Identification

Name
Alteplase
Accession Number
DB00009  (BTD00050, BIOD00050)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Thrombolytic agents
Description

Human tissue plasminogen activator, purified, glycosylated, 527 residues purified from CHO cells

Protein structure
Db00009
Protein chemical formula
C2569H3928N746O781S40
Protein average weight
59042.3 Da
Sequences
>Alteplase sequence
SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG
TCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSA
LAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDC
YFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAK
PWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRS
PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVH
KEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL
SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGG
PLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Download FASTA Format
Synonyms
  • Alteplase (genetical recombination)
  • Alteplase, recombinant
  • Alteplase,recombinant
  • Plasminogen activator (human tissue-type protein moiety)
  • rt-PA
  • t-PA
  • t-plasminogen activator
  • Tissue plasminogen activator
  • Tissue plasminogen activator alteplase
  • Tissue plasminogen activator, recombinant
  • tPA
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ActivaseKitGenentech, Inc.1987-11-13Not applicableUs
ActivaseKitGenentech, Inc.1987-11-13Not applicableUs
Activase RT-PA InjPowder, for solution29 mIntravenousHoffmann La Roche1987-12-311998-07-31Canada
CathfloPowder, for solution2 mgHoffmann La Roche2002-09-26Not applicableCanada
Cathflo ActivaseInjection, powder, lyophilized, for solution2.2 mg/2mLIntravenousGenentech, Inc.2001-09-04Not applicableUs
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Activase RT-PAAlteplase (50 mg) + Water (50 ml)Liquid; Powder, for solutionIntravenousHoffmann La Roche1998-04-12Not applicableCanada
Activase RT-PAAlteplase (100 mg) + Water (100 ml)Liquid; Powder, for solutionIntravenousHoffmann La Roche1996-12-31Not applicableCanada
Lysatec RT - PaAlteplase (50 mg) + Water (50 ml)Powder, for solutionIntravenousGenentech, Inc.1993-12-311997-08-26Canada
Categories
UNII
1RXS4UE564
CAS number
105857-23-6

Pharmacology

Indication

For management of acute myocardial infarction, acute ischemic strok and for lysis of acute pulmonary emboli

Structured Indications
Pharmacodynamics

Alteplase binds to fibrin in a thrombus and converts the entrapped plasminogen to plasmin. It also produces limited conversion of plasminogen in the absence of fibrin.

Mechanism of action

Alteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.

