You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameBevacizumab
Accession NumberDB00112  (BTD00087, BIOD00087)
TypeBiotech
GroupsApproved, Investigational
DescriptionA recombinant humanized monoclonal IgG1 antibody that binds to and inhibits the biologic activity of human vascular endothelial growth factor (VEGF). Bevacizumab contains human framework regions and the complementarity-determining regions of a murine antibody that binds to VEGF. Bevacizumab is produced in a Chinese Hamster Ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin and has a molecular weight of approximately 149 kilodaltons.
Protein structureDb00112
Related Articles
Protein chemical formulaC6538H10034N1716O2033S44
Protein average weight149000.0 Da
Sequences
>"Bevacizumab light chain"
DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>"Bevacizumab heavy chain"
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY
AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
antiVEGF
Avastin
External Identifiers
  • R-435
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Avastininjection, solution100 mg/4mLintravenousGenentech, Inc.2004-02-26Not applicableUs
Avastininjection, solution400 mg/16mLintravenousGenentech, Inc.2004-02-26Not applicableUs
Avastinsolution25 mgintravenousHoffmann La Roche Limited2005-11-02Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII2S9ZZM9Q9V
CAS number216974-75-3
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationAs part of combination therapy for metastatic colorectal cancer and HER2-negative metastatic breast cancer.
PharmacodynamicsBevacizumab is an antineoplastic agent and prevents or reduces the formation of blood vessels (angiogenesis) thereby preventing or reducing metatstatic disease progressing. Bevacizumab binds VEGF and prevents vascular endothelial growth and endothelial cell proliferation.
Mechanism of actionBevacizumab contains human framework regions with antigen binding regions of a humanised murine antibody that binds to VEGF. Bevacizumab is produced by recombinant DNA technology in a Chinese hamster ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin and is purified by a process that includes specific viral inactivation and removal steps. Bevacizumab binds VEGF and prevents the interaction of VEGF to its receptors (Flt-1 and KDR) on the surface of endothelial cells. This prevents blood vessel proliferation and in response retardation of metastatic tumor growth occurs.
Related Articles
AbsorptionNot Available
Volume of distribution

Vd: 46 mL/kg

Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to endothelial cells, or by human antimurine antibody production

Route of eliminationNot Available
Half lifeapproximately 20 days (range: 11–50 days)
Clearance
  • 0.26 L/day [Male patients who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.21 L/day [Female patients who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.25 L/day [Patients with higher tumor burden who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]
  • 0.2 L/day [patients with tumor burdens below the median who received 1 to 20 mg/kg of Avastin weekly, every 2 weeks, or every 3 weeks]

Clearance varies by body weight, gender, and tumor burden. Increased clearance observed in men and in patients with higher tumor burden; however, no evidence of reduced efficacy.

ToxicityCategory C in pregnancy. No studies on lactating patients: recommended to discontinue the drug or discontinue lactation. No extensive studies in pediatrics. In geriatrics: increased risk of proteinuria, arterial thromboembolic events, as well as GI bleeding and sepsis among others.
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Bevacizumab Action PathwayDrug actionSMP00420
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Roche Pharmaceuticals
Packagers
Dosage forms
FormRouteStrength
Injection, solutionintravenous100 mg/4mL
Injection, solutionintravenous400 mg/16mL
Solutionintravenous25 mg
Prices
Unit descriptionCostUnit
Avastin 400 mg/16ml Solution 16ml Vial2786.78USD vial
Avastin 100 mg/4ml Solution 4ml Vial696.7USD vial
Avastin 100 mg/4 ml vial167.48USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2145985 No2003-09-162012-10-28Canada
CA2286330 No2008-06-102018-04-03Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
References
Synthesis ReferenceNot Available
General References
  1. Velcheti V, Viswanathan A, Govindan R: The proportion of patients with metastatic non-small cell lung cancer potentially eligible for treatment with bevacizumab: a single institutional survey. J Thorac Oncol. 2006 Jun;1(5):501. [PubMed:17409907 ]
  2. Link [Link]
External Links
ATC CodesL01XC07
AHFS Codes
  • 10:00.00
PDB Entries
FDA labelDownload (133 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
2-(4-Chlorophenyl)-5-QuinoxalinecarboxamideBevacizumab may increase the cardiotoxic activities of 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide.
