizumab may increase the cardiotoxic activities of Raltitrexed.Approved, Investigational
RamucirumabBevacizumab may increase the cardiotoxic activities of Ramucirumab.Approved, Investigational
RanibizumabBevacizumab may increase the cardiotoxic activities of Ranibizumab.Approved
RanpirnaseBevacizumab may increase the cardiotoxic activities of Ranpirnase.Investigational
RegorafenibBevacizumab may increase the cardiotoxic activities of Regorafenib.Approved
ResveratrolBevacizumab may increase the cardiotoxic activities of Resveratrol.Experimental, Investigational
Rhodamine 6GBevacizumab may increase the cardiotoxic activities of Rhodamine 6G.Experimental
RituximabBevacizumab may increase the cardiotoxic activities of Rituximab.Approved
RomidepsinBevacizumab may increase the cardiotoxic activities of Romidepsin.Approved, Investigational
RomiplostimBevacizumab may increase the cardiotoxic activities of Romiplostim.Approved
RoquinimexBevacizumab may increase the cardiotoxic activities of Roquinimex.Investigational
RubitecanBevacizumab may increase the cardiotoxic activities of Rubitecan.Investigational
RucaparibBevacizumab may increase the cardiotoxic activities of Rucaparib.Investigational
RuxolitinibBevacizumab may increase the cardiotoxic activities of Ruxolitinib.Approved
SalirasibBevacizumab may increase the cardiotoxic activities of Salirasib.Investigational
SaracatinibBevacizumab may increase the cardiotoxic activities of Saracatinib.Investigational
SatraplatinBevacizumab may increase the cardiotoxic activities of Satraplatin.Investigational
SeliciclibBevacizumab may increase the cardiotoxic activities of Seliciclib.Investigational
SemaxanibBevacizumab may increase the cardiotoxic activities of Semaxanib.Investigational
SeocalcitolBevacizumab may increase the cardiotoxic activities of Seocalcitol.Experimental
SiltuximabBevacizumab may increase the cardiotoxic activities of Siltuximab.Approved
SirolimusBevacizumab may increase the cardiotoxic activities of Sirolimus.Approved, Investigational
Sodium phenylbutyrateBevacizumab may increase the cardiotoxic activities of Sodium phenylbutyrate.Approved
SonidegibBevacizumab may increase the cardiotoxic activities of Sonidegib.Approved, Investigational
SonifilanBevacizumab may increase the cardiotoxic activities of Sonifilan.Investigational
SorafenibThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Sorafenib.Approved, Investigational
SparfloxacinBevacizumab may increase the cardiotoxic activities of Sparfloxacin.Approved
Sparfosic acidBevacizumab may increase the cardiotoxic activities of Sparfosic acid.Experimental
SparsomycinBevacizumab may increase the cardiotoxic activities of Sparsomycin.Experimental
squalamineBevacizumab may increase the cardiotoxic activities of squalamine.Investigational
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Bevacizumab.Investigational
SRT501Bevacizumab may increase the cardiotoxic activities of SRT501.Investigational
StreptozocinBevacizumab may increase the cardiotoxic activities of Streptozocin.Approved
SulforaphaneBevacizumab may increase the cardiotoxic activities of Sulforaphane.Investigational
SulindacBevacizumab may increase the cardiotoxic activities of Sulindac.Approved
SunitinibThe risk or severity of adverse effects can be increased when Sunitinib is combined with Bevacizumab.Approved, Investigational
SuraminBevacizumab may increase the cardiotoxic activities of Suramin.Approved
SwainsonineBevacizumab may increase the cardiotoxic activities of Swainsonine.Experimental
TalaporfinBevacizumab may increase the cardiotoxic activities of Talaporfin.Investigational
TamoxifenBevacizumab may increase the cardiotoxic activities of Tamoxifen.Approved
TegafurBevacizumab may increase the cardiotoxic activities of Tegafur.Approved
TemafloxacinBevacizumab may increase the cardiotoxic activities of Temafloxacin.Withdrawn
TemoporfinBevacizumab may increase the cardiotoxic activities of Temoporfin.Approved
TemozolomideBevacizumab may increase the cardiotoxic activities of Temozolomide.Approved, Investigational
TemsirolimusBevacizumab may increase the cardiotoxic activities of Temsirolimus.Approved
TeniposideBevacizumab may increase the cardiotoxic activities of Teniposide.Approved
TestolactoneBevacizumab may increase the cardiotoxic activities of Testolactone.Approved
TetrathiomolybdateBevacizumab may increase the cardiotoxic activities of Tetrathiomolybdate.Investigational
TezacitabineBevacizumab may increase the cardiotoxic activities of Tezacitabine.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Bevacizumab.Investigational
ThalidomideBevacizumab may increase the cardiotoxic activities of Thalidomide.Approved, Investigational, Withdrawn
ThiotepaBevacizumab may increase the cardiotoxic activities of Thiotepa.Approved
ThymalfasinBevacizumab may increase the cardiotoxic activities of Thymalfasin.Approved, Investigational
TiboloneBevacizumab may increase the cardiotoxic activities of Tibolone.Approved
TioguanineBevacizumab may increase the cardiotoxic activities of Tioguanine.Approved
TipifarnibBevacizumab may increase the cardiotoxic activities of Tipifarnib.Investigational
TirapazamineBevacizumab may increase the cardiotoxic activities of Tirapazamine.Investigational
TivozanibBevacizumab may increase the cardiotoxic activities of Tivozanib.Investigational
