Sodium channel protein type 7 subunit alpha

Details

Name
Sodium channel protein type 7 subunit alpha
Synonyms
  • Putative voltage-gated sodium channel subunit alpha Nax
  • SCN6A
  • Sodium channel protein cardiac and skeletal muscle subunit alpha
  • Sodium channel protein type VII subunit alpha
Gene Name
SCN7A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017554|Sodium channel protein type 7 subunit alpha
MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEEDLKPTPDLEVGKKLPFIYGNLSQG
MVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRRTTIKVLVHPFF
QLFILISVLIDCVFMSLTNLPKWRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPW
NWLDFSVTVFEVIIRYSPLDFIPTLQTARTLRILKIIPLNQGLKSLVGVLIHCLKQLIGV
IILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEG
ERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYH
QILYASGKVYMIFFVVVSFLFSFYMASLFLGILAMAYEEEKQRVGEISKKIEPKFQQTGK
ELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFAK
TFLIWNCSPCWLKLKEFVHRIIMAPFTDLFLIICIILNVCFLTLEHYPMSKQTNTLLNIG
NLVFIGIFTAEMIFKIIAMHPYGYFQVGWNIFDSMIVFHGLIELCLANVAGMALLRLFRM
LRIFKLGKYWPTFQILMWSLSNSWVALKDLVLLLFTFIFFSAAFGMKLFGKNYEEFVCHI
DKDCQLPRWHMHDFFHSFLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNLLV
LYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKTQNVPKDTMDH
VNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIAS
GESDIENLDNKEIQSKSGDGGSKEKIKQSSSSECSTVDIAISEEEEMFYGGERSKHLKNG
CRRGSSLGQISGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYMDQ
RKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTR
EELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLVCLMIWLIFSIMGVDLF
AGRFYECIDPTSGERFPSSEVMNKSRCESLLFNESMLWENAKMNFDNVGNGFLSLLQVAT
FNGWITIMNSAIDSVAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLITVIIDNFNKHK
IKLGGSNIFITVKQRKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQAFNVIVMVL
ICFQAIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKLIAFRCFYFTIAWNIFDFM
VVIFSITGLCLPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPKVFHNLMLPLMLSLPAL
LNIILLIFLVMFIYAVFGMYNFAYVKKEAGINDVSNFETFGNSMLCLFQVAIFAGWDGML
DAIFNSKWSDCDPDKINPGTQVRGDCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLN
IASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLI
ALDLPMAVGDRIHCLDILLAFTKRVMGQDVRMEKVVSEIESGFLLANPFKITCEPITTTL
KRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATKEGAYFDKAKEKSPIQS
QI
Number of residues
1682
Molecular Weight
193491.605
Theoretical pI
Not Available
GO Classification
Functions
voltage-gated ion channel activity / voltage-gated sodium channel activity
Processes
membrane depolarization during action potential / muscle contraction / neuronal action potential / regulation of ion transmembrane transport / sodium ion homeostasis / sodium ion transport
Components
glial cell projection / plasma membrane / voltage-gated sodium channel complex
General Function
Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient.
