D(3) dopamine receptor

Details

Name
D(3) dopamine receptor
Synonyms
  • Dopamine D3 receptor
Gene Name
DRD3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0001159|D(3) dopamine receptor
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Number of residues
400
Molecular Weight
44224.335
Theoretical pI
9.07
GO Classification
Functions
dopamine binding / dopamine neurotransmitter receptor activity, coupled via Gi/Go / drug binding / G-protein coupled amine receptor activity
Processes
acid secretion / adenylate cyclase-activating dopamine receptor signaling pathway / adenylate cyclase-inhibiting dopamine receptor signaling pathway / arachidonic acid secretion / behavioral response to cocaine / cellular calcium ion homeostasis / circadian regulation of gene expression / dopamine metabolic process / G-protein coupled receptor internalization / G-protein coupled receptor signaling pathway / gastric emptying / learning / learning or memory / locomotory behavior / musculoskeletal movement, spinal reflex action / negative regulation of adenylate cyclase activity / negative regulation of blood pressure / negative regulation of dopamine receptor signaling pathway / negative regulation of oligodendrocyte differentiation / negative regulation of protein kinase B signaling / negative regulation of protein secretion / negative regulation of sodium / negative regulation of transcription from RNA polymerase II promoter / positive regulation of cell proliferation / positive regulation of cytokinesis / positive regulation of dopamine receptor signaling pathway / positive regulation of mitotic nuclear division / positive regulation of renal sodium excretion / positive regulation of transcription from RNA polymerase II promoter / prepulse inhibition / regulation of blood volume by renin-angiotensin / regulation of cAMP metabolic process / regulation of circadian sleep/wake cycle, sleep / regulation of dopamine secretion / regulation of dopamine uptake involved in synaptic transmission / regulation of lipid metabolic process / regulation of locomotion involved in locomotory behavior / regulation of multicellular organism growth / response to amphetamine / response to cocaine / response to drug / response to histamine / response to morphine / sensory perception of chemical stimulus / social behavior / synaptic transmission / synaptic transmission, dopaminergic / visual learning
Components
apical part of cell / cell projection / endocytic vesicle / integral component of plasma membrane / plasma membrane
General Function
G-protein coupled amine receptor activity
Specific Function
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
Pfam Domain Function
Transmembrane Regions
33-55 66-88 105-126 150-170 188-212 330-351 367-388
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0021269|D(3) dopamine receptor (DRD3)
ATGGCATCTCTGAGCCAGCTGAGTGGCCACCTGAACTACACCTGTGGGGCAGAGAACTCC
ACAGGTGCCAGCCAGGCCCGCCCACATGCCTACTATGCCCTCTCCTACTGCGCGCTCATC
CTGGCCATCGTCTTCGGCAATGGCCTGGTGTGCATGGCTGTGCTGAAGGAGCGGGCCCTG
CAGACTACCACCAACTACTTAGTAGTGAGCCTGGCTGTGGCAGACTTGCTGGTGGCCACC
TTGGTGATGCCCTGGGTGGTATACCTGGAGGTGACAGGTGGAGTCTGGAATTTCAGCCGC
ATTTGCTGTGATGTTTTTGTCACCCTGGATGTCATGATGTGTACAGCCAGCATCCTTAAT
CTCTGTGCCATCAGCATAGACAGGTACACTGCAGTGGTCATGCCCGTTCACTACCAGCAT
GGCACGGGACAGAGCTCCTGTCGGCGCGTGGCCCTCATGATCACGGCCGTCTGGGTACTG
GCCTTTGCTGTGTCCTGCCCTCTTCTGTTTGGCTTTAATACCACAGGGGACCCCACTGTC
TGCTCCATCTCCAACCCTGATTTTGTCATCTACTCTTCAGTGGTGTCCTTCTACCTGCCC
TTTGGAGTGACTGTCCTTGTCTATGCCAGAATCTATGTGGTGCTGAAACAAAGGAGACGG
AAAAGGATCCTCACTCGACAGAACAGTCAGTGCAACAGTGTCAGGCCTGGCTTCCCCCAA
CAAACCCTCTCTCCTGACCCGGCACATCTGGAGCTGAAGCGTTACTACAGCATCTGCCAG
GACACTGCCTTGGGTGGACCAGGCTTCCAAGAAAGAGGAGGAGAGTTGAAAAGAGAGGAG
AAGACTCGGAATTCCCTGAGTCCCACCATAGCGCCCAAGCTCAGCTTAGAAGTTCGAAAA
CTCAGCAATGGCAGATTATCGACATCTTTGAAGCTGGGGCCCCTGCAACCTCGGGGAGTG
CCACTTCGGGAGAAGAAGGCAACCCAAATGGTGGCCATTGTGCTTGGGGCCTTCATTGTC
TGCTGGCTGCCCTTCTTCTTGACCCATGTTCTCAATACCCACTGCCAGACATGCCACGTG
TCCCCAGAGCTTTACAGTGCCACGACATGGCTGGGCTACGTGAATAGCGCCCTCAACCCT
GTGATCTATACCACCTTCAATATCGAGTTCCGGAAAGCCTTCCTCAAGATCCTGTCTTGC
TGA
Chromosome Location
3
Locus
3q13.3
External Identifiers
ResourceLink
UniProtKB IDP35462
UniProtKB Entry NameDRD3_HUMAN
GenBank Protein ID927342
GenBank Gene IDU32499
GenAtlas IDDRD3
HGNC IDHGNC:3024
General References
  1. Giros B, Martres MP, Sokoloff P, Schwartz JC: [Gene cloning of human dopaminergic D3 receptor and identification of its chromosome]. C R Acad Sci III. 1990;311(13):501-8. [PubMed:2129115]
  2. Schmauss C, Haroutunian V, Davis KL, Davidson M: Selective loss of dopamine D3-type receptor mRNA expression in parietal and motor cortices of patients with chronic schizophrenia. Proc Natl Acad Sci U S A. 1993 Oct 1;90(19):8942-6. [PubMed:8415635]