Tnp 470Bevacizumab may increase the cardiotoxic activities of Tnp 470.Investigational
TopotecanBevacizumab may increase the cardiotoxic activities of Topotecan.Approved, Investigational
ToremifeneBevacizumab may increase the cardiotoxic activities of Toremifene.Approved, Investigational
TositumomabBevacizumab may increase the cardiotoxic activities of Tositumomab.Approved
TrabectedinBevacizumab may increase the cardiotoxic activities of Trabectedin.Approved, Investigational
TrametinibBevacizumab may increase the cardiotoxic activities of Trametinib.Approved
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Bevacizumab.Approved, Investigational
Trastuzumab emtansineBevacizumab may increase the cardiotoxic activities of Trastuzumab emtansine.Approved
TreosulfanBevacizumab may increase the cardiotoxic activities of Treosulfan.Investigational
TretazicarBevacizumab may increase the cardiotoxic activities of Tretazicar.Investigational
TretinoinBevacizumab may increase the cardiotoxic activities of Tretinoin.Approved, Investigational, Nutraceutical
TrifluridineBevacizumab may increase the cardiotoxic activities of Trifluridine.Approved
TrilostaneBevacizumab may increase the cardiotoxic activities of Trilostane.Approved, Investigational, Vet Approved, Withdrawn
TrimetrexateBevacizumab may increase the cardiotoxic activities of Trimetrexate.Approved, Investigational
TriptorelinBevacizumab may increase the cardiotoxic activities of Triptorelin.Approved, Vet Approved
TrofosfamideBevacizumab may increase the cardiotoxic activities of Trofosfamide.Investigational
TrovafloxacinBevacizumab may increase the cardiotoxic activities of Trovafloxacin.Approved, Withdrawn
TroxacitabineBevacizumab may increase the cardiotoxic activities of Troxacitabine.Investigational
TTNPBBevacizumab may increase the cardiotoxic activities of TTNPB.Experimental
TubercidinBevacizumab may increase the cardiotoxic activities of Tubercidin.Experimental
UbenimexBevacizumab may increase the cardiotoxic activities of Ubenimex.Experimental
Uracil mustardBevacizumab may increase the cardiotoxic activities of Uracil mustard.Approved
VadimezanBevacizumab may increase the cardiotoxic activities of Vadimezan.Investigational
Val 083Bevacizumab may increase the cardiotoxic activities of Val 083.Investigational
ValrubicinBevacizumab may increase the cardiotoxic activities of Valrubicin.Approved
VandetanibBevacizumab may increase the cardiotoxic activities of Vandetanib.Approved
VapreotideBevacizumab may increase the cardiotoxic activities of Vapreotide.Approved, Investigational
VeliparibBevacizumab may increase the cardiotoxic activities of Veliparib.Investigational
VemurafenibBevacizumab may increase the cardiotoxic activities of Vemurafenib.Approved
VerteporfinBevacizumab may increase the cardiotoxic activities of Verteporfin.Approved, Investigational
VesnarinoneBevacizumab may increase the cardiotoxic activities of Vesnarinone.Investigational
VinblastineBevacizumab may increase the cardiotoxic activities of Vinblastine.Approved
VincristineBevacizumab may increase the cardiotoxic activities of Vincristine.Approved, Investigational
VindesineBevacizumab may increase the cardiotoxic activities of Vindesine.Approved
VinflunineBevacizumab may increase the cardiotoxic activities of Vinflunine.Approved
VinorelbineBevacizumab may increase the cardiotoxic activities of Vinorelbine.Approved, Investigational
VintafolideBevacizumab may increase the cardiotoxic activities of Vintafolide.Investigational
VismodegibBevacizumab may increase the cardiotoxic activities of Vismodegib.Approved
Vitamin ABevacizumab may increase the cardiotoxic activities of Vitamin A.Approved, Nutraceutical, Vet Approved
VorinostatBevacizumab may increase the cardiotoxic activities of Vorinostat.Approved, Investigational
ZorubicinBevacizumab may increase the cardiotoxic activities of Zorubicin.Experimental
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Velcheti V, Viswanathan A, Govindan R: The proportion of patients with metastatic non-small cell lung cancer potentially eligible for treatment with bevacizumab: a single institutional survey. J Thorac Oncol. 2006 Jun;1(5):501. [PubMed:17409907 ]
  2. Link [Link]
External Links
ATC CodesL01XC07
AHFS Codes
  • 10:00.00
PDB Entries
FDA labelDownload (133 KB)
MSDSNot Available
Pharmacoeconomics
Manufacturers
  • Roche Pharmaceuticals
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous100 mg/4mL
Injection, solutionIntravenous400 mg/16mL
SolutionIntravenous25 mg
Prices
Unit descriptionCostUnit
Avastin 400 mg/16ml Solution 16ml Vial2786.78USD vial
Avastin 100 mg/4ml Solution 4ml Vial696.7USD vial
Avastin 100 mg/4 ml vial167.48USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2145985 No2003-09-162012-10-28Canada
CA2286330 No2008-06-102018-04-03Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Vascular endothelial growth factor receptor binding
Specific Function:
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activ...
Gene Name:
VEGFA
Uniprot ID:
P15692
Molecular Weight:
27042.205 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Gerber HP, Ferrara N: Pharmacology and pharmacodynamics of bevacizumab as monotherapy or in combination with cytotoxic therapy in preclinical studies. Cancer Res. 2005 Feb 1;65(3):671-80. [PubMed:15705858 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23