2-MethoxyestradiolBevacizumab may increase the cardiotoxic activities of 2-Methoxyestradiol.
3-MethoxybenzamideBevacizumab may increase the cardiotoxic activities of 3-Methoxybenzamide.
3,4-Dihydroxybenzoic AcidBevacizumab may increase the cardiotoxic activities of 3,4-Dihydroxybenzoic Acid.
5,10-Dideazatetrahydrofolic AcidBevacizumab may increase the cardiotoxic activities of 5,10-Dideazatetrahydrofolic Acid.
7-HydroxystaurosporineBevacizumab may increase the cardiotoxic activities of 7-Hydroxystaurosporine.
8-azaguanineBevacizumab may increase the cardiotoxic activities of 8-azaguanine.
9-(2-phosphonylmethoxyethyl)-2,6-diaminopurineBevacizumab may increase the cardiotoxic activities of 9-(2-phosphonylmethoxyethyl)-2,6-diaminopurine.
AbirateroneBevacizumab may increase the cardiotoxic activities of Abiraterone.
ABT-263Bevacizumab may increase the cardiotoxic activities of ABT-263.
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Bevacizumab.
AfatinibBevacizumab may increase the cardiotoxic activities of Afatinib.
AfimoxifeneBevacizumab may increase the cardiotoxic activities of Afimoxifene.
AfliberceptBevacizumab may increase the cardiotoxic activities of Aflibercept.
AlatrofloxacinBevacizumab may increase the cardiotoxic activities of Alatrofloxacin.
AlbendazoleBevacizumab may increase the cardiotoxic activities of Albendazole.
AldesleukinBevacizumab may increase the cardiotoxic activities of Aldesleukin.
AlemtuzumabBevacizumab may increase the cardiotoxic activities of Alemtuzumab.
AlitretinoinBevacizumab may increase the cardiotoxic activities of Alitretinoin.
Alpha-DifluoromethylornithineBevacizumab may increase the cardiotoxic activities of Alpha-Difluoromethylornithine.
AltretamineBevacizumab may increase the cardiotoxic activities of Altretamine.
AminoglutethimideBevacizumab may increase the cardiotoxic activities of Aminoglutethimide.
Aminolevulinic acidBevacizumab may increase the cardiotoxic activities of Aminolevulinic acid.
AmonafideBevacizumab may increase the cardiotoxic activities of Amonafide.
AmrubicinBevacizumab may increase the cardiotoxic activities of Amrubicin.
AmsacrineBevacizumab may increase the cardiotoxic activities of Amsacrine.
AnagrelideBevacizumab may increase the cardiotoxic activities of Anagrelide.
AnastrozoleBevacizumab may increase the cardiotoxic activities of Anastrozole.
annamycinBevacizumab may increase the cardiotoxic activities of annamycin.
AP 12009Bevacizumab may increase the cardiotoxic activities of AP 12009.
AP24534Bevacizumab may increase the cardiotoxic activities of AP24534.
Arsenic trioxideBevacizumab may increase the cardiotoxic activities of Arsenic trioxide.
ASA404Bevacizumab may increase the cardiotoxic activities of ASA404.
AsparaginaseBevacizumab may increase the cardiotoxic activities of Asparaginase.
AT-101Bevacizumab may increase the cardiotoxic activities of AT-101.
AxitinibBevacizumab may increase the cardiotoxic activities of Axitinib.
AzacitidineBevacizumab may increase the cardiotoxic activities of Azacitidine.
AzathioprineBevacizumab may increase the cardiotoxic activities of Azathioprine.
AZD2171Bevacizumab may increase the cardiotoxic activities of AZD2171.
Azelaic AcidBevacizumab may increase the cardiotoxic activities of Azelaic Acid.
BatimastatBevacizumab may increase the cardiotoxic activities of Batimastat.
BelimumabThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Belimumab.
BelinostatBevacizumab may increase the cardiotoxic activities of Belinostat.
BendamustineBevacizumab may increase the cardiotoxic activities of Bendamustine.
BesifloxacinBevacizumab may increase the cardiotoxic activities of Besifloxacin.
BexaroteneBevacizumab may increase the cardiotoxic activities of Bexarotene.
