| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-04-16 16:47:40 |
| Primary Accession Number |
DB00397 |
| Secondary Accession Number |
|
| Name |
Phenylpropanolamine |
| Drug Type |
- Approved
- Small Molecule
- Withdrawn
|
| Description |
Phenylpropanolamine has been withdrawn in Canada. In November 2000, the Food and Drug Administration (FDA) issued a public health advisory against the use of the drug. |
| Synonyms |
- (+-)-Phenylpropanolamine
- (+/-)-Norephedrin
- PPA
|
| Brand Names |
- Acutrim
- Ami-Tex
- Codimal
- Conex
- Contuss
- Despec
- Dexatrim
- Dura-Vent
- Entex
- Gentab
- Guaipax
- Myminic
- Naldecon
- Nolex
- Partuss
- Phenoxine
- Phenyldrine
- Phenylfenesin
- Propagest
- Rhindecon
- Rhymed
- Snaplets
- Triaminic
- ULR
- Vanex
|
| Brand Mixtures |
- Alka Seltzer Plus Cold Medicine Evt (Acetylsalicylic Acid + Chlorpheniramine Maleate + Phenylpropanolamine Bitartrate)
- Alka-Seltzer Plus Cold Medicine - Evt (Acetylsalicylic Acid + Chlorpheniramine Maleate + Phenylpropanolamine Bitartrate)
- Antitussive Decong Antihistamine Syr (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Bronchodex D Cap (Chlorpheniramine Maleate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Bronchosirum Pour Enfants (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Caldomine Dh Adulte (Hydrocodone Bitartrate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Caldomine Dh Enfant (Hydrocodone Bitartrate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Centracol DM - Syr (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Chlor Tripolon Decongest Syr (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Cold & Allergy (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Cold & Allergy Relief - Liq (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Cold Decongestant Long Acting Cap (Chlorpheniramine Maleate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Cold Relief (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Cold Relief DM (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Coltalin Tablet (Acetaminophen + Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Contac Cold Capsules (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Contac Cold Extra Strength Capsules (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Contac Cough Cold and Flu Caplets (Acetaminophen + Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Contact C Src (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Coricidin D Long Acting Tab (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Coricidin D Tab (Acetylsalicylic Acid + Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Coricidin Nd Tab (Acetylsalicylic Acid + Phenylpropanolamine Hydrochloride)
- Coricidin Sinus Headache Tab (Acetaminophen + Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Corsym Suspension (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Cough, Cold & Allergy Relief (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Counteract Sinus and Allergy (Acetaminophen + Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Decongestant Antihistaminic Syrup (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dilotab (Acetaminophen + Phenylpropanolamine Hydrochloride)
- Dimetane Expectorant Liq (Brompheniramine Maleate + Guaifenesin + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetane Expectorant-C Syr (Brompheniramine Maleate + Codeine Phosphate + Guaifenesin + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetane Expectorant-Dc Syr (Brompheniramine Maleate + Guaifenesin + Hydrocodone Bitartrate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Chewable Tablets (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Children's Cold & Allergy Tablets (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Children's Cold & Fever (Acetaminophen + Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Clear (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Cold & Sinus (Acetaminophen + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Cough & Cold Liqui-Gels - Cap (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Dimetapp Cough, Cold & Flu (Acetaminophen + Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Dimetapp DM Elixir (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp DM Tab (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Extentabs (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Liqui-Gels Cap (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Oral Infant Drops (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Tab (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp-C Syr (Brompheniramine Maleate + Codeine Phosphate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dristan Capsules (Acetylsalicylic Acid + Caffeine + Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Emercidin D Tab (Acetaminophen + Caffeine + Diphenylpyraline Hydrochloride + Phenylpropanolamine Hydrochloride)