Specific Function
Voltage-gated ion channel activity
Pfam Domain Function
Transmembrane Regions
119-137 145-165 180-197 204-220 240-259 371-391 506-524 536-555 570-589 592-609 626-644 708-727 936-953 967-985 1000-1018 1022-1040 1058-1077 1168-1189 1253-1270 1282-1300 1313-1330 1344-1360 1380-1397 1473-1495
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017555|Sodium channel protein type 7 subunit alpha (SCN7A)
ATGTTGGCTTCACCAGAACCTAAGGGCCTTGTTCCCTTCACTAAAGAGTCTTTTGAACTT
ATAAAACAGCATATTGCTAAAACACATAATGAAGACCATGAAGAAGAAGACTTAAAGCCA
ACTCCTGATTTGGAAGTTGGCAAAAAGCTTCCATTTATTTATGGAAACCTTTCTCAAGGA
ATGGTGTCAGAGCCCTTGGAAGATGTGGACCCATATTACTACAAGAAAAAAAATACTTTC
ATAGTATTAAATAAAAATAGAACAATCTTCAGATTCAATGCGGCTTCCATCTTGTGTACA
TTGTCTCCTTTCAATTGTATTAGAAGAACAACTATCAAGGTTTTGGTACATCCCTTTTTC
CAACTGTTTATTCTAATTAGTGTCCTGATTGATTGCGTATTCATGTCCCTGACTAATTTG
CCAAAATGGAGACCAGTATTAGAGAATACTTTGCTTGGAATTTACACATTTGAAATACTT
GTAAAACTCTTTGCAAGAGGTGTCTGGGCAGGATCATTTTCCTTCCTCGGTGATCCATGG
AACTGGCTCGATTTCAGCGTAACTGTGTTTGAGGTTATTATAAGATACTCACCTCTGGAC
TTCATTCCAACGCTTCAAACTGCAAGAACTTTGAGAATTTTAAAAATTATTCCTTTAAAT
CAAGGTCTGAAATCCCTTGTAGGGGTCCTGATCCACTGCTTGAAGCAGCTTATTGGTGTC
ATTATCCTAACTCTGTTTTTTCTGAGCATATTTTCTCTAATTGGGATGGGGCTCTTCATG
GGCAACTTGAAACATAAATGTTTTCGATGGCCCCAAGAGAATGAAAATGAAACCCTGCAC
AACAGAACTGGAAACCCATATTATATTCGAGAAACAGAAAACTTTTATTATTTGGAAGGA
GAAAGATATGCTCTCCTTTGTGGCAACAGGACAGATGCTGGTCAGTGTCCTGAAGGATAT
GTGTGTGTAAAAGCTGGCATAAATCCTGATCAAGGCTTCACAAATTTTGACAGTTTTGGC
TGGGCCTTATTTGCCCTATTTCGGTTAATGGCTCAGGATTACCCTGAAGTACTTTATCAC
CAGATACTTTATGCTTCTGGGAAGGTCTACATGATATTTTTTGTGGTGGTAAGTTTTTTG
TTTTCCTTTTATATGGCAAGTTTGTTCTTAGGCATACTTGCCATGGCCTATGAAGAAGAA
AAGCAGAGAGTTGGTGAAATATCTAAGAAGATTGAACCAAAATTTCAACAGACTGGAAAA
GAACTTCAAGAAGGAAATGAAACAGATGAGGCCAAGACCATACAAATAGAAATGAAGAAA
AGGTCACCAATTTCCACAGACACATCATTGGATGTGTTGGAAGATGCTACTCTCAGACAT
AAGGAAGAACTTGAAAAATCCAAGAAGATATGCCCATTATACTGGTATAAGTTTGCTAAA
ACTTTCTTGATCTGGAATTGTTCTCCCTGTTGGTTAAAATTGAAAGAGTTTGTCCATAGG
ATTATAATGGCACCATTTACTGATCTTTTCCTTATCATATGCATAATTTTAAACGTATGT
TTTCTGACCTTGGAGCATTATCCAATGAGTAAACAAACTAACACTCTTCTCAACATTGGA
AACCTGGTTTTCATTGGAATTTTCACAGCAGAAATGATTTTTAAAATAATTGCAATGCAT
CCATATGGGTATTTCCAAGTAGGTTGGAACATTTTTGATAGCATGATAGTGTTCCATGGT
TTAATAGAACTTTGTCTAGCAAATGTTGCAGGAATGGCTCTTCTTCGATTATTCAGGATG
TTAAGAATTTTCAAGTTGGGAAAGTATTGGCCAACATTCCAGATTTTGATGTGGTCTCTT