BicalutamideBevacizumab may increase the cardiotoxic activities of Bicalutamide.
BleomycinBevacizumab may increase the cardiotoxic activities of Bleomycin.
BlinatumomabBevacizumab may increase the cardiotoxic activities of Blinatumomab.
BortezomibBevacizumab may increase the cardiotoxic activities of Bortezomib.
BosutinibBevacizumab may increase the cardiotoxic activities of Bosutinib.
Brentuximab vedotinBevacizumab may increase the cardiotoxic activities of Brentuximab vedotin.
BSI-201Bevacizumab may increase the cardiotoxic activities of BSI-201.
BusulfanBevacizumab may increase the cardiotoxic activities of Busulfan.
CabazitaxelBevacizumab may increase the cardiotoxic activities of Cabazitaxel.
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Bevacizumab.
CabergolineBevacizumab may increase the cardiotoxic activities of Cabergoline.
CabozantinibBevacizumab may increase the cardiotoxic activities of Cabozantinib.
CalcipotriolBevacizumab may increase the cardiotoxic activities of Calcipotriol.
CamptothecinBevacizumab may increase the cardiotoxic activities of Camptothecin.
CapecitabineBevacizumab may increase the cardiotoxic activities of Capecitabine.
CarboplatinBevacizumab may increase the cardiotoxic activities of Carboplatin.
CarfilzomibBevacizumab may increase the cardiotoxic activities of Carfilzomib.
CarmofurBevacizumab may increase the cardiotoxic activities of Carmofur.
CarmustineBevacizumab may increase the cardiotoxic activities of Carmustine.
CatumaxomabBevacizumab may increase the cardiotoxic activities of Catumaxomab.
CB1954Bevacizumab may increase the cardiotoxic activities of CB1954.
CelecoxibBevacizumab may increase the cardiotoxic activities of Celecoxib.
CeritinibBevacizumab may increase the cardiotoxic activities of Ceritinib.
CetuximabBevacizumab may increase the cardiotoxic activities of Cetuximab.
ChlorambucilBevacizumab may increase the cardiotoxic activities of Chlorambucil.
ChlorotrianiseneBevacizumab may increase the cardiotoxic activities of Chlorotrianisene.
CinoxacinBevacizumab may increase the cardiotoxic activities of Cinoxacin.
CiprofloxacinBevacizumab may increase the cardiotoxic activities of Ciprofloxacin.
CisplatinBevacizumab may increase the cardiotoxic activities of Cisplatin.
CladribineBevacizumab may increase the cardiotoxic activities of Cladribine.
ClofarabineBevacizumab may increase the cardiotoxic activities of Clofarabine.
ClozapineThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Clozapine.
ColchicineBevacizumab may increase the cardiotoxic activities of Colchicine.
CrizotinibBevacizumab may increase the cardiotoxic activities of Crizotinib.
CyclophosphamideBevacizumab may increase the cardiotoxic activities of Cyclophosphamide.
Cyproterone acetateBevacizumab may increase the cardiotoxic activities of Cyproterone acetate.
CytarabineBevacizumab may increase the cardiotoxic activities of Cytarabine.
DabrafenibBevacizumab may increase the cardiotoxic activities of Dabrafenib.
DacarbazineBevacizumab may increase the cardiotoxic activities of Dacarbazine.
DactinomycinBevacizumab may increase the cardiotoxic activities of Dactinomycin.
DaratumumabBevacizumab may increase the cardiotoxic activities of Daratumumab.
DasatinibBevacizumab may increase the cardiotoxic activities of Dasatinib.
DaunorubicinBevacizumab may increase the cardiotoxic activities of Daunorubicin.
DecitabineBevacizumab may increase the cardiotoxic activities of Decitabine.
Denileukin diftitoxBevacizumab may increase the cardiotoxic activities of Denileukin diftitox.
DeslanosideDeslanoside may decrease the cardiotoxic activities of Bevacizumab.
DexamethasoneBevacizumab may increase the cardiotoxic activities of Dexamethasone.
DexrazoxaneBevacizumab may increase the cardiotoxic activities of Dexrazoxane.
DienogestBevacizumab may increase the cardiotoxic activities of Dienogest.
DiethylstilbestrolBevacizumab may increase the cardiotoxic activities of Diethylstilbestrol.