TargetActionsOrganism
APlasminogen
activator
Human
AFibrinogen alpha chainNot AvailableHuman
UUrokinase plasminogen activator surface receptorNot AvailableHuman
UPlasminogen activator inhibitor 1Not AvailableHuman
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Alteplase Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AbciximabAlteplase may increase the anticoagulant activities of Abciximab.Approved
AcenocoumarolAlteplase may increase the anticoagulant activities of Acenocoumarol.Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Acetylsalicylic acid is combined with Alteplase.Approved, Vet Approved
AloxiprinThe risk or severity of adverse effects can be increased when Aloxiprin is combined with Alteplase.Experimental
AlprostadilAlprostadil may increase the anticoagulant activities of Alteplase.Approved, Investigational
Aminosalicylic AcidThe risk or severity of adverse effects can be increased when Aminosalicylic Acid is combined with Alteplase.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Alteplase.Approved
AncrodAlteplase may increase the anticoagulant activities of Ancrod.Investigational
AndrographolideAndrographolide may increase the anticoagulant activities of Alteplase.Investigational
Antithrombin III humanAlteplase may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanAlteplase may increase the anticoagulant activities of Apixaban.Approved
AprotininThe therapeutic efficacy of Alteplase can be decreased when used in combination with Aprotinin.Approved, Withdrawn
ArdeparinAlteplase may increase the anticoagulant activities of Ardeparin.Approved, Investigational, Withdrawn
ArgatrobanAlteplase may increase the anticoagulant activities of Argatroban.Approved, Investigational
AzelastineAzelastine may increase the anticoagulant activities of Alteplase.Approved
BalsalazideThe risk or severity of adverse effects can be increased when Balsalazide is combined with Alteplase.Approved, Investigational
BecaplerminAlteplase may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BeraprostBeraprost may increase the anticoagulant activities of Alteplase.Investigational
BivalirudinAlteplase may increase the anticoagulant activities of Bivalirudin.Approved, Investigational
BuflomedilBuflomedil may increase the anticoagulant activities of Alteplase.Experimental
ButylphthalideButylphthalide may increase the anticoagulant activities of Alteplase.Investigational
CangrelorCangrelor may increase the anticoagulant activities of Alteplase.Approved
CertoparinAlteplase may increase the anticoagulant activities of Certoparin.Approved, Investigational
CilostazolCilostazol may increase the anticoagulant activities of Alteplase.Approved
Citric AcidAlteplase may increase the anticoagulant activities of Citric Acid.Approved, Nutraceutical, Vet Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Alteplase.Approved, Nutraceutical
CloricromenCloricromen may increase the anticoagulant activities of Alteplase.Experimental
Dabigatran etexilateAlteplase may increase the anticoagulant activities of Dabigatran etexilate.Approved
DalteparinAlteplase may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidAlteplase may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DarexabanAlteplase may increase the anticoagulant activities of Darexaban.Investigational
DefibrotideDefibrotide may increase the anticoagulant activities of Alteplase.Approved, Investigational
dersalazineThe risk or severity of adverse effects can be increased when dersalazine is combined with Alteplase.Investigational
DesirudinAlteplase may increase the anticoagulant activities of Desirudin.Approved
DextranAlteplase may increase the anticoagulant activities of Dextran.Approved, Vet Approved
Dextran 40Alteplase may increase the anticoagulant activities of Dextran 40.Approved
Dextran 70Alteplase may increase the anticoagulant activities of Dextran 70.Approved
Dextran 75Alteplase may increase the anticoagulant activities of Dextran 75.Approved
DicoumarolAlteplase may increase the anticoagulant activities of Dicoumarol.Approved
DiflunisalThe risk or severity of adverse effects can be increased when Diflunisal is combined with Alteplase.Approved
DipyridamoleDipyridamole may increase the anticoagulant activities of Alteplase.Approved
Edetic AcidAlteplase may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanAlteplase may increase the anticoagulant activities of Edoxaban.Approved
EnoxaparinAlteplase may increase the anticoagulant activities of Enoxaparin.Approved
EpinastineEpinastine may increase the anticoagulant activities of Alteplase.Approved, Investigational
EplivanserinEplivanserin may increase the anticoagulant activities of Alteplase.Investigational
eplivanserineeplivanserine may increase the anticoagulant activities of Alteplase.Investigational
EpoprostenolEpoprostenol may increase the anticoagulant activities of Alteplase.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Alteplase.Approved, Investigational
Ethyl biscoumacetateAlteplase may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
Ferulic acidAlteplase may increase the anticoagulant activities of Ferulic acid.Experimental
FluindioneAlteplase may increase the anticoagulant activities of Fluindione.Investigational
FondaparinuxAlteplase may increase the anticoagulant activities of Fondaparinux.Investigational
Fondaparinux sodiumAlteplase may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
GabexateAlteplase may increase the anticoagulant activities of Gabexate.Investigational
GuacetisalThe risk or severity of adverse effects can be increased when Guacetisal is combined with Alteplase.Experimental
Hemoglobin crosfumarilThe risk or severity of adverse effects can be increased when Hemoglobin crosfumaril is combined with Alteplase.Experimental