- Emertabs Tab (Acetaminophen + Caffeine + Phenylpropanolamine Hydrochloride)
- Entex La (Guaifenesin + Phenylpropanolamine Hydrochloride)
- Entex La Tablets Srt (Guaifenesin + Phenylpropanolamine Hydrochloride)
- Extra Strength Contac C - Src (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Oradrine 2 Tab (Acetaminophen + Caffeine + Diphenylpyraline Hydrochloride + Phenylpropanolamine Hydrochloride)
- Oradrine Tablets (Acetaminophen + Caffeine + Codeine Phosphate + Diphenylpyraline Hydrochloride + Phenylpropanolamine Hydrochloride)
- Oradrine-2 Tab (Acetaminophen + Caffeine + Diphenylpyraline Hydrochloride + Phenylpropanolamine Hydrochloride)
- Ornade Af Liquid (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Ornade Af Spansule Src (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Ornade DM 10 Liq (Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Ornade DM 15 Liq (Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Ornade DM 30 Liq (Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Ornade Expectorant Cough Formula (Chlorpheniramine Maleate + Guaifenesin + Phenylpropanolamine Hydrochloride)
- Ornade Liquid (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Ornade Spansule Src (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Pharmacol DM Syr (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Pharmetapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Pharminicol DM Syrup (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Sine Off Nd Extra Strength Caplet (Acetaminophen + Phenylpropanolamine Hydrochloride)
- Sine-Off Allergy Tab (Acetaminophen + Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Sine-Off N.D. Tab (Acetaminophen + Phenylpropanolamine Hydrochloride)
- Sine-Off N.D. Tablet (Acetaminophen + Phenylpropanolamine Hydrochloride)
- Sinutab Sa Tab (Acetaminophen + Phenylpropanolamine Hydrochloride + Phenyltoloxamine Citrate)
- Tantacol DM Syr (Dextromethorphan Hydrobromide + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Tantapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Tavist-D Tablets (Clemastine (Clemastine Hydrogen Fumarate) + Phenylpropanolamine Hydrochloride)
- Tri-Anamine Cold Syrup (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Tri-Anamine Expect Antihist Decong Syrup (Guaifenesin + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Triaminic Cold and Allergy Syrup (Chlorpheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Triaminic DM Daytime Syr (Dextromethorphan Hydrobromide + Guaifenesin + Phenylpropanolamine Hydrochloride)
- Triaminic Expectorant Dh Syrup (Guaifenesin + Hydrocodone Bitartrate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Triaminic Time Release Tab (Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Triaminicin Colds & Flu Caplets (Acetaminophen + Caffeine + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Trisulfaminic Sus (Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate + Sulfadiazine + Sulfamerazine + Sulfamethazine)
- Trisulfaminic Tab (Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate + Sulfadiazine + Sulfamerazine + Sulfamethazine)
- Tussaminic C Forte Syrup (Codeine Phosphate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Tussaminic C Pediatric Syrup (Codeine Phosphate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Tussaminic DH Pediatric Syrup (Hydrocodone Bitartrate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
- Tussaminic Dh Forte Syrup (Hydrocodone Bitartrate + Pheniramine Maleate + Phenylpropanolamine Hydrochloride + Pyrilamine Maleate)
|
| Chemical IUPAC Name |
(1S,2R)-2-amino-1-phenylpropan-1-ol |
| Chemical Formula |
C9H13NO |
| Chemical Structure |
 |
| CAS Registry Number |
14838-15-4 |
| InChI Identifier |
InChI=1/C9H13NO/c1-7(10)9(11)8-5-3-2-4-6-8/h2-7,9,11H,10H2,1H3/t7-,9-/m1/s1 |
| InChI Key |
DLNKOYKMWOXYQA-VXNVDRBHBW |
| KEGG Drug |
Not Available |
| KEGG Compound |
C07911  |
| PubChem Compound |
26934  |
| PubChem Substance |
10113  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA450941  |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
02247031  |
| RxList Link |
Not Available |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Phenylpropanolamine  |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Vanderbitle, Hass, Ind. Eng. Chem. 32, 34 (1940) |
| Average Molecular Weight |
151.2056 |
| Monoisotopic Molecular Weight |
151.0997 |
| State |
Solid |
| Melting Point |
190-194 oC |
| Experimental Water Solubility |
Freely soluble
Source: PhysProp
|
| Predicted Water Solubility |
2.06e+01 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
1
Source: PhysProp
|