DigitoxinDigitoxin may decrease the cardiotoxic activities of Bevacizumab.
DigoxinDigoxin may decrease the cardiotoxic activities of Bevacizumab.
DinutuximabBevacizumab may increase the cardiotoxic activities of Dinutuximab.
DocetaxelBevacizumab may increase the cardiotoxic activities of Docetaxel.
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Bevacizumab.
DoxorubicinBevacizumab may increase the cardiotoxic activities of Doxorubicin.
EcabetBevacizumab may increase the cardiotoxic activities of Ecabet.
efaproxiralBevacizumab may increase the cardiotoxic activities of efaproxiral.
EflornithineBevacizumab may increase the cardiotoxic activities of Eflornithine.
EG009Bevacizumab may increase the cardiotoxic activities of EG009.
ElsamitrucinBevacizumab may increase the cardiotoxic activities of Elsamitrucin.
EndostatinBevacizumab may increase the cardiotoxic activities of Endostatin.
EnoxacinBevacizumab may increase the cardiotoxic activities of Enoxacin.
EnrofloxacinBevacizumab may increase the cardiotoxic activities of Enrofloxacin.
EpirubicinBevacizumab may increase the cardiotoxic activities of Epirubicin.
Epothilone BBevacizumab may increase the cardiotoxic activities of Epothilone B.
EribulinBevacizumab may increase the cardiotoxic activities of Eribulin.
ErlotinibBevacizumab may increase the cardiotoxic activities of Erlotinib.
EstramustineBevacizumab may increase the cardiotoxic activities of Estramustine.
Ethiodized oilBevacizumab may increase the cardiotoxic activities of Ethiodized oil.
Ethyl carbamateBevacizumab may increase the cardiotoxic activities of Ethyl carbamate.
EtoposideBevacizumab may increase the cardiotoxic activities of Etoposide.
EverolimusBevacizumab may increase the cardiotoxic activities of Everolimus.
ExemestaneBevacizumab may increase the cardiotoxic activities of Exemestane.
exisulindBevacizumab may increase the cardiotoxic activities of exisulind.
FenretinideBevacizumab may increase the cardiotoxic activities of Fenretinide.
FlavopiridolBevacizumab may increase the cardiotoxic activities of Flavopiridol.
FleroxacinBevacizumab may increase the cardiotoxic activities of Fleroxacin.
FloxuridineBevacizumab may increase the cardiotoxic activities of Floxuridine.
FludarabineBevacizumab may increase the cardiotoxic activities of Fludarabine.
FlumequineBevacizumab may increase the cardiotoxic activities of Flumequine.
FluorouracilBevacizumab may increase the cardiotoxic activities of Fluorouracil.
FlutamideBevacizumab may increase the cardiotoxic activities of Flutamide.
FormestaneBevacizumab may increase the cardiotoxic activities of Formestane.
FormycinBevacizumab may increase the cardiotoxic activities of Formycin.
FotemustineBevacizumab may increase the cardiotoxic activities of Fotemustine.
FulvestrantBevacizumab may increase the cardiotoxic activities of Fulvestrant.
FumagillinBevacizumab may increase the cardiotoxic activities of Fumagillin.
Gallium nitrateBevacizumab may increase the cardiotoxic activities of Gallium nitrate.
GarenoxacinBevacizumab may increase the cardiotoxic activities of Garenoxacin.
GatifloxacinBevacizumab may increase the cardiotoxic activities of Gatifloxacin.
GefitinibBevacizumab may increase the cardiotoxic activities of Gefitinib.
GeldanamycinBevacizumab may increase the cardiotoxic activities of Geldanamycin.
GemcitabineBevacizumab may increase the cardiotoxic activities of Gemcitabine.
GemifloxacinBevacizumab may increase the cardiotoxic activities of Gemifloxacin.
Gemtuzumab ozogamicinBevacizumab may increase the cardiotoxic activities of Gemtuzumab ozogamicin.
GenisteinBevacizumab may increase the cardiotoxic activities of Genistein.
Ginsenoside CBevacizumab may increase the cardiotoxic activities of Ginsenoside C.
GoserelinBevacizumab may increase the cardiotoxic activities of Goserelin.
GrepafloxacinBevacizumab may increase the cardiotoxic activities of Grepafloxacin.