AGTAACTCATGGGTGGCCCTGAAAGACTTGGTCCTGTTGTTGTTCACATTCATCTTCTTT
TCTGCTGCATTCGGCATGAAGCTGTTTGGTAAGAATTATGAAGAATTTGTCTGCCACATA
GACAAAGACTGTCAACTCCCACGCTGGCACATGCATGACTTTTTCCACTCCTTCCTGAAT
GTGTTCCGAATTCTCTGTGGAGAGTGGGTAGAGACCTTGTGGGACTGTATGGAGGTTGCA
GGCCAATCCTGGTGTATTCCTTTTTACCTGATGGTCATTTTAATTGGAAATTTACTGGTA
CTTTACCTGTTTCTGGCATTGGTGAGCTCATTTAGTTCATGCAAGGATGTAACAGCTGAA
GAGAATAATGAAGCAAAAAATCTCCAGCTTGCAGTGGCAAGAATTAAAAAAGGAATAAAC
TATGTGCTTCTTAAAATACTATGCAAAACACAAAATGTCCCAAAGGACACAATGGACCAT
GTAAATGAGGTATATGTTAAAGAAGATATTTCTGACCATACCCTTTCTGAATTGAGCAAC
ACCCAAGATTTTCTCAAAGATAAGGAAAAAAGCAGTGGCACAGAGAAAAACGCTACTGAA
AATGAGAGCCAATCACTTATCCCCAGTCCTAGTGTCTCAGAAACTGTACCAATTGCTTCA
GGAGAATCTGATATAGAAAATCTGGATAATAAGGAGATTCAGAGTAAGTCTGGTGATGGA
GGCAGCAAAGAGAAAATAAAGCAATCTAGCTCATCTGAATGCAGTACTGTTGATATTGCT
ATCTCTGAAGAAGAAGAAATGTTCTATGGAGGTGAAAGATCAAAGCATCTGAAAAATGGT
TGCAGACGCGGATCTTCACTTGGTCAAATCAGTGGAGCATCCAAGAAAGGAAAAATCTGG
CAGAACATCAGGAAAACCTGCTGCAAGATTGTAGAGAACAATTGGTTTAAGTGTTTTATT
GGGCTTGTTACTCTGCTCAGCACTGGCACTCTGGCTTTTGAAGATATATATATGGATCAG
AGAAAGACAATTAAAATTTTATTAGAATATGCTGACATGATCTTTACTTATATCTTCATT
CTGGAAATGCTTCTAAAATGGATGGCATATGGTTTTAAGGCCTATTTCTCTAATGGCTGG
TACAGGCTGGACTTCGTGGTTGTTATTGTGTTTTGTCTTAGCTTAATAGGCAAAACTCGG
GAAGAACTAAAACCTCTTATTTCCATGAAATTCCTTCGGCCCCTCAGAGTTCTATCTCAA
TTTGAAAGAATGAAGGTGGTTGTGAGAGCTTTGATCAAAACAACCTTACCCACTTTGAAT
GTGTTTCTTGTCTGCCTGATGATCTGGCTGATTTTTAGTATCATGGGAGTAGACTTATTT
GCTGGCAGATTCTATGAATGCATTGACCCAACAAGTGGAGAAAGGTTTCCTTCATCTGAA
GTCATGAATAAGAGTCGGTGTGAAAGCCTTCTGTTTAACGAATCCATGCTATGGGAAAAT
GCAAAAATGAACTTTGATAATGTTGGAAATGGTTTCCTTTCTCTGCTTCAAGTAGCAACA
TTTAATGGATGGATCACTATTATGAATTCAGCAATTGATTCTGTTGCTGTTAATATACAG
CCTCATTTTGAAGTCAACATCTACATGTATTGTTACTTTATCAACTTTATTATATTTGGA
GTATTTCTCCCTCTGAGTATGCTGATTACTGTTATTATTGATAATTTCAACAAGCATAAA
ATAAAGCTGGGAGGCTCAAATATCTTTATAACGGTTAAACAGAGAAAACAGTACCGCAGG
CTGAAGAAGCTAATGTATGAGGATTCTCAAAGACCAGTACCTCGCCCATTAAACAAGCTC
CAAGGATTCATCTTTGATGTGGTAACAAGCCAAGCTTTTAATGTCATTGTTATGGTTCTT
ATATGTTTCCAAGCAATAGCCATGATGATAGACACTGATGTTCAGAGTCTACAAATGTCC
ATTGCTCTCTACTGGATTAACTCAATTTTTGTTATGCTATATACTATGGAATGTATACTG
AAGCTCATCGCTTTCCGTTGTTTTTATTTCACCATTGCGTGGAACATTTTTGATTTTATG
GTGGTTATTTTCTCCATCACAGGACTATGTCTGCCTATGACAGTAGGATCCTACCTTGTG
CCTCCTTCACTTGTGCAACTGATACTTCTCTCACGGATCATTCACATGCTGCGTCTTGGA