| Predicted LogP |
0.57
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-0.87
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
9.44 |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
C[C@@H](N)[C@@H](O)C1=CC=CC=C1 |
| Canonical SMILES |
CC(N)C(O)C1=CC=CC=C1 |
| Drug Category |
- Adrenergic alpha-Agonists
- Appetite Depressants
- Nasal Decongestants
- Sympathomimetics
|
| ATC Codes |
|
| AHFS Codes |
Not Available |
| Indication |
For the treatment of nasal congestion, control of urinary incontinence, priapism and obesity. |
| Pharmacology |
Phenylpropanolamine (PPA), a sympathomimetic agent structurally similar to pseudoephedrine, is used to treat nasal congestion. Phenylpropanolamine is found in appetite suppressant formulations and with guaifenesinin in cough-cold formulations. In 2000, the FDA requested that all drug companies discontinue marketing products containing phenylpropanolamine, due to an increased risk of hemorrhagic stroke in women who used phenylpropanolamine. |
| Mechanism of Action |
Phenylpropanolamine acts directly on alpha- and, to a lesser degree, beta-adrenergic receptors in the mucosa of the respiratory tract. Stimulation of alpha-adrenergic receptors produces vasoconstriction, reduces tissue hyperemia, edema, and nasal congestion, and increases nasal airway patency. PPA indirectly stimulates beta-receptors, producing tachycardia and a positive inotropic effect. |
| Absorption |
Reduced bioavailability (about 38%) from gastrointestinal tract because of first pass metabolism by monoamine oxidase in the stomach and liver. |
| Toxicity |
May induce ventricular extrasystoles and short paroxysms of ventricular tachycardia, a sensation of fullness in the head and tingling of the extremities; LD50=1490mg/kg (orally in rat) |
| Protein Binding |
Not Available |
| Biotransformation |
Hepatic |
| Half Life |
2.1 to 3.4 hours. |
| Dosage Forms |
Not Available
|
| Patient Information |
Show  |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
| Drug |
Interaction |
| Acetophenazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Alseroxylon |
Increased arterial pressure |
| Amitriptyline |
The tricyclic increases the sympathomimetic effect |
| Amoxapine |
The tricyclic increases the sympathomimetic effect |
| Bromocriptine |
The sympathomimetic increases the toxicity of bromocriptine |
| Chlorpromazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Clomipramine |
The tricyclic increases the sympathomimetic effect |
| Deserpidine |
Increased arterial pressure |
| Desipramine |
The tricyclic increases the sympathomimetic effect |
| Doxepin |
The tricyclic increases the sympathomimetic effect |
| Ethopropazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Fluoxetine |
Risk of serotoninergic syndrome |
| Fluphenazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Fluvoxamine |
Risk of serotoninergic syndrome |
| Guanethidine |
The agent decreases the effect of guanethidine |
| Imipramine |
The tricyclic increases the sympathomimetic effect |
| Isocarboxazid |
Increased arterial pressure |
| Linezolid |
Possible increase of arterial pressure |
| Mesoridazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Methdilazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Methotrimeprazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Methyldopa |
Increased arterial pressure |
| Midodrine |
Increased arterial pressure |
| Moclobemide |
Moclobemide increases the sympathomimetic effect |
| Nortriptyline |
The tricyclic increases the sympathomimetic effect |
| Pargyline |
Increased arterial pressure |
| Paroxetine |
Risk of serotoninergic syndrome |
| Perphenazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Phenelzine |
Increased arterial pressure |
| Prochlorperazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Promazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Promethazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Propericiazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Propiomazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Protriptyline |
The tricyclic increases the sympathomimetic effect |
| Rasagiline |
Increased arterial pressure |
| Reserpine |
Increased arterial pressure |
| Thiethylperazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Thioridazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Tranylcypromine |
Increased arterial pressure |
| Trifluoperazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Triflupromazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Trimeprazine |
Decreased anorexic effect, may increase psychotic symptoms |
| Trimipramine |
The tricyclic increases the sympathomimetic effect |
| Venlafaxine |
Risk of serotoninergic syndrome |
|
| Food Interactions |
- Limit caffeine intake.