HadacidinBevacizumab may increase the cardiotoxic activities of Hadacidin.
HalofuginoneBevacizumab may increase the cardiotoxic activities of Halofuginone.
HexestrolBevacizumab may increase the cardiotoxic activities of Hexestrol.
Hydroxyprogesterone caproateBevacizumab may increase the cardiotoxic activities of Hydroxyprogesterone caproate.
HydroxyureaBevacizumab may increase the cardiotoxic activities of Hydroxyurea.
IbrutinibBevacizumab may increase the cardiotoxic activities of Ibrutinib.
IdarubicinBevacizumab may increase the cardiotoxic activities of Idarubicin.
IdelalisibBevacizumab may increase the cardiotoxic activities of Idelalisib.
IfosfamideBevacizumab may increase the cardiotoxic activities of Ifosfamide.
ImatinibBevacizumab may increase the cardiotoxic activities of Imatinib.
ImiquimodBevacizumab may increase the cardiotoxic activities of Imiquimod.
Interferon beta-1aBevacizumab may increase the cardiotoxic activities of Interferon beta-1a.
IobenguaneBevacizumab may increase the cardiotoxic activities of Iobenguane.
IpilimumabBevacizumab may increase the cardiotoxic activities of Ipilimumab.
IrinotecanThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Irinotecan.
IxabepiloneBevacizumab may increase the cardiotoxic activities of Ixabepilone.
IxazomibBevacizumab may increase the cardiotoxic activities of Ixazomib.
KOS-1584Bevacizumab may increase the cardiotoxic activities of KOS-1584.
L-alanosineBevacizumab may increase the cardiotoxic activities of L-alanosine.
LanreotideBevacizumab may increase the cardiotoxic activities of Lanreotide.
LapatinibBevacizumab may increase the cardiotoxic activities of Lapatinib.
LeflunomideBevacizumab may increase the cardiotoxic activities of Leflunomide.
LenalidomideBevacizumab may increase the cardiotoxic activities of Lenalidomide.
LenvatinibBevacizumab may increase the cardiotoxic activities of Lenvatinib.
LetrozoleBevacizumab may increase the cardiotoxic activities of Letrozole.
LeuprolideBevacizumab may increase the cardiotoxic activities of Leuprolide.
LevofloxacinBevacizumab may increase the cardiotoxic activities of Levofloxacin.
LomefloxacinBevacizumab may increase the cardiotoxic activities of Lomefloxacin.
LomustineBevacizumab may increase the cardiotoxic activities of Lomustine.
LonidamineBevacizumab may increase the cardiotoxic activities of Lonidamine.
LycopeneBevacizumab may increase the cardiotoxic activities of Lycopene.
MasitinibBevacizumab may increase the cardiotoxic activities of Masitinib.
MasoprocolBevacizumab may increase the cardiotoxic activities of Masoprocol.
MaxacalcitolBevacizumab may increase the cardiotoxic activities of Maxacalcitol.
MDX-1106Bevacizumab may increase the cardiotoxic activities of MDX-1106.
MebendazoleBevacizumab may increase the cardiotoxic activities of Mebendazole.
MechlorethamineBevacizumab may increase the cardiotoxic activities of Mechlorethamine.
MedrogestoneBevacizumab may increase the cardiotoxic activities of Medrogestone.
Medroxyprogesterone acetateBevacizumab may increase the cardiotoxic activities of Medroxyprogesterone acetate.
Megestrol acetateBevacizumab may increase the cardiotoxic activities of Megestrol acetate.
MelphalanBevacizumab may increase the cardiotoxic activities of Melphalan.
MequinolBevacizumab may increase the cardiotoxic activities of Mequinol.
MercaptopurineBevacizumab may increase the cardiotoxic activities of Mercaptopurine.
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Bevacizumab.
MethotrexateBevacizumab may increase the cardiotoxic activities of Methotrexate.
Methyl aminolevulinateBevacizumab may increase the cardiotoxic activities of Methyl aminolevulinate.
MethylprednisoloneBevacizumab may increase the cardiotoxic activities of Methylprednisolone.
MethyltestosteroneBevacizumab may increase the cardiotoxic activities of Methyltestosterone.
MGI-114Bevacizumab may increase the cardiotoxic activities of MGI-114.
MidostaurinBevacizumab may increase the cardiotoxic activities of Midostaurin.
MiltefosineBevacizumab may increase the cardiotoxic activities of Miltefosine.
MitomycinBevacizumab may increase the cardiotoxic activities of Mitomycin.
MitotaneBevacizumab may increase the cardiotoxic activities of Mitotane.
MitoxantroneBevacizumab may increase the cardiotoxic activities of Mitoxantrone.
motexafin gadoliniumBevacizumab may increase the cardiotoxic activities of motexafin gadolinium.
MoxifloxacinBevacizumab may increase the cardiotoxic activities of Moxifloxacin.
Mycophenolic acidBevacizumab may increase the cardiotoxic activities of Mycophenolic acid.
Nalidixic AcidBevacizumab may increase the cardiotoxic activities of Nalidixic Acid.
NecitumumabBevacizumab may increase the cardiotoxic activities of Necitumumab.
NelarabineBevacizumab may increase the cardiotoxic activities of Nelarabine.
NiguldipineBevacizumab may increase the cardiotoxic activities of Niguldipine.
NilotinibBevacizumab may increase the cardiotoxic activities of Nilotinib.
NilutamideBevacizumab may increase the cardiotoxic activities of Nilutamide.
NintedanibBevacizumab may increase the cardiotoxic activities of Nintedanib.
NivolumabBevacizumab may increase the cardiotoxic activities of Nivolumab.
nocodazoleBevacizumab may increase the cardiotoxic activities of nocodazole.
NorfloxacinBevacizumab may increase the cardiotoxic activities of Norfloxacin.
ObinutuzumabBevacizumab may increase the cardiotoxic activities of Obinutuzumab.
OctreotideBevacizumab may increase the cardiotoxic activities of Octreotide.
OfatumumabBevacizumab may increase the cardiotoxic activities of Ofatumumab.
OfloxacinBevacizumab may increase the cardiotoxic activities of Ofloxacin.
OlaparibBevacizumab may increase the cardiotoxic activities of Olaparib.
Omacetaxine mepesuccinateBevacizumab may increase the cardiotoxic activities of Omacetaxine mepesuccinate.
OprelvekinBevacizumab may increase the cardiotoxic activities of Oprelvekin.
OsimertinibBevacizumab may increase the cardiotoxic activities of Osimertinib.
OuabainOuabain may decrease the cardiotoxic activities of Bevacizumab.
OxaliplatinBevacizumab may increase the cardiotoxic activities of Oxaliplatin.
PaclitaxelBevacizumab may increase the cardiotoxic activities of Paclitaxel.
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Bevacizumab.
PalbociclibBevacizumab may increase the cardiotoxic activities of Palbociclib.
PalifosfamideBevacizumab may increase the cardiotoxic activities of Palifosfamide.
PamidronateBevacizumab may increase the cardiotoxic activities of Pamidronate.
PanitumumabBevacizumab may increase the cardiotoxic activities of Panitumumab.
PanobinostatBevacizumab may increase the cardiotoxic activities of Panobinostat.
PazopanibBevacizumab may increase the cardiotoxic activities of Pazopanib.
PefloxacinBevacizumab may increase the cardiotoxic activities of Pefloxacin.
PegaspargaseBevacizumab may increase the cardiotoxic activities of Pegaspargase.
PembrolizumabBevacizumab may increase the cardiotoxic activities of Pembrolizumab.
PemetrexedBevacizumab may increase the cardiotoxic activities of Pemetrexed.
PentostatinBevacizumab may increase the cardiotoxic activities of Pentostatin.
PertuzumabBevacizumab may increase the cardiotoxic activities of Pertuzumab.
Phenylacetic acidBevacizumab may increase the cardiotoxic activities of Phenylacetic acid.
PipobromanBevacizumab may increase the cardiotoxic activities of Pipobroman.
PirfenidoneBevacizumab may increase the cardiotoxic activities of Pirfenidone.
PirlindoleBevacizumab may increase the cardiotoxic activities of Pirlindole.
PixantroneBevacizumab may increase the cardiotoxic activities of Pixantrone.
PlicamycinBevacizumab may increase the cardiotoxic activities of Plicamycin.
PodofiloxBevacizumab may increase the cardiotoxic activities of Podofilox.