  3. Liu K, Bergson C, Levenson R, Schmauss C: On the origin of mRNA encoding the truncated dopamine D3-type receptor D3nf and detection of D3nf-like immunoreactivity in human brain. J Biol Chem. 1994 Nov 18;269(46):29220-6. [PubMed:7961889]
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Basile M, Lin R, Kabbani N, Karpa K, Kilimann M, Simpson I, Kester M: Paralemmin interacts with D3 dopamine receptors: implications for membrane localization and cAMP signaling. Arch Biochem Biophys. 2006 Feb 1;446(1):60-8. Epub 2005 Dec 1. [PubMed:16386234]
  7. Villar VA, Jones JE, Armando I, Palmes-Saloma C, Yu P, Pascua AM, Keever L, Arnaldo FB, Wang Z, Luo Y, Felder RA, Jose PA: G protein-coupled receptor kinase 4 (GRK4) regulates the phosphorylation and function of the dopamine D3 receptor. J Biol Chem. 2009 Aug 7;284(32):21425-34. doi: 10.1074/jbc.M109.003665. Epub 2009 Jun 11. [PubMed:19520868]
  8. Chien EY, Liu W, Zhao Q, Katritch V, Han GW, Hanson MA, Shi L, Newman AH, Javitch JA, Cherezov V, Stevens RC: Structure of the human dopamine D3 receptor in complex with a D2/D3 selective antagonist. Science. 2010 Nov 19;330(6007):1091-5. doi: 10.1126/science.1197410. [PubMed:21097933]
  9. Chen CH, Liu MY, Wei FC, Koong FJ, Hwu HG, Hsiao KJ: Further evidence of no association between Ser9Gly polymorphism of dopamine D3 receptor gene and schizophrenia. Am J Med Genet. 1997 Feb 21;74(1):40-3. [PubMed:9034004]
  10. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209]
  11. Lucotte G, Lagarde JP, Funalot B, Sokoloff P: Linkage with the Ser9Gly DRD3 polymorphism in essential tremor families. Clin Genet. 2006 May;69(5):437-40. [PubMed:16650084]
  12. Jeanneteau F, Funalot B, Jankovic J, Deng H, Lagarde JP, Lucotte G, Sokoloff P: A functional variant of the dopamine D3 receptor is associated with risk and age-at-onset of essential tremor. Proc Natl Acad Sci U S A. 2006 Jul 11;103(28):10753-8. Epub 2006 Jun 29. [PubMed:16809426]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00246ZiprasidoneapprovedunknownantagonistDetails
DB00268Ropiniroleapproved, investigationalyesagonistDetails
DB00413Pramipexoleapproved, investigationalyesagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB01239Chlorprothixeneapproved, experimental, investigational, withdrawnyesantagonistDetails
DB00714Apomorphineapproved, investigationalyesagonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB12061PardoprunoxinvestigationalunknownDetails
DB05766ACP-104investigationalunknownDetails
DB06016Cariprazineapproved, investigationalyesagonistpartial agonistDetails
DB06216AsenapineapprovedunknownantagonistDetails
DB06477SumaniroleinvestigationalunknownDetails
DB06288Amisulprideapproved, investigationalunknownantagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnyesagonistDetails
DB01200Bromocriptineapproved, investigationalyesagonistDetails
DB00589Lisurideapproved, investigationalyesagonistDetails
DB00248CabergolineapprovedunknownagonistDetails
DB05271RotigotineapprovedyesagonistDetails
DB00502Haloperidolapprovedunknowninverse agonistDetails
DB01267PaliperidoneapprovedyesantagonistDetails
DB00734Risperidoneapproved, investigationalunknownantagonistDetails
DB00363ClozapineapprovedunknownantagonistDetails
DB01238Aripiprazoleapproved, investigationalunknownantagonistpartial agonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB00409Remoxiprideapproved, withdrawnunknownantagonistDetails
DB01392Yohimbineapproved, investigational, vet_approvedunknownantagonistDetails
DB00391Sulpirideapproved, investigationalunknownantagonistDetails
DB00988DopamineapprovedyesagonistDetails
DB01235LevodopaapprovedyesagonistDetails
DB01100PimozideapprovedyesantagonistDetails
DB01184Domperidoneapproved, investigational, vet_approvedyesantagonistDetails
DB04946IloperidoneapprovedunknownantagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00543AmoxapineapprovedunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownbinderDetails
DB09014CaptodiameexperimentalyesagonistDetails
DB09207AS-8112experimentalunknownantagonistDetails
DB13025TiaprideinvestigationalyesblockerDetails
DB12478PiribedilinvestigationalunknownDetails
DB06454SarizotaninvestigationalunknownligandDetails
DB09223BlonanserininvestigationalyesantagonistDetails
DB09286PipamperoneinvestigationalunknownDetails
DB11274Dihydro-alpha-ergocryptineapprovedyespartial agonistDetails
DB09289TianeptineinvestigationalunknownagonistDetails
DB14185Aripiprazole lauroxilapproved, investigationalunknownDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11275EpicriptineapprovedyesagonistDetails