- Take without regard to meals.
|
| Pathways |
Not Available
|
| General References |
- Drugs.com

- Wikipedia

|
| Organisms Affected |
|
| Phase 1 Metabolizing Enzymes |
- Monoamine oxidase type A (MAO-A)
|
| Targets |
- Alpha-2A adrenergic receptor
- Alpha-1A adrenergic receptor
|
|
Drug Target 1
[top]
|
| Target 1 ID |
318 |
| Target 1 Name |
Alpha-2A adrenergic receptor |
| Target 1 Synonyms |
- Alpha-2 adrenergic receptor subtype C10
- Alpha-2A adrenoceptor
- Alpha-2A adrenoreceptor
- Alpha-2AAR
|
| Target 1 Gene Name |
ADRA2A |
| Target 1 Protein Sequence |
>Alpha-2A adrenergic receptor
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
|
| Target 1 Number of Residues |
457 |
| Target 1 Molecular Weight |
48957 |
| Target 1 Theoretical pI |
10.20 |
| Target 1 GO Classification |
|
Function
|
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
alpha-adrenergic receptor activity
alpha2-adrenergic receptor activity |
|
Process
|
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 1 General Function |
Involved in alpha2-adrenergic receptor activity |
| Target 1 Specific Function |
Alpha-2 adrenergic receptors mediate the catecholamine- induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is oxymetazoline > clonidine > epinephrine > norepinephrine > phenylephrine > dopamine > p-synephrine > p-tyramine > serotonin = p-octopamine. For antagonists, the rank order is yohimbine > phentolamine = mianserine > chlorpromazine = spiperone = prazosin > propanolol > alprenolol = pindolol |
| Target 1 Pathways |
Not Available
|
| Target 1 Reactions |
Not Available |
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
- 34-59
- 71-96
- 107-129
- 150-173
- 193-217
- 375-399
- 407-430
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
178196  |
| Target 1 UniProtKB/Swiss-Prot ID |
P08913  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
ADA2A_HUMAN  |
| Target 1 PDB ID |
1HOF  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
- Membrane
- multi-pass membrane protein
|
| Target 1 Gene Sequence |
>1353 bp
ATGGGCTCCCTGCAGCCGGACGCGGGCAACGCGAGCTGGAACGGGACCGAGGCGCCGGGG
GGCGGCGCCCGGGCCACCCCTTACTCCCTGCAGGTGACGCTGACGCTGGTGTGCCTGGCC
GGCCTGCTCATGCTGCTCACCGTGTTCGGCAACGTGCTCGTCATCATCGCCGTGTTCACG
AGCCGCGCGCTCAAGGCGCCCCAAAACCTCTTCCTGGTGTCTCTGGCCTCGGCCGACATC
CTGGTGGCCACGCTCGTCATCCCTTTCTCGCTGGCCAACGAGGTCATGGGCTACTGGTAC
TTCGGCAAGGCTTGGTGCGAGATCTACCTGGCGCTCGACGTGCTCTTCTGCACGTCGTCC
ATCGTGCACCTGTGCGCCATCAGCCTGGACCGCTACTGGTCCATCACACAGGCCATCGAG
TACAACCTGAAGCGCACGCCGCGCCGCATCAAGGCCATCATCATCACCGTGTGGGTCATC
TCGGCCGTCATCTCCTTCCCGCCGCTCATCTCCATCGAGAAGAAGGGCGGCGGCGGCGGC
CCGCAGCCGGCCGAGCCGCGCTGCGAGATCAACGACCAGAAGTGGTACGTCATCTCGTCG
TGCATCGGCTCCTTCTTCGCTCCCTGCCTCATCATGATCCTGGTCTACGTGCGCATCTAC
CAGATCGCCAAGCGTCGCACCCGCGTGCCACCCAGCCGCCGGGGTCCGGACGCCGTCGCC
GCGCCGCCGGGGGGCACCGAGCGCAGGCCCAACGGTCTGGGCCCCGAGCGCAGCGCGGGC
CCGGGGGGCGCAGAGGCCGAACCGCTGCCCACCCAGCTCAACGGCGCCCCTGGCGAGCCC
GCGCCGGCCGGGCCGCGCGACACCGACGCGCTGGACCTGGAGGAGAGCTCGTCTTCCGAC
CACGCCGAGCGGCCTCCAGGGCCCCGCAGACCCGAGCGCGGTCCCCGGGGCAAAGGCAAG
GCCCGAGCGAGCCAGGTGAAGCCGGGCGACAGCCTGCGCGGCGCGGGCCGGGGGCGACGG
GGATCGGGACGCCGGCTGCAGGGCCGGGGGAGGAGCGCGTCGGGGCTGCCAAGGCGTCGC
GCTGGCGCGGGCGGGCAGAACCGCGAGAAGCGCTTCACGTTCGTGCTGGCCGTGGTCATC
GGAGTGTTCGTGGTGTGCTGGTTCCCCTTCTTCTTCACCTACACGCTCACGGCCGTCGGG
TGCTCCGTGCCACGCACGCTCTTCAAATTCTTCTTCTGGTTCGGCTACTGCAACAGCTCG
TTGAACCCGGTCATCTACACCATCTTCAACCACGATTTCCGCCGCGCCTTCAAGAAGATC
CTCTGTCGGGGGGACAGGAAGCGGATCGTGTGA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
ADRA2A  |
| Target 1 GenAtlas ID |
ADRA2A  |
| Target 1 HGNC ID |
HGNC:281  |
| Target 1 Chromosome Location |
10 |
| Target 1 Locus |
10q24-q26 |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Chung DA, Zuiderweg ER, Fowler CB, Soyer OS, Mosberg HI, Neubig RR: NMR structure of the second intracellular loop of the alpha 2A adrenergic receptor: evidence for a novel cytoplasmic helix. Biochemistry. 2002 Mar 19;41(11):3596-604. [PubMed
]
- Suryanarayana S, Daunt DA, Von Zastrow M, Kobilka BK: A point mutation in the seventh hydrophobic domain of the alpha 2 adrenergic receptor increases its affinity for a family of beta receptor antagonists. J Biol Chem. 1991 Aug 15;266(23):15488-92. [PubMed
]
- Wang CD, Buck MA, Fraser CM: Site-directed mutagenesis of alpha 2A-adrenergic receptors: identification of amino acids involved in ligand binding and receptor activation by agonists. Mol Pharmacol. 1991 Aug;40(2):168-79. [PubMed
]
- Chhajlani V, Rangel N, Uhlen S, Wikberg JE: Identification of an additional gene belonging to the alpha 2 adrenergic receptor family in the human genome by PCR. FEBS Lett. 1991 Mar 25;280(2):241-4. [PubMed
]
- Guyer CA, Horstman DA, Wilson AL, Clark JD, Cragoe EJ Jr, Limbird LE: Cloning, sequencing, and expression of the gene encoding the porcine alpha 2-adrenergic receptor. Allosteric modulation by Na+, H+, and amiloride analogs. J Biol Chem. 1990 Oct 5;265(28):17307-17. [PubMed
]
- Fraser CM, Arakawa S, McCombie WR, Venter JC: Cloning, sequence analysis, and permanent expression of a human alpha 2-adrenergic receptor in Chinese hamster ovary cells. Evidence for independent pathways of receptor coupling to adenylate cyclase attenuation and activation. J Biol Chem. 1989 Jul 15;264(20):11754-61. [PubMed
]
- Kobilka BK, Matsui H, Kobilka TS, Yang-Feng TL, Francke U, Caron MG, Lefkowitz RJ, Regan JW: Cloning, sequencing, and expression of the gene coding for the human platelet alpha 2-adrenergic receptor. Science. 1987 Oct 30;238(4827):650-6. [PubMed
]
|
| Target 1 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
556 |
| Target 2 Name |
Alpha-1A adrenergic receptor |
| Target 2 Synonyms |
- Alpha 1A- adrenoreceptor
- Alpha 1A-adrenoceptor
- Alpha adrenergic receptor 1c
- Alpha-1C adrenergic receptor
|
| Target 2 Gene Name |
ADRA1A |
| Target 2 Protein Sequence |