HeparinAlteplase may increase the anticoagulant activities of Heparin.Approved, Investigational
HydroxytyrosolHydroxytyrosol may increase the anticoagulant activities of Alteplase.Investigational
IbudilastIbudilast may increase the anticoagulant activities of Alteplase.Approved, Investigational
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Alteplase.Approved, Nutraceutical
IdraparinuxAlteplase may increase the anticoagulant activities of Idraparinux.Investigational
IfenprodilIfenprodil may increase the anticoagulant activities of Alteplase.Approved, Investigational, Withdrawn
IfetrobanIfetroban may increase the anticoagulant activities of Alteplase.Investigational
IloprostIloprost may increase the anticoagulant activities of Alteplase.Approved, Investigational
IndobufenIndobufen may increase the anticoagulant activities of Alteplase.Investigational
KetanserinKetanserin may increase the anticoagulant activities of Alteplase.Investigational
LepirudinAlteplase may increase the anticoagulant activities of Lepirudin.Approved
LetaxabanAlteplase may increase the anticoagulant activities of Letaxaban.Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Alteplase.Approved, Investigational
LinsidomineLinsidomine may increase the anticoagulant activities of Alteplase.Experimental
MelagatranAlteplase may increase the anticoagulant activities of Melagatran.Experimental
MesalazineThe risk or severity of adverse effects can be increased when Mesalazine is combined with Alteplase.Approved
Methyl salicylateThe risk or severity of adverse effects can be increased when Methyl salicylate is combined with Alteplase.Approved, Vet Approved
MilrinoneMilrinone may increase the anticoagulant activities of Alteplase.Approved
NadroparinAlteplase may increase the anticoagulant activities of Nadroparin.Approved
NafamostatAlteplase may increase the anticoagulant activities of Nafamostat.Approved, Investigational
NaftopidilNaftopidil may increase the anticoagulant activities of Alteplase.Investigational
NimesulideNimesulide may increase the anticoagulant activities of Alteplase.Approved, Investigational, Withdrawn
NitroaspirinThe risk or severity of adverse effects can be increased when Nitroaspirin is combined with Alteplase.Investigational
NitroglycerinThe serum concentration of Alteplase can be decreased when it is combined with Nitroglycerin.Approved, Investigational
OlsalazineThe risk or severity of adverse effects can be increased when Olsalazine is combined with Alteplase.Approved
OtamixabanAlteplase may increase the anticoagulant activities of Otamixaban.Investigational
Pentaerythritol TetranitrateAlteplase may increase the anticoagulant activities of Pentaerythritol Tetranitrate.Approved
Pentosan PolysulfateAlteplase may increase the anticoagulant activities of Pentosan Polysulfate.Approved
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Alteplase.Approved, Investigational
PhenindioneAlteplase may increase the anticoagulant activities of Phenindione.Approved, Investigational
PhenprocoumonAlteplase may increase the anticoagulant activities of Phenprocoumon.Approved, Investigational
PicotamidePicotamide may increase the anticoagulant activities of Alteplase.Experimental
PrasugrelPrasugrel may increase the anticoagulant activities of Alteplase.Approved
Protein CAlteplase may increase the anticoagulant activities of Protein C.Approved
Protein S humanAlteplase may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeAlteplase may increase the anticoagulant activities of Protocatechualdehyde.Approved
RamatrobanRamatroban may increase the anticoagulant activities of Alteplase.Investigational
ResveratrolResveratrol may increase the anticoagulant activities of Alteplase.Approved, Experimental, Investigational
ReviparinAlteplase may increase the anticoagulant activities of Reviparin.Approved, Investigational
RidogrelRidogrel may increase the anticoagulant activities of Alteplase.Approved
RivaroxabanAlteplase may increase the anticoagulant activities of Rivaroxaban.Approved
Salicylic acidThe risk or severity of adverse effects can be increased when Salicylic acid is combined with Alteplase.Approved, Vet Approved
SarpogrelateSarpogrelate may increase the anticoagulant activities of Alteplase.Investigational
SevofluraneSevoflurane may increase the anticoagulant activities of Alteplase.Approved, Vet Approved
SRT501SRT501 may increase the anticoagulant activities of Alteplase.Investigational
SulodexideAlteplase may increase the anticoagulant activities of Sulodexide.Approved, Investigational
TesmilifeneTesmilifene may increase the anticoagulant activities of Alteplase.Investigational
TicagrelorTicagrelor may increase the anticoagulant activities of Alteplase.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Alteplase.Approved
TirofibanTirofiban may increase the anticoagulant activities of Alteplase.Approved
TranilastTranilast may increase the anticoagulant activities of Alteplase.Approved, Investigational
TrapidilTrapidil may increase the anticoagulant activities of Alteplase.Approved
TreprostinilThe risk or severity of adverse effects can be increased when Alteplase is combined with Treprostinil.Approved, Investigational
TriflusalTriflusal may increase the anticoagulant activities of Alteplase.Approved, Investigational
Trolamine salicylateThe risk or severity of adverse effects can be increased when Trolamine salicylate is combined with Alteplase.Approved
TroxerutinAlteplase may increase the anticoagulant activities of Troxerutin.Investigational
VorapaxarVorapaxar may increase the anticoagulant activities of Alteplase.Approved
WarfarinAlteplase may increase the anticoagulant activities of Warfarin.Approved
XimelagatranAlteplase may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
Food Interactions
Not Available