AAAGGACCAAAGGTGTTTCATAATCTGATGCTTCCTTTGATGCTGTCCCTCCCAGCATTA
TTGAACATCATTCTTCTCATCTTCCTGGTCATGTTCATCTATGCCGTATTTGGAATGTAT
AATTTTGCCTATGTTAAAAAAGAAGCTGGAATTAATGATGTGTCTAATTTTGAAACCTTT
GGCAACAGTATGCTCTGTCTTTTTCAAGTTGCAATATTTGCTGGTTGGGATGGGATGCTT
GATGCAATTTTCAACAGTAAATGGTCTGACTGTGATCCTGATAAAATTAACCCTGGGACT
CAAGTTAGAGGAGATTGTGGGAACCCCTCTGTTGGGATTTTTTATTTTGTCAGTTATATC
CTCATATCATGGCTGATCATTGTAAATATGTACATTGTTGTTGTCATGGAGTTTTTAAAT
ATTGCTTCTAAGAAGAAAAACAAGACCTTGAGTGAAGATGATTTTAGGAAATTCTTTCAG
GTATGGAAAAGGTTTGATCCTGATAGGACCCAGTACATAGACTCTAGCAAGCTTTCAGAT
TTTGCAGCTGCTCTTGATCCTCCTCTTTTCATGGCAAAACCAAACAAGGGCCAGCTCATT
GCTTTGGACCTCCCCATGGCTGTTGGGGACAGAATTCATTGCCTCGATATCTTACTTGCT
TTTACAAAGAGAGTTATGGGTCAAGATGTGAGGATGGAGAAAGTTGTTTCAGAAATAGAA
TCAGGGTTTTTGTTAGCCAACCCTTTTAAGATCACATGTGAGCCAATTACGACTACTTTG
AAACGAAAACAAGAGGCAGTTTCAGCAACCATCATTCAACGTGCTTATAAAAATTACCGC
TTGAGGCGAAATGACAAAAATACATCAGATATTCATATGATAGATGGTGACAGAGATGTT
CATGCTACTAAAGAAGGTGCCTATTTTGACAAAGCTAAGGAAAAGTCACCTATTCAAAGC
CAGATCTAA
Chromosome Location
2
Locus
2q24.3
External Identifiers
ResourceLink
UniProtKB IDQ01118
UniProtKB Entry NameSCN7A_HUMAN
HGNC IDHGNC:10594
General References
  1. George AL Jr, Knittle TJ, Tamkun MM: Molecular cloning of an atypical voltage-gated sodium channel expressed in human heart and uterus: evidence for a distinct gene family. Proc Natl Acad Sci U S A. 1992 Jun 1;89(11):4893-7. [PubMed:1317577]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]
  3. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00313Valproic acidapproved, investigationalunknowninhibitorDetails
DB05541Brivaracetamapproved, investigationalyesinhibitorDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB13269Dichlorobenzyl alcoholapprovedyesantagonistDetails
DB00243Ranolazineapproved, investigationalyesinhibitorDetails
DB00776OxcarbazepineapprovedunknowninhibitorDetails
DB00564Carbamazepineapproved, investigationalyesinhibitorDetails
DB00273TopiramateapprovedyesinhibitorDetails
DB11186Pentoxyverineapproved, investigationalunknowninhibitorDetails
DB13746Bioallethrinapproved, experimentalunknownmodulatorDetails
DB09342PropoxycaineapprovedyesblockerDetails
DB09088Amylocaineapproved, withdrawnyesblockerDetails
DB09345PramocaineapprovedyesblockerDetails
DB09085Tetracaineapproved, vet_approvedyesblockerDetails