>Alpha-1A adrenergic receptor
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
|
| Target 2 Number of Residues |
473 |
| Target 2 Molecular Weight |
51487 |
| Target 2 Theoretical pI |
9.23 |
| Target 2 GO Classification |
|
Function
|
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
alpha-adrenergic receptor activity
alpha1-adrenergic receptor activity |
|
Process
|
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 2 General Function |
Involved in alpha1-adrenergic receptor activity |
| Target 2 Specific Function |
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins |
| Target 2 Pathways |
Not Available
|
| Target 2 Reactions |
Not Available |
| Target 2 Pfam Domain Function |
|
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
- 28-51
- 65-88
- 100-122
- 144-167
- 182-205
- 274-297
- 306-329
|
| Target 2 Essentiality |
Non-Essential |
| Target 2 GenBank ID Protein |
433201  |
| Target 2 UniProtKB/Swiss-Prot ID |
P35348  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
ADA1A_HUMAN  |
| Target 2 PDB ID |
Not Available |
| Target 2 Cellular Location |
- Membrane
- multi-pass membrane protein
|
| Target 2 Gene Sequence |
>1401 bp
ATGGTGTTTCTCTCGGGAAATGCTTCCGACAGCTCCAACTGCACCCAACCGCCGGCACCG
GTGAACATTTCCAAGGCCATTCTGCTCGGGGTGATCTTGGGGGGCCTCATTCTTTTCGGG
GTGCTGGGTAACATCCTAGTGATCCTCTCCGTAGCCTGTCACCGACACCTGCACTCAGTC
ACGCACTACTACATCGTCAACCTGGCGGTGGCCGACCTCCTGCTCACCTCCACGGTGCTG
CCCTTCTCCGCCATCTTCGAGGTCCTAGGCTACTGGGCCTTCGGCAGGGTCTTCTGCAAC
ATCTGGGCGGCAGTGGATGTGCTGTGCTGCACCGCGTCCATCATGGGCCTCTGCATCATC
TCCATCGACCGCTACATCGGCGTGAGCTACCCGCTGCGCTACCCAACCATCGTCACCCAG
AGGAGGGGTCTCATGGCTCTGCTCTGCGTCTGGGCACTCTCCCTGGTCATATCCATTGGA
CCCCTGTTCGGCTGGAGGCAGCCGGCCCCCGAGGACGAGACCATCTGCCAGATCAACGAG
GAGCCGGGCTACGTGCTCTTCTCAGCGCTGGGCTCCTTCTACCTGCCTCTGGCCATCATC
CTGGTCATGTACTGCCGCGTCTACGTGGTGGCCAAGAGGGAGAGCCGGGGCCTCAAGTCT
GGCCTCAAGACCGACAAGTCGGACTCGGAGCAAGTGACGCTCCGCATCCATCGGAAAAAC
GCCCCGGCAGGAGGCAGCGGGATGGCCAGCGCCAAGACCAAGACGCACTTCTCAGTGAGG
CTCCTCAAGTTCTCCCGGGAGAAGAAAGCGGCCAAAACGCTGGGCATCGTGGTCGGCTGC
TTCGTCCTCTGCTGGCTGCCTTTTTTCTTAGTCATGCCCATTGGGTCTTTCTTCCCTGAT
TTCAAGCCCTCTGAAACAGTTTTTAAAATAGTATTTTGGCTCGGATATCTAAACAGCTGC
ATCAACCCCATCATATACCCATGCTCCAGCCAAGAGTTCAAAAAGGCCTTTCAGAATGTC
TTGAGAATCCAGTGTCTCCGCAGAAAGCAGTCTTCCAAACATGCCCTGGGCTACACCCTG
CACCCGCCCAGCCAGGCCGTGGAAGGGCAACACAAGGACATGGTGCGCATCCCCGTGGGA
TCAAGAGAGACCTTCTACAGGATCTCCAAGACGGATGGCGTTTGTGAATGGAAATTTTTC
TCTTCCATGCCCCGTGGATCTGCCAGGATTACAGTGTCCAAAGACCAATCCTCCTGTACC
ACAGCCCGGGTGAGAAGTAAAAGCTTTTTGGAGGTCTGCTGCTGTGTAGGGCCCTCAACC
CCCAGCCTTGACAAGAACCATCAAGTTCCAACCATTAAGGTCCACACCATCTCCCTCAGT
GAGAACGGGGAGGAAGTCTAG
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
ADRA1A  |
| Target 2 GenAtlas ID |
ADRA1A  |
| Target 2 HGNC ID |
HGNC:277  |
| Target 2 Chromosome Location |
8 |
| Target 2 Locus |
8p21-p11.2 |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Hirasawa A, Shibata K, Horie K, Takei Y, Obika K, Tanaka T, Muramoto N, Takagaki K, Yano J, Tsujimoto G: Cloning, functional expression and tissue distribution of human alpha 1c-adrenoceptor splice variants. FEBS Lett. 1995 Apr 24;363(3):256-60. [PubMed
]
- Schwinn DA, Johnston GI, Page SO, Mosley MJ, Wilson KH, Worman NP, Campbell S, Fidock MD, Furness LM, Parry-Smith DJ, et al.: Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. [PubMed
]
- Weinberg DH, Trivedi P, Tan CP, Mitra S, Perkins-Barrow A, Borkowski D, Strader CD, Bayne M: Cloning, expression and characterization of human alpha adrenergic receptors alpha 1a, alpha 1b and alpha 1c. Biochem Biophys Res Commun. 1994 Jun 30;201(3):1296-304. [PubMed
]
- Forray C, Bard JA, Wetzel JM, Chiu G, Shapiro E, Tang R, Lepor H, Hartig PR, Weinshank RL, Branchek TA, et al.: The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype. Mol Pharmacol. 1994 Apr;45(4):703-8. [PubMed
]
- Hirasawa A, Horie K, Tanaka T, Takagaki K, Murai M, Yano J, Tsujimoto G: Cloning, functional expression and tissue distribution of human cDNA for the alpha 1C-adrenergic receptor. Biochem Biophys Res Commun. 1993 Sep 15;195(2):902-9. [PubMed
]
- Tseng-Crank J, Kost T, Goetz A, Hazum S, Roberson KM, Haizlip J, Godinot N, Robertson CN, Saussy D: The alpha 1C-adrenoceptor in human prostate: cloning, functional expression, and localization to specific prostatic cell types. Br J Pharmacol. 1995 Aug;115(8):1475-85. [PubMed
]
- Chang DJ, Chang TK, Yamanishi SS, Salazar FH, Kosaka AH, Khare R, Bhakta S, Jasper JR, Shieh IS, Lesnick JD, Ford AP, Daniels DV, Eglen RM, Clarke DE, Bach C, Chan HW: Molecular cloning, genomic characterization and expression of novel human alpha1A-adrenoceptor isoforms. FEBS Lett. 1998 Jan 30;422(2):279-83. [PubMed
]
|
| Target 2 Drug References |
- Buckner SA, Milicic I, Daza AV, Meyer MD, Altenbach RJ, Williams M, Sullivan JP, Brioni JD: ABT-866, a novel alpha(1A)-adrenoceptor agonist with antagonist properties at the alpha(1B)- and alpha(1D)-adrenoceptor subtypes. Eur J Pharmacol. 2002 Aug 2;449(1-2):159-65. [PubMed
]
- Altenbach RJ, Khilevich A, Kolasa T, Rohde JJ, Bhatia PA, Patel MV, Searle XB, Yang F, Bunnelle WH, Tietje K, Bayburt EK, Carroll WA, Meyer MD, Henry R, Buckner SA, Kuk J, Daza AV, Milicic IV, Cain JC, Kang CH, Ireland LM, Carr TL, Miller TR, Hancock AA, Nakane M, Esbenshade TA, Brune ME, O'Neill AB, Gauvin DM, Katwala SP, Holladay MW, Brioni JD, Sullivan JP: Synthesis and structure-activity studies on N-[5-(1H-imidazol-4-yl)-5,6,7,8-tetrahydro-1-naphthalenyl]methanesulfonami de, an imidazole-containing alpha(1A)-adrenoceptor agonist. J Med Chem. 2004 Jun 3;47(12):3220-35. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Wellman PJ, McMahon LR, Green T, Tole A: Effects of the alpha 1a-adrenoceptor antagonist RS-17053 on phenylpropanolamine-induced anorexia in rats. Pharmacol Biochem Behav. 1997 May-Jun;57(1-2):281-4. [PubMed
]
|