References

General References
Not Available
External Links
UniProt
P00750
Genbank
L00153
KEGG Drug
D02837
PubChem Substance
46507035
ChEMBL
CHEMBL1201593
Therapeutic Targets Database
DAP000203
PharmGKB
PA164776730
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Alteplase
ATC Codes
S01XA13 — AlteplaseB01AD02 — Alteplase
AHFS Codes
  • 20:12.20 — Thrombolytic Agents
FDA label
Download (1.98 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedTreatmentStrokes1
1TerminatedTreatmentStrokes1
1TerminatedTreatmentThrombosis1
1Unknown StatusTreatmentCentral Retinal Vein Occlusion (CRVO)1
1WithdrawnTreatmentStroke, Ischemic1
1, 2CompletedTreatmentStrokes1
1, 2WithdrawnPreventionCerebral Aneurysms / Cerebral Vasospasm / Hydrocephaly / Subarachnoid Hemorrhage1
2Active Not RecruitingTreatmentDamage in the Anterior Spinal Artery (ASA) / Motor Weakness in Two or Four Limbs / Temperature and Superficial Sensation / Urinary Retention or Bowel Disorder1
2Active Not RecruitingTreatmentHypertensive Intracerebral Hemorrhage1
2Active Not RecruitingTreatmentStroke, Acute1
2Active Not RecruitingTreatmentStroke, Ischemic1
2CompletedTreatmentAbdominal Abscess / Pelvic Abscess1
2CompletedTreatmentAcute Deep Venous Thrombosis of the Lower Extremity1
2CompletedTreatmentBrain Infarction / Stroke, Ischemic / Strokes1
2CompletedTreatmentIntracerebral Hemorrhage1
2CompletedTreatmentIntraventricular Hemorrhage1
2CompletedTreatmentStroke, Ischemic1
2Not Yet RecruitingTreatmentCerebral Artery / Nervous System Disorders1
2Not Yet RecruitingTreatmentPlastic Bronchitis1
2RecruitingTreatmentAcute Pulmonary Embolism1
2RecruitingTreatmentMyocardial Infarction (MI)1
2Unknown StatusTreatmentAneurysmal Subarachnoid Hemorrhage / Intraventricular Hemorrhage1
2Unknown StatusTreatmentStrokes3
2, 3Not Yet RecruitingTreatmentStroke, Ischemic1
2, 3RecruitingTreatmentExudative Macular Degeneration / Retinal Hemorrhage1
2, 3TerminatedTreatmentSinus Thrombosis, Intracranial1
2, 3WithdrawnTreatmentStroke, Ischemic1
3Active Not RecruitingTreatmentStrokes2
3CompletedTreatmentAcute Pulmonary Embolism / Massive Pulmonary Embolism / Prophylaxis of Pulmonary embolism / Pulmonary Thromboembolisms / Sub-massive Pulmonary Embolism1
3CompletedTreatmentAngina Pectoris / Cardiovascular Disease (CVD) / Coronary Heart Disease (CHD) / Heart Diseases / Myocardial Infarction (MI) / Myocardial Ischemia1
3CompletedTreatmentCardiovascular Disease (CVD) / Coronary Heart Disease (CHD) / Heart Diseases / Myocardial Infarction (MI) / Myocardial Ischemia2
3CompletedTreatmentCerebral Infarctions / Ischemia, Brain1
3CompletedTreatmentCerebrovascular Accidents / Strokes1
3CompletedTreatmentDeep Vein Thrombosis (DVT) / Post Thrombotic Syndrome / Postphlebitic Syndrome / Thrombosis, Venous / Venous Thromboembolism1
3CompletedTreatmentIntraventricular Hemorrhage1
3CompletedTreatmentMyocardial Infarction (MI)2
3CompletedTreatmentStroke, Ischemic1
3Not Yet RecruitingTreatmentCentral Retinal Artery Occlusion1
3Not Yet RecruitingTreatmentDeep Vein Thrombosis (DVT) / Post-Thrombotic Syndrome / Thrombosis, Venous1
3Not Yet RecruitingTreatmentMyocardial Infarction (MI) / Percutaneous Coronary Intervention1
3Not Yet RecruitingTreatmentProphylaxis of Pulmonary embolism1
3RecruitingTreatmentIntracerebral Hemorrhage1
3RecruitingTreatmentPleural Empyema1
3RecruitingTreatmentST Segment Elevation Myocardial Infarction (STEMI)1
3RecruitingTreatmentStroke, Ischemic1
3RecruitingTreatmentStrokes3
3SuspendedTreatmentAbscess, Intra-Abdominal1
3TerminatedTreatmentIschemia, Brain / Strokes1
3TerminatedTreatmentStrokes1
4Active Not RecruitingTreatmentAcute ST Elevation Myocardial Infarction1
4CompletedTreatmentAcute ST-segment Elevation Myocardial Infarction1
4CompletedTreatmentDysfunctional Central Venous Access Devices (CVADS)1
4CompletedTreatmentStrokes1
4CompletedTreatmentProphylaxis of Pulmonary embolism / Thromboembolism1
4RecruitingTreatmentPleural Diseases1
4TerminatedTreatmentMiddle Cerebral Artery Infarction1
4TerminatedTreatmentThrombosis1
4Unknown StatusTreatmentMalfunction; Catheter / Mechanical Complication of Hemodialysis Catheter / Thrombosis1
4Unknown StatusTreatmentProphylaxis of Pulmonary embolism / Pulmonary Thromboembolisms1
Not AvailableActive Not RecruitingPreventionTransplantation, Kidney / Transplantation, Liver1
Not AvailableActive Not RecruitingTreatmentChronic Renal Insufficiency1
Not AvailableCompletedNot AvailableStrokes2
Not AvailableCompletedTreatmentAcute Ischemic Stroke (AIS)1
Not AvailableCompletedTreatmentBacterial Pleural Effusion Other Than Tuberculosis / Pleural Effusion Associated With Pulmonary Infection1
Not AvailableCompletedTreatmentProsthetic Valve Thrombosis1
Not AvailableNot Yet RecruitingOtherCollateral Circulation, Any Site1
Not AvailableRecruitingNot AvailableStroke, Ischemic1
Not AvailableRecruitingNot AvailableStrokes2
Not AvailableRecruitingTreatmentKidney Diseases1
Not AvailableRecruitingTreatmentStroke, Ischemic1
Not AvailableTerminatedNot AvailableMyocardial Infarction (MI)1
Not AvailableTerminatedNot AvailableStroke, Ischemic / Transient Ischaemic Attack (TIA)1
Not AvailableTerminatedTreatmentAcute Ischaemic Stroke1
Not AvailableUnknown StatusNot AvailableStroke, Ischemic1
Not AvailableUnknown StatusNot AvailableStrokes1
Not AvailableUnknown StatusTreatmentEmpyema / Pleural Effusions1
Not AvailableWithdrawnNot AvailableAcute Coronary Syndromes (ACS) / Non ST Elevation Myocardial Infarction / ST Elevation Myocardial Infarction / Unstable Angina (UA)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Kit
Liquid; powder, for solutionIntravenous
Powder, for solutionIntravenous29 m
Powder, for solution2 mg
Injection, powder, lyophilized, for solutionIntravenous2.2 mg/2mL
Powder, for solutionIntravenous
Prices
Unit descriptionCostUnit
Activase 100 mg vial4779.71USD vial
Activase 50 mg vial2389.85USD vial
Cathflo activase 2 mg vial106.33USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)60 °CNovokhatny, V.V. et al., J. Biol. Chem. 266:12994-123002 (1991)
hydrophobicity-0.516Not Available
isoelectric point7.61Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Activator
General Function
Serine-type peptidase activity
Specific Function
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In...
Gene Name
PLG
Uniprot ID
P00747
Uniprot Name
Plasminogen
Molecular Weight
90568.415 Da
References
  1. Longstaff C, Williams S, Thelwell C: Fibrin binding and the regulation of plasminogen activators during thrombolytic therapy. Cardiovasc Hematol Agents Med Chem. 2008 Jul;6(3):212-23. [PubMed:18673235]
  2. Melandri G, Vagnarelli F, Calabrese D, Semprini F, Nanni S, Branzi A: Review of tenecteplase (TNKase) in the treatment of acute myocardial infarction. Vasc Health Risk Manag. 2009;5(1):249-56. Epub 2009 Apr 8. [PubMed:19436656]
  3. Hilleman DE, Tsikouris JP, Seals AA, Marmur JD: Fibrinolytic agents for the management of ST-segment elevation myocardial infarction. Pharmacotherapy. 2007 Nov;27(11):1558-70. [PubMed:17963464]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Human
Pharmacological action
Yes
General Function
Structural molecule activity
Specific Function
Cleaved by the protease thrombin to yield monomers which, together with fibrinogen beta (FGB) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function ...
Gene Name
FGA
Uniprot ID
P02671
Uniprot Name
Fibrinogen alpha chain
Molecular Weight
94972.455 Da
References
  1. Longstaff C, Williams S, Thelwell C: Fibrin binding and the regulation of plasminogen activators during thrombolytic therapy. Cardiovasc Hematol Agents Med Chem. 2008 Jul;6(3):212-23. [PubMed:18673235]
  2. Melandri G, Vagnarelli F, Calabrese D, Semprini F, Nanni S, Branzi A: Review of tenecteplase (TNKase) in the treatment of acute myocardial infarction. Vasc Health Risk Manag. 2009;5(1):249-56. Epub 2009 Apr 8. [PubMed:19436656]
  3. Hilleman DE, Tsikouris JP, Seals AA, Marmur JD: Fibrinolytic agents for the management of ST-segment elevation myocardial infarction. Pharmacotherapy. 2007 Nov;27(11):1558-70. [PubMed:17963464]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Urokinase plasminogen activator receptor activity
Specific Function
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-...
Gene Name
PLAUR
Uniprot ID
Q03405
Uniprot Name
Urokinase plasminogen activator surface receptor
Molecular Weight
36977.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase inhibitor activity
Specific Function
Serine protease inhibitor. This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, protein C and matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major con...
Gene Name
SERPINE1
Uniprot ID
P05121
Uniprot Name
Plasminogen activator inhibitor 1
Molecular Weight
45059.695 Da
References
  1. Hilleman DE, Tsikouris JP, Seals AA, Marmur JD: Fibrinolytic agents for the management of ST-segment elevation myocardial infarction. Pharmacotherapy. 2007 Nov;27(11):1558-70. [PubMed:17963464]

Drug created on June 13, 2005 07:24 / Updated on December 10, 2017 17:18