PodophyllinBevacizumab may increase the cardiotoxic activities of Podophyllin.
polyacrylic acidBevacizumab may increase the cardiotoxic activities of polyacrylic acid.
PomalidomideBevacizumab may increase the cardiotoxic activities of Pomalidomide.
PonatinibBevacizumab may increase the cardiotoxic activities of Ponatinib.
PorfimerBevacizumab may increase the cardiotoxic activities of Porfimer.
porfiromycinBevacizumab may increase the cardiotoxic activities of porfiromycin.
PralatrexateBevacizumab may increase the cardiotoxic activities of Pralatrexate.
PrednisoloneBevacizumab may increase the cardiotoxic activities of Prednisolone.
PrednisoneBevacizumab may increase the cardiotoxic activities of Prednisone.
ProcarbazineBevacizumab may increase the cardiotoxic activities of Procarbazine.
Purine RibosideBevacizumab may increase the cardiotoxic activities of Purine Riboside.
PuromycinBevacizumab may increase the cardiotoxic activities of Puromycin.
QuinacrineBevacizumab may increase the cardiotoxic activities of Quinacrine.
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Bevacizumab.
Radium Ra 223 DichlorideBevacizumab may increase the cardiotoxic activities of Radium Ra 223 Dichloride.
RaltitrexedBevacizumab may increase the cardiotoxic activities of Raltitrexed.
RamucirumabBevacizumab may increase the cardiotoxic activities of Ramucirumab.
RanibizumabBevacizumab may increase the cardiotoxic activities of Ranibizumab.
RanpirnaseBevacizumab may increase the cardiotoxic activities of Ranpirnase.
RegorafenibBevacizumab may increase the cardiotoxic activities of Regorafenib.
ResveratrolBevacizumab may increase the cardiotoxic activities of Resveratrol.
Rhodamine 6GBevacizumab may increase the cardiotoxic activities of Rhodamine 6G.
RituximabBevacizumab may increase the cardiotoxic activities of Rituximab.
RomidepsinBevacizumab may increase the cardiotoxic activities of Romidepsin.
RomiplostimBevacizumab may increase the cardiotoxic activities of Romiplostim.
RoquinimexBevacizumab may increase the cardiotoxic activities of Roquinimex.
RubitecanBevacizumab may increase the cardiotoxic activities of Rubitecan.
RuxolitinibBevacizumab may increase the cardiotoxic activities of Ruxolitinib.
SatraplatinBevacizumab may increase the cardiotoxic activities of Satraplatin.
SeliciclibBevacizumab may increase the cardiotoxic activities of Seliciclib.
SemaxanibBevacizumab may increase the cardiotoxic activities of Semaxanib.
SeocalcitolBevacizumab may increase the cardiotoxic activities of Seocalcitol.
SiltuximabBevacizumab may increase the cardiotoxic activities of Siltuximab.
SirolimusBevacizumab may increase the cardiotoxic activities of Sirolimus.
SonidegibBevacizumab may increase the cardiotoxic activities of Sonidegib.
SorafenibThe risk or severity of adverse effects can be increased when Bevacizumab is combined with Sorafenib.
SparfloxacinBevacizumab may increase the cardiotoxic activities of Sparfloxacin.
Sparfosic acidBevacizumab may increase the cardiotoxic activities of Sparfosic acid.
SparsomycinBevacizumab may increase the cardiotoxic activities of Sparsomycin.
squalamineBevacizumab may increase the cardiotoxic activities of squalamine.
SRT501Bevacizumab may increase the cardiotoxic activities of SRT501.
StreptozocinBevacizumab may increase the cardiotoxic activities of Streptozocin.
SulindacBevacizumab may increase the cardiotoxic activities of Sulindac.
SunitinibThe risk or severity of adverse effects can be increased when Sunitinib is combined with Bevacizumab.
SunitinibBevacizumab may increase the cardiotoxic activities of Sunitinib.
SuraminBevacizumab may increase the cardiotoxic activities of Suramin.
SwainsonineBevacizumab may increase the cardiotoxic activities of Swainsonine.
TamoxifenBevacizumab may increase the cardiotoxic activities of Tamoxifen.
TegafurBevacizumab may increase the cardiotoxic activities of Tegafur.
TemafloxacinBevacizumab may increase the cardiotoxic activities of Temafloxacin.
TemozolomideBevacizumab may increase the cardiotoxic activities of Temozolomide.
TemsirolimusBevacizumab may increase the cardiotoxic activities of Temsirolimus.
TeniposideBevacizumab may increase the cardiotoxic activities of Teniposide.
TestolactoneBevacizumab may increase the cardiotoxic activities of Testolactone.
TetrathiomolybdateBevacizumab may increase the cardiotoxic activities of Tetrathiomolybdate.
TezacitabineBevacizumab may increase the cardiotoxic activities of Tezacitabine.
ThalidomideBevacizumab may increase the cardiotoxic activities of Thalidomide.
ThiotepaBevacizumab may increase the cardiotoxic activities of Thiotepa.
ThymalfasinBevacizumab may increase the cardiotoxic activities of Thymalfasin.
TiboloneBevacizumab may increase the cardiotoxic activities of Tibolone.
TioguanineBevacizumab may increase the cardiotoxic activities of Tioguanine.
TipifarnibBevacizumab may increase the cardiotoxic activities of Tipifarnib.
TirapazamineBevacizumab may increase the cardiotoxic activities of Tirapazamine.
TopotecanBevacizumab may increase the cardiotoxic activities of Topotecan.
ToremifeneBevacizumab may increase the cardiotoxic activities of Toremifene.
TositumomabBevacizumab may increase the cardiotoxic activities of Tositumomab.
TrabectedinBevacizumab may increase the cardiotoxic activities of Trabectedin.
TrametinibBevacizumab may increase the cardiotoxic activities of Trametinib.
TrastuzumabBevacizumab may increase the cardiotoxic activities of Trastuzumab.
Trastuzumab emtansineBevacizumab may increase the cardiotoxic activities of Trastuzumab emtansine.
TretinoinBevacizumab may increase the cardiotoxic activities of Tretinoin.
TrifluridineBevacizumab may increase the cardiotoxic activities of Trifluridine.
TrilostaneBevacizumab may increase the cardiotoxic activities of Trilostane.
TrimetrexateBevacizumab may increase the cardiotoxic activities of Trimetrexate.
TriptorelinBevacizumab may increase the cardiotoxic activities of Triptorelin.
TrovafloxacinBevacizumab may increase the cardiotoxic activities of Trovafloxacin.
TroxacitabineBevacizumab may increase the cardiotoxic activities of Troxacitabine.
TTNPBBevacizumab may increase the cardiotoxic activities of TTNPB.
TubercidinBevacizumab may increase the cardiotoxic activities of Tubercidin.
UbenimexBevacizumab may increase the cardiotoxic activities of Ubenimex.
Uracil mustardBevacizumab may increase the cardiotoxic activities of Uracil mustard.
ValrubicinBevacizumab may increase the cardiotoxic activities of Valrubicin.
VandetanibBevacizumab may increase the cardiotoxic activities of Vandetanib.
VapreotideBevacizumab may increase the cardiotoxic activities of Vapreotide.
VeliparibBevacizumab may increase the cardiotoxic activities of Veliparib.
VemurafenibBevacizumab may increase the cardiotoxic activities of Vemurafenib.
VerteporfinBevacizumab may increase the cardiotoxic activities of Verteporfin.
VinblastineBevacizumab may increase the cardiotoxic activities of Vinblastine.
VincristineBevacizumab may increase the cardiotoxic activities of Vincristine.
VindesineBevacizumab may increase the cardiotoxic activities of Vindesine.
VinorelbineBevacizumab may increase the cardiotoxic activities of Vinorelbine.
VismodegibBevacizumab may increase the cardiotoxic activities of Vismodegib.
Vitamin ABevacizumab may increase the cardiotoxic activities of Vitamin A.
VorinostatBevacizumab may increase the cardiotoxic activities of Vorinostat.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Vascular endothelial growth factor receptor binding
Specific Function:
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activ...
Gene Name:
VEGFA
Uniprot ID:
P15692
Molecular Weight:
27042.205 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Gerber HP, Ferrara N: Pharmacology and pharmacodynamics of bevacizumab as monotherapy or in combination with cytotoxic therapy in preclinical studies. Cancer Res. 2005 Feb 1;65(3):671-80. [PubMed:15705858 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23