Identification
NameSargramostim
Accession NumberDB00020  (BTD00035, BIOD00035)
TypeBiotech
GroupsApproved, Investigational
Description

Sargramostim is a human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF) expressed in yeast. It is a glycoprotein that is 127 residues. Substitution of Leu23 leads to a difference from native protein.

Protein structureDb00020
Related Articles
Protein chemical formulaC639H1006N168O196S8
Protein average weight14434.5 Da
Sequences
>DB00020 sequence
APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLE
LYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFD
CWEPVQE
Download FASTA Format
Synonyms
GM-CSF
External IDs Not Available
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
LeukineLiquid500 ug/mLIntravenous; SubcutaneousSanofi Aventis1996-12-01Not applicableUs
LeukineInjection, powder, for solution250 ug/mLIntravenous; SubcutaneousGenzyme Corporation2010-03-152016-06-30Us
LeukineInjection, powder, for solution250 ug/mLIntravenous; SubcutaneousSanofi Aventis1991-05-01Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
LeucomaxNovartis
Brand mixturesNot Available
Categories
UNII5TAA004E22
CAS number123774-72-1
Pharmacology
Indication

For the treatment of cancer and bone marrow transplant

Structured Indications
Pharmacodynamics

Sargramostim is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy an recovering from acut myelogenous leukemia, Leukine or GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.

Mechanism of action

Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor (GM-CSF-R-alpha or CSF2R) which stimulates a JAK2 STAT1/STAT3 signal transduction pathway. This leads to the production of hemopoietic cells and neutrophils

TargetKindPharmacological actionActionsOrganismUniProt ID
Granulocyte-macrophage colony-stimulating factor receptor subunit alphaProteinyes
agonist
HumanP15509 details
Interleukin-3 receptor subunit alphaProteinyes
agonist
HumanP26951 details
Cytokine receptor common subunit betaProteinyes
agonist
HumanP32927 details
Syndecan-2Proteinunknown
agonist
HumanP34741 details
Bone marrow proteoglycanProteinunknownNot AvailableHumanP13727 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
Clearance
  • 420 mL/min/m2 [Normal people with liquid LEUKINE (IV)]
  • 431 mL/min/m2 [Normal people with lyophilized LEUKINE (IV)]
  • 549 mL/min/m2 [Normal people with liquid LEUKINE (SC)]
  • 529 mL/min/m2 [Normal people with lyophilized LEUKINE (SC)]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
BleomycinThe risk or severity of adverse effects can be increased when Sargramostim is combined with Bleomycin.Approved
CyclophosphamideThe risk or severity of adverse effects can be increased when Cyclophosphamide is combined with Sargramostim.Approved, Investigational
Food InteractionsNot Available
References
Synthesis Reference

Kaname Sugimoto, “Process for the production of human colony-stimulating factor.” U.S. Patent US4621050, issued May, 1983.

US4621050
General ReferencesNot Available
External Links
ATC CodesL03AA09
AHFS CodesNot Available
PDB Entries
FDA labelNot Available
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0Unknown StatusTreatmentMyasthenia Gravis1
1Active Not RecruitingOtherLocally Advanced Pancreatic Adenocarcinoma1
1Active Not RecruitingTreatmentAcute Myelogenous Leukaemia (AML) / Multiple Myeloma (MM) / Myelodysplastic Syndromes (MDS) / Smoldering Multiple Myeloma (SMM)1
1Active Not RecruitingTreatmentAdenocarcinomas / Cancer, Breast / Cancer, Ovarian / Colorectal Cancers1
1Active Not RecruitingTreatmentDisorder Related to Transplantation / Leukemias / Lymphoid Malignancies / Lymphoma NOS / Transplantation, Stem Cell1
1Active Not RecruitingTreatmentGlioblastomas1
1Active Not RecruitingTreatmentHER2-positive Breast Cancer / Stage III Ovarian Epithelial Cancer / Stage III Ovarian Germ Cell Tumor / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Stage IV Ovarian Epithelial Cancer / Stage IV Ovarian Germ Cell Tumor1
1Active Not RecruitingTreatmentMelanoma (Skin)1
1Active Not RecruitingTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
1Active Not RecruitingTreatmentPancreatic Acinar Cell Carcinoma / Pancreatic Ductal Adenocarcinoma / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
1Active Not RecruitingTreatmentPancreatic Cancers / Resectable Pancreatic Adenocarcinoma1
1Active Not RecruitingTreatmentRecurrent Fallopian Tube Cancer / Recurrent Ovarian Epithelial Cancer / Recurrent Primary Peritoneal Cavity Cancer / Stage IIA Fallopian Tube Cancer / Stage IIA Ovarian Epithelial Cancer / Stage IIA Primary Peritoneal Cavity Cancer / Stage IIB Fallopian Tube Cancer / Stage IIB Ovarian Epithelial Cancer / Stage IIB Primary Peritoneal Cavity Cancer / Stage IIC Fallopian Tube Cancer / Stage IIC Ovarian Epithelial Cancer / Stage IIC Primary Peritoneal Cavity Cancer / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Epithelial Cancer / Stage IIIA Primary Peritoneal Cavity Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Epithelial Cancer / Stage IIIB Primary Peritoneal Cavity Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Epithelial Cancer / Stage IIIC Primary Peritoneal Cavity Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Epithelial Cancer / Stage IV Primary Peritoneal Cavity Cancer1
1Active Not RecruitingTreatmentRecurrent Prostate Carcinoma / Stage IV Prostate Cancer1
1Active Not RecruitingTreatmentRefractory Multiple Myeloma / Stage I Multiple Myeloma / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
1CompletedNot AvailableDendritic Cell Deficiency1
1CompletedPreventionHuman Immunodeficiency Virus (HIV) Infections2
1CompletedTreatmentAccelerated Phase Chronic Myelogenous Leukemia / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Blastic Phase Chronic Myelogenous Leukemia / Chronic Myelomonocytic Leukemia / Chronic Phase Chronic Myelogenous Leukemia / Paroxysmal Nocturnal Hemoglobinuria (PNH) / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Myeloid Leukemia / Refractory Anemia / Refractory Anemia With Ringed Sideroblasts / Relapsing Chronic Myelogenous Leukemia / Thrombocytopenias / Untreated Adult Acute Myeloid Leukemia1
1CompletedTreatmentAdenocarcinoma of the Colon / Adenocarcinoma of the Gallbladder / Adenocarcinoma of the Pancreas / Adenocarcinoma of the Rectum / Adult Primary Hepatocellular Carcinoma / Advanced Adult Primary Liver Cancer / Cholangiocarcinoma of the Gallbladder / Diffuse Adenocarcinoma of the Stomach / Intestinal Adenocarcinoma of the Stomach / Male Breast Cancer / Mixed Adenocarcinoma of the Stomach / Ovarian Endometrioid Adenocarcinoma / Paget Disease of the Breast With Intraductal Carcinoma / Paget Disease of the Breast With Invasive Ductal Carcinoma / Recurrent Adult Primary Liver Cancer / Recurrent Breast Cancer / Recurrent Colon Cancer / Recurrent Gallbladder Cancer / Recurrent Gastric Cancer / Recurrent Malignant Testicular Germ Cell Tumor / Recurrent Pancreatic Cancer / Recurrent Rectal Cancer / Recurrent Salivary Gland Cancer / Salivary Gland Adenocarcinoma / Stage II Malignant Testicular Germ Cell Tumor / Stage II Pancreatic Cancer / Stage III Colon Cancer / Stage III Gastric Cancer / Stage III Malignant Testicular Germ Cell Tumor / Stage III Pancreatic Cancer / Stage III Rectal Cancer / Stage III Salivary Gland Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IV Breast Cancer / Stage IV Colon Cancer / Stage IV Gastric Cancer / Stage IV Pancreatic Cancer / Stage IV Rectal Cancer / Stage IV Salivary Gland Cancer / Thyroid Gland Medullary Carcinoma / Unresectable Gallbladder Cancer1
1CompletedTreatmentAdult Solid Neoplasm1
1CompletedTreatmentAnaplastic Astrocytoma (AA) / Anaplastic Oligoastrocytoma / Anaplastic Oligodendroglioma (AO) / Giant Cell Glioblastoma / Glioblastomas / Gliosarcoma / Mixed Gliomas / Recurrent Brain Neoplasm1
1CompletedTreatmentBladder Cancers1
1CompletedTreatmentBrain and Central Nervous System Tumors1
1CompletedTreatmentBrain and Central Nervous System Tumors / Gastrointestinal Stromal Tumors / Sarcomas1
1CompletedTreatmentCancer, Breast2
1CompletedTreatmentCancer, Breast / Cancer, Ovarian / Lung Cancers2
1CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cavity Cancer1
1CompletedTreatmentCancer, Ovarian / Primary Peritoneal Cavity Cancer1
1CompletedTreatmentCarcinoma of the Prostate2
1CompletedTreatmentCytopenias / Human Immunodeficiency Virus (HIV) Infections4
1CompletedTreatmentDisseminated Neuroblastoma / Recurrent Neuroblastoma / Regional Neuroblastoma1
1CompletedTreatmentFollicular Lymphoma (FL) / Lymphoma NOS / Lymphoma, B Cell1
1CompletedTreatmentHodgkins Disease (HD) / Leukemias / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL) / Other Plasma Cell Dyscrasia (Waldenstrom, Amyloidosis)1
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Kaposi s Sarcoma (KS)2
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Non-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentIntraocular Melanoma / Malignant Conjunctival Neoplasm / Melanoma (Skin)1
1CompletedTreatmentLeukemias1
1CompletedTreatmentLeukemias / Lung Cancers / Mesothelioma, Malignant / Myelodysplastic Syndromes / Primary Peritoneal Cavity Cancer1
1CompletedTreatmentLeukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
1CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
1CompletedTreatmentLung Cancers1
1CompletedTreatmentLymphoma NOS1
1CompletedTreatmentMalignant Melanoma1
1CompletedTreatmentMelanoma (Skin)3
1CompletedTreatmentMelanoma (Skin) / Metastatic Cancers1
1CompletedTreatmentNeuroblastomas1
1CompletedTreatmentNonneoplastic Condition1
1CompletedTreatmentParkinson's Disease (PD)1
1CompletedTreatmentPeriodontitis1
1CompletedTreatmentProstatic Neoplasms1
1CompletedTreatmentPulmonary Alveolar Proteinosis, Autoimmune1
1CompletedTreatmentRecurrent Fallopian Tube Cancer / Recurrent Ovarian Epithelial Cancer / Recurrent Primary Peritoneal Cavity Cancer1
1Not Yet RecruitingBasic ScienceAutoimmune Pulmonary Alveolar Proteinosis1
1Not Yet RecruitingTreatmentPediatric Acute Respiratory Distress Syndrome1
1RecruitingPreventionHER2/Neu Negative / No Evidence of Disease / One or More Positive Axillary Nodes / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
1RecruitingPreventionHER2/Neu Negative / No Evidence of Disease / One or More Positive Axillary Nodes / Stage IB Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer1
1RecruitingTreatmentAdvanced Malignancies / Cancer, Advanced1
1RecruitingTreatmentAstrocytomas / Childhood Astrocytoma / Childhood Atypical Teratoid/Rhabdoid Tumor / Diffuse Intrinsic Pontine Glioma (DIPG) / Gliomas / Recurrent Childhood Anaplastic Oligodendroglioma / Recurrent Childhood Brain Neoplasm / Recurrent Childhood Glioblastoma / Recurrent Childhood Medulloblastoma / Recurrent Primitive Neuroectodermal Tumor / Refractory Brain Neoplasm1
1RecruitingTreatmentCancer, Breast / Gastric Cancers1
1RecruitingTreatmentCarcinoma of the Prostate2
1RecruitingTreatmentHigh-risk Tumor / Lymphoma NOS / Neuroblastomas1
1RecruitingTreatmentPartial Response of Multiple Myeloma or Plasma Cell Leukemia / Plasma Cell Myeloma1
1RecruitingTreatmentRecurrent Prostate Cancer / Stage I Prostate Cancer / Stage IIA Prostate Cancer / Stage IIB Prostate Cancer1
1TerminatedSupportive CareLymphoma NOS / Neutropenias1
1TerminatedTreatmentBrain and Central Nervous System Tumors / Kidney Cancer / Liver Cancer / Retinoblastoma / Sarcomas1
1TerminatedTreatmentBrain and Central Nervous System Tumors / Lymphoma NOS / Unspecified Adult Solid Tumor, Protocol Specific1
1TerminatedTreatmentCancer, Ovarian / Carcinoma of the Prostate / Gastric Cancers / Tumor, Brain1
1TerminatedTreatmentExtensive Stage Small Cell Lung Cancer / Recurrent Colon Cancer / Recurrent Non-small Cell Lung Cancer / Recurrent Rectal Cancer / Recurrent Small Cell Lung Cancer / Stage IV Colon Cancer / Stage IV Non-Small Cell Lung Cancer / Stage IV Rectal Cancer1
1TerminatedTreatmentHIV-1 Infections1
1TerminatedTreatmentLeukemias / Lymphoma NOS1
1TerminatedTreatmentLung Cancers1
1TerminatedTreatmentMetastatic Cancers / Neoplasms / Tumors / Tumors, Solid1
1TerminatedTreatmentSarcomas1
1TerminatedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1Unknown StatusSupportive CareChronic Myeloproliferative Disorders / Drug/Agent Toxicity by Tissue/Organ / Leukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Precancerous Conditions / Unspecified Adult Solid Tumor, Protocol Specific1
1Unknown StatusTreatmentCancer, Breast1
1Unknown StatusTreatmentColorectal Cancers / Kidney Cancer1
1Unknown StatusTreatmentMelanoma (Skin)1
1Unknown StatusTreatmentUnspecified Childhood Solid Tumor, Protocol Specific1
1WithdrawnTreatmentMalignant Ovarian Clear Cell Tumor / Malignant Ovarian Serous Tumor / Recurrent Fallopian Tube Carcinoma / Recurrent Ovarian Carcinoma / Recurrent Primary Peritoneal Carcinoma / Stage IIIA Fallopian Tube Cancer / Stage IIIA Ovarian Cancer / Stage IIIA Primary Peritoneal Cancer / Stage IIIB Fallopian Tube Cancer / Stage IIIB Ovarian Cancer / Stage IIIB Primary Peritoneal Cancer / Stage IIIC Fallopian Tube Cancer / Stage IIIC Ovarian Cancer / Stage IIIC Primary Peritoneal Cancer / Stage IV Fallopian Tube Cancer / Stage IV Ovarian Cancer / Stage IV Primary Peritoneal Cancer1
1, 2Active Not RecruitingPreventionCancer, Breast / Cancer, Ovarian1
1, 2Active Not RecruitingTreatmentCancer, Ovarian / Endometrial Cancers / Fallopian Cancer / Peritoneal Cancer1
1, 2Active Not RecruitingTreatmentCarcinoma of the Prostate1
1, 2Active Not RecruitingTreatmentColorectal Cancers1
1, 2Active Not RecruitingTreatmentHER2-positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage II Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
1, 2Active Not RecruitingTreatmentHER2-positive Breast Cancer / Male Breast Cancer / Recurrent Breast Cancer / Stage IV Breast Cancer1
1, 2Active Not RecruitingTreatmentMalignant Melanoma1
1, 2Active Not RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
1, 2Active Not RecruitingTreatmentRecurrent Prostate Cancer1
1, 2Active Not RecruitingTreatmentRenal Cancers1
1, 2CompletedBasic ScienceCritical Illness / Immuno-suppression / Sepsis 1
1, 2CompletedTreatmentAccelerated Phase Chronic Myelogenous Leukemia / Adult Acute Myeloid Leukemia in Remission / Chronic Phase Chronic Myelogenous Leukemia / Previously Treated Myelodysplastic Syndromes / Refractory Anemia With Excess Blasts / Refractory Anemia With Excess Blasts in Transformation / Relapsing Chronic Myelogenous Leukemia1
1, 2CompletedTreatmentCarcinoma of the Prostate1
1, 2CompletedTreatmentCarcinoma, Colorectal1
1, 2CompletedTreatmentColorectal Cancers / Kidney Cancer1
1, 2CompletedTreatmentHIV-1 Infections1
1, 2CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)1
1, 2CompletedTreatmentLeukemias / Lymphoma NOS1
1, 2CompletedTreatmentLymphoma NOS / Non Hodgkin Lymphoma (NHL)1
1, 2CompletedTreatmentMalignancies, Hematologic1
1, 2CompletedTreatmentMalignant Melanoma1
1, 2CompletedTreatmentMelanoma (Skin)1
1, 2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
1, 2CompletedTreatmentNeuroblastomas1
1, 2CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1, 2RecruitingTreatmentMetastatic Melanoma1
1, 2SuspendedTreatmentDesmoplastic Small Round Cell Tumor (DSRCT) / Disseminated Neuroblastoma / Metastatic Osteosarcoma / Recurrent Neuroblastoma / Recurrent Osteosarcoma1
1, 2SuspendedTreatmentMetastatic Pancreatic Adenocarcinoma / Recurrent Pancreatic Carcinoma / Stage III Pancreatic Cancer / Stage IV Pancreatic Cancer1
1, 2TerminatedTreatmentCrohn's Disease (CD)1
1, 2TerminatedTreatmentNeoplasm Metastases / Neoplasms, Breast1
1, 2Unknown StatusTreatmentAdvanced Renal Cell Cancer / Renal Cell Cancer1
1, 2Unknown StatusTreatmentCancer, Breast1
1, 2Unknown StatusTreatmentChronic HIV-infection1
1, 2Unknown StatusTreatmentMelanoma (Skin)1
1, 2Unknown StatusTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1, 2WithdrawnTreatmentCancer, Breast1
2Active Not RecruitingPreventionCancer, Breast1
2Active Not RecruitingPreventionHER2-positive Breast Cancer / Male Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer1
2Active Not RecruitingTreatmentBilateral Breast Carcinoma / Estrogen Receptor Negative / HER2/Neu Negative / Progesterone Receptor Negative / Stage IB Breast Cancer / Stage II Breast Cancer / Stage IIA Breast Cancer / Stage IIB Breast Cancer / Stage III Breast Cancer / Stage IIIA Breast Cancer / Stage IIIB Breast Cancer / Stage IIIC Breast Cancer / Stage IV Breast Cancer / Triple-Negative Breast Carcinoma / Unilateral Breast Carcinoma1
2Active Not RecruitingTreatmentCancer, Breast2
2Active Not RecruitingTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cancer1
2Active Not RecruitingTreatmentCarcinoma of the Prostate3
2Active Not RecruitingTreatmentChronic Myeloproliferative Disorders / Leukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
2Active Not RecruitingTreatmentChronic Myeloproliferative Disorders / Leukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2Active Not RecruitingTreatmentEffects of Immunotherapy / Neoplasm, Residual / Neuroblastomas1
2Active Not RecruitingTreatmentLeukemias1
2Active Not RecruitingTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2Active Not RecruitingTreatmentLymphoma NOS1
2Active Not RecruitingTreatmentMalignant Pleural Mesothelioma (MPM)2
2Active Not RecruitingTreatmentMantle Cell Lymphoma (MCL)1
2Active Not RecruitingTreatmentMetastatic Melanoma / Recurrent Melanoma / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2Active Not RecruitingTreatmentPulmonary Alveolar Proteinosis, Autoimmune1
2CompletedSupportive CareCancer, Breast / Cancer, Ovarian / Drug/Agent Toxicity by Tissue/Organ / Lung Cancers / Lymphoma NOS / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedSupportive CareHead and Neck Cancers / Oral Complications / Radiation Toxicity1
2CompletedTreatmentAcute Lymphocytic Leukemia (ALL) / Acute Myelogenous Leukaemia (AML) / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myelogenous Leukemia (CML) / Hodgkins Disease (HD) / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Non-Hodgkin's Lymphoma (NHL) / Peripheral T-Cell Lymphoma (PTCL)1
2CompletedTreatmentAcute Myeloid Leukaemias (AML) / Chronic Myeloid Leukemia (CML) / Myelodysplastic Syndromes (MDS)1
2CompletedTreatmentAdult Acute Lymphoblastic Leukemia in Remission / Adult Acute Megakaryoblastic Leukemia (M7) / Adult Acute Minimally Differentiated Myeloid Leukemia (M0) / Adult Acute Monoblastic Leukemia (M5a) / Adult Acute Monocytic Leukemia (M5b) / Adult Acute Myeloblastic Leukemia With Maturation (M2) / Adult Acute Myeloblastic Leukemia Without Maturation (M1) / Adult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Acute Myelomonocytic Leukemia (M4) / Adult Erythroleukemia (M6a) / Adult Pure Erythroid Leukemia (M6b) / Chronic Myelomonocytic Leukemia / De Novo Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Refractory Anemia / Refractory Anemia With Excess Blasts / Refractory Anemia With Ringed Sideroblasts / Refractory Cytopenia With Multilineage Dysplasia / Secondary Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Adult Acute Myeloid Leukemia1
2CompletedTreatmentAlveolar Childhood Rhabdomyosarcoma / Embryonal Childhood Rhabdomyosarcoma / Embryonal-botryoid Childhood Rhabdomyosarcoma / Previously Treated Childhood Rhabdomyosarcoma / Recurrent Childhood Rhabdomyosarcoma1
2CompletedTreatmentBrain and Central Nervous System Tumors4
2CompletedTreatmentBrenner Tumor / Fallopian Tube Cancer / Ovarian Clear Cell Cystadenocarcinoma / Ovarian Endometrioid Adenocarcinoma / Ovarian Mixed Epithelial Carcinoma / Ovarian Mucinous Cystadenocarcinoma / Ovarian Serous Cystadenocarcinoma / Ovarian Undifferentiated Adenocarcinoma / Peritoneal Cavity Cancer / Recurrent Ovarian Epithelial Cancer / Stage III Ovarian Epithelial Cancer / Stage IV Ovarian Epithelial Cancer1
2CompletedTreatmentBurkitt's Lymphoma / Lymphoma, Large-Cell, Diffuse / Lymphoma, Small Noncleaved-Cell1
2CompletedTreatmentCancer, Breast3
2CompletedTreatmentCancer, Breast / Cancer, Ovarian / Cervical Cancers / Colorectal Cancers / Lung Cancers / Pancreatic Cancers1
2CompletedTreatmentCancer, Breast / Cancer, Ovarian / Chronic Myeloproliferative Disorders / Gestational Trophoblastic Disease / Kidney Cancer / Leukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Neuroblastomas / Sarcomas / Testicular germ cell tumour1
2CompletedTreatmentCancer, Breast / Colorectal Cancers / Kidney Cancer / Lung Cancers / Mesothelioma, Malignant / Pancreatic Cancers1
2CompletedTreatmentCancer, Breast / Esophageal Cancers / Gastric Cancers / Lung Cancers / Pancreatic Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Peritoneal Cancer1
2CompletedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Primary Peritoneal Cancer1
2CompletedTreatmentCarcinoma of the Prostate8
2CompletedTreatmentChronic Hepatitis B Infection1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)1
2CompletedTreatmentCiliary Body and Choroid Melanoma, Medium/Large Size / Extraocular Extension Melanoma / Iris Melanoma / Stage IIB Melanoma / Stage IIC Melanoma / Stage IIIA Melanoma / Stage IIIB Melanoma / Stage IIIC Melanoma / Stage IV Melanoma1
2CompletedTreatmentColon Cancer / Metastatic Colon Cancer / Metastatic Rectal Cancer / Rectal Cancers1
2CompletedTreatmentColorectal Cancers2
2CompletedTreatmentColorectal Cancers / Endometrial Cancers / Head and Neck Cancers / Liver Cancer / Lung Cancers / Melanoma (Skin) / Pancreatic Cancers / Testicular germ cell tumour / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentColorectal Cancers / Metastatic Cancers1
2CompletedTreatmentCrohn's Disease (CD)1
2CompletedTreatmentEstrogen Receptor-negative Breast Cancer / Estrogen Receptor-Positive Breast Cancer / Inflammatory carcinoma of the breast / Male Breast Cancer / Progesterone Receptor-negative Breast Cancer / Progesterone Receptor-positive Breast Cancer / Stage IIIB Breast Cancer / Stage IV Breast Cancer1
2CompletedTreatmentGraft Versus Host Disease (GVHD) / Lymphoma NOS1
2CompletedTreatmentHereditary Pulmonary Alveolar Proteinosis1
2CompletedTreatmentHodgkins Disease (HD) / Leukemia, Lymphocytic, Chronic, B-Cell / Leukemia, Myeloid, Acute / Multiple Myeloma (MM) / Myelodysplastic Syndromes / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
2CompletedTreatmentInflammatory carcinoma of the breast / Locally Advanced Breast Cancer (LABC)1
2CompletedTreatmentIntraocular Melanoma / Melanoma (Skin)2
2CompletedTreatmentKidney Cancer1
2CompletedTreatmentKidney Cancer / Lung Cancers / Metastatic Cancers / Unspecified Adult Solid Tumor, Protocol Specific1
2CompletedTreatmentKidney Cancer / Metastatic Cancers1
2CompletedTreatmentLeishmaniasis, Cutaneous1
2CompletedTreatmentLeukemias16
2CompletedTreatmentLeukemias / Lymphoma NOS2
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases2
2CompletedTreatmentLiver Metastases / Uveal Melanoma1
2CompletedTreatmentLymphoma NOS12
2CompletedTreatmentLymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm1
2CompletedTreatmentLymphoma NOS / Unspecified Adult Solid Tumor, Protocol Specific / Unspecified Childhood Solid Tumor, Protocol Specific1
2CompletedTreatmentLymphoma, Large B-Cell, Diffuse1
2CompletedTreatmentMalignant Melanoma2
2CompletedTreatmentMalignant Neoplasms of Brain1
2CompletedTreatmentMelanoma (Skin)11
2CompletedTreatmentMelanoma (Skin) / Metastatic Cancers1
2CompletedTreatmentMetastatic Cancers / Sarcomas2
2CompletedTreatmentMetastatic Melanoma2
2CompletedTreatmentMultiple Myeloma (MM)1
2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm4
2CompletedTreatmentNeuroblastomas4
2CompletedTreatmentPancreatic Cancers1
2CompletedTreatmentPeripheral Arterial Disease (PAD)1
2CompletedTreatmentProstatic Neoplasms2
2CompletedTreatmentRecurrent Melanoma / Stage III Melanoma / Stage IV Melanoma1
2CompletedTreatmentRecurrent Neuroblastoma1
2CompletedTreatmentRecurrent Prostate Carcinoma / Stage I Prostate Cancer / Stage IIA Prostate Cancer / Stage IIB Prostate Cancer / Stage III Prostate Cancer1
2CompletedTreatmentRefractory Plasma Cell Neoplasm / Stage II Multiple Myeloma / Stage III Multiple Myeloma1
2CompletedTreatmentRenal Cell Carcinoma (RCC)1
2CompletedTreatmentRespiratory Distress Syndrome, Adult1
2CompletedTreatmentRhabdomyosarcomas / Sarcoma, Ewing's1
2CompletedTreatmentSarcomas1
2CompletedTreatmentSepsis 1
2CompletedTreatmentTumor, Brain / Tumors, Central Nervous System1
2Enrolling by InvitationTreatmentAcute Myeloid Leukaemias (AML) / Myelodysplastic Syndrome1
2RecruitingPreventionCancer, Breast2
2RecruitingPreventionDuctal Breast Carcinoma In Situ1
2RecruitingTreatmentAlzheimer's Disease (AD)1
2RecruitingTreatmentAutoimmune Pulmonary Alveolar Proteinosis1
2RecruitingTreatmentBiliary Cancer1
2RecruitingTreatmentCancer, Ovarian / Platinum Sensitive Ovarian Cancer1
2RecruitingTreatmentFollicular Lymphoma (FL)1
2RecruitingTreatmentGanglioneuroblastoma / Recurrent Neuroblastoma1
2RecruitingTreatmentGlioblastomas / Gliosarcoma2
2RecruitingTreatmentKidney Diseases / Transplant, Kidney1
2RecruitingTreatmentLeukemia, Lymphoid / Leukemias / Lymphoma NOS / Lymphoma, Hodgkins / Myelomas1
2RecruitingTreatmentLeukemias1
2RecruitingTreatmentMultiple Myeloma (MM)1
2RecruitingTreatmentNeuroblastomas2
2RecruitingTreatmentNon-Small-Cell Lung Carcinoma (NSCLC)1
2RecruitingTreatmentRecurrent Osteosarcoma1
2RecruitingTreatmentSquamous Cell Carcinoma of the Oral Cavity1
2SuspendedTreatmentMelanoma (Skin)1
2SuspendedTreatmentMetastatic Malignant Neoplasm in the Lung / Metastatic Osteosarcoma / Recurrent Osteosarcoma1
2TerminatedDiagnosticLymphoma NOS1
2TerminatedTreatmentColorectal Cancers / Esophageal Cancers / Extrahepatic Bile Duct Cancer / Gallbladder Cancer / Gastric Cancers / Pancreatic Cancers / Small Intestine Cancer1
2TerminatedTreatmentCrohn's Disease (CD)2
2TerminatedTreatmentFollicular Lymphoma (FL)1
2TerminatedTreatmentHematologic Diseases1
2TerminatedTreatmentHormone Refractory Prostate Cancer1
2TerminatedTreatmentLeukemias5
2TerminatedTreatmentLymphoma NOS3
2TerminatedTreatmentLymphoma, B-Cell / Lymphoma, Diffuse / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentMelanoma (Skin)1
2TerminatedTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2TerminatedTreatmentMyelomas1
2TerminatedTreatmentNeoplasms, Ovarian1
2TerminatedTreatmentNeuroblastomas1
2TerminatedTreatmentPrimary Refractory Neuroblastoma1
2TerminatedTreatmentProstatic Neoplasms2
2TerminatedTreatmentPulmonary Alveolar Proteinosis (PAP)1
2TerminatedTreatmentSarcomas1
2Unknown StatusTreatmentAcute Myeloid Leukaemias (AML) / Myelodysplastic Syndrome1
2Unknown StatusTreatmentBrain and Central Nervous System Tumors / Lymphoma NOS / Lymphoproliferative Disorders / Small Intestine Cancer1
2Unknown StatusTreatmentKidney Cancer1
2Unknown StatusTreatmentLymphoma NOS5
2Unknown StatusTreatmentLymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm1
2Unknown StatusTreatmentMalignant Melanoma, Metastatic1
2Unknown StatusTreatmentMyelodysplastic Syndromes1
2Unknown StatusTreatmentPulmonary Alveolar Proteinosis (PAP)1
2WithdrawnTreatmentAcute Myeloid Leukemia NOS1
2WithdrawnTreatmentCarcinoma of the Prostate1
2WithdrawnTreatmentDementia Alzheimer's Type1
2WithdrawnTreatmentLeukemias1
2WithdrawnTreatmentMelanoma (Skin)1
2WithdrawnTreatmentRenal Cell Carcinoma (RCC)1
2, 3RecruitingTreatmentLeukemias1
2, 3RecruitingTreatmentRecurrent Melanoma of the Skin / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Stages III Skin Melanoma1
2, 3Unknown StatusTreatmentPulmonary Alveolar Proteinosis (PAP)1
3Active Not RecruitingTreatmentLeukemias1
3Active Not RecruitingTreatmentProstate Cancer Metastatic1
3CompletedPreventionBreast Cancer With Low to Intermediate HER2 Expression1
3CompletedPreventionLocal Recurrence of Malignant Melanoma of Skin / Stage IV Melanoma1
3CompletedSupportive CareHead and Neck Cancers / Oral Complications / Radiation Toxicity1
3CompletedSupportive CareInfection NOS1
3CompletedTreatmentAcute Myeloid Leukaemias (AML)1
3CompletedTreatmentAdult Malignant Mesenchymoma / Adult Rhabdomyosarcoma / Alveolar Childhood Rhabdomyosarcoma / Childhood Malignant Mesenchymoma / Embryonal Childhood Rhabdomyosarcoma / Embryonal-botryoid Childhood Rhabdomyosarcoma / Nonmetastatic Childhood Soft Tissue Sarcoma / Previously Untreated Childhood Rhabdomyosarcoma / Stage I Adult Soft Tissue Sarcoma / Stage II Adult Soft Tissue Sarcoma / Stage III Adult Soft Tissue Sarcoma1
3CompletedTreatmentCancer, Breast1
3CompletedTreatmentCrohn's Disease (CD)1
3CompletedTreatmentCytomegalovirus Retinitis / Human Immunodeficiency Virus (HIV) Infections1
3CompletedTreatmentDisseminated Neuroblastoma / Localized Resectable Neuroblastoma / Localized Unresectable Neuroblastoma / Regional Neuroblastoma / Stage 4 Neuroblastoma / Stage 4S Neuroblastoma1
3CompletedTreatmentGraft Versus Host Disease (GVHD) / Multiple Myeloma (MM)1
3CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Non-Hodgkin's Lymphoma (NHL)1
3CompletedTreatmentLeukemia,Myeloid, Chronic1
3CompletedTreatmentLeukemias2
3CompletedTreatmentLeukemias / Lymphoma NOS1
3CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
3CompletedTreatmentLocalized Resectable Neuroblastoma / Localized Unresectable Neuroblastoma / Recurrent Neuroblastoma / Regional Neuroblastoma / Stage 4 Neuroblastoma / Stage 4S Neuroblastoma1
3CompletedTreatmentMelanoma2
3CompletedTreatmentMetastatic Renal Cell Carcinoma1
3CompletedTreatmentNeuroblastomas2
3CompletedTreatmentPancreatic Cancers1
3CompletedTreatmentSarcomas1
3Not Yet RecruitingTreatmentChildhood Ganglioneuroblastoma / Childhood Neuroblastoma / NMYC Gene Amplification / Recurrent Neuroblastoma1
3RecruitingTreatmentSevere Sepsis / Shock, Septic1
3RecruitingTreatmentStage IB Melanoma / Stage IIA Melanoma / Stage IIB Melanoma / Stage IIC Melanoma1
3SuspendedTreatmentLymphoma NOS1
3TerminatedTreatmentBladder Cancers1
3TerminatedTreatmentCrohn's Disease (CD)2
3TerminatedTreatmentLymphoma NOS1
3Unknown StatusTreatmentLeukemias1
3Unknown StatusTreatmentLymphoma NOS1
3Unknown StatusTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
3Unknown StatusTreatmentNon-Hodgkin's Lymphoma (NHL)1
4CompletedTreatmentAcute Myeloblastic Leukemia1
4CompletedTreatmentHIV Disease1
4CompletedTreatmentInfertilities1
4Not Yet RecruitingTreatmentAcute Lymphoid Leukemia (ALL) / Acute Myeloid Leukaemias (AML) / Hepatoblastomas / Lymphoma NOS / Neuroblastomas / Retinoblastoma1
4RecruitingTreatmentCritical Injury (Trauma) in Children1
4RecruitingTreatmentMelanoma1
Not AvailableActive Not RecruitingTreatmentCancer, Breast1
Not AvailableActive Not RecruitingTreatmentMelanoma (Skin)1
Not AvailableActive Not RecruitingTreatmentMultiple Myeloma (MM)1
Not AvailableActive Not RecruitingTreatmentPeripheral Arterial Disease (PAD)1
Not AvailableCompletedNot AvailableHead and Neck Cancers1
Not AvailableCompletedSupportive CareChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Lymphoma NOS / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
Not AvailableCompletedSupportive CareHead and Neck Cancers / Mucositis / Radiation Toxicity1
Not AvailableCompletedTreatmentCytomegalovirus Retinitis / Human Immunodeficiency Virus (HIV) Infections1
Not AvailableCompletedTreatmentCytopenias / Human Immunodeficiency Virus (HIV) Infections2
Not AvailableCompletedTreatmentEndotoxaemia / Inflammatory processes / Multi Organ Dysfunction Syndrome / Sepsis 1
Not AvailableCompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
Not AvailableCompletedTreatmentLeukemias1
Not AvailableCompletedTreatmentLeukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes1
Not AvailableCompletedTreatmentMelanoma1
Not AvailableCompletedTreatmentPrimary Hepatocellular Carcinoma1
Not AvailableCompletedTreatmentRecurrent Melanoma / Stage IV Melanoma1
Not AvailableRecruitingNot AvailableMelanoma1
Not AvailableRecruitingTreatmentLiver Cirrhosis1
Not AvailableRecruitingTreatmentNeuroblastomas2
Not AvailableTerminatedTreatmentOsteosarcomas1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, for solutionIntravenous; Subcutaneous250 ug/mL
LiquidIntravenous; Subcutaneous500 ug/mL
Prices
Unit descriptionCostUnit
Leukine 250 mcg vial204.79USD vial
Bio-immunex capsule0.42USD capsule
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1341150 No2000-12-052017-12-05Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
isoelectric point5.05Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
Gene Name:
CSF2RA
Uniprot ID:
P15509
Molecular Weight:
46206.185 Da
References
  1. Wang Y, Cai D, Brendel C, Barett C, Erben P, Manley PW, Hochhaus A, Neubauer A, Burchert A: Adaptive secretion of granulocyte-macrophage colony-stimulating factor (GM-CSF) mediates imatinib and nilotinib resistance in BCR/ABL+ progenitors via JAK-2/STAT-5 pathway activation. Blood. 2007 Mar 1;109(5):2147-55. Epub 2006 Nov 7. [PubMed:17090651 ]
  2. Chen J, Carcamo JM, Golde DW: The alpha subunit of the granulocyte-macrophage colony-stimulating factor receptor interacts with c-Kit and inhibits c-Kit signaling. J Biol Chem. 2006 Aug 4;281(31):22421-6. Epub 2006 Jun 7. [PubMed:16760463 ]
  3. Lencz T, Morgan TV, Athanasiou M, Dain B, Reed CR, Kane JM, Kucherlapati R, Malhotra AK: Converging evidence for a pseudoautosomal cytokine receptor gene locus in schizophrenia. Mol Psychiatry. 2007 Jun;12(6):572-80. Epub 2007 Mar 20. [PubMed:17522711 ]
  4. Xiao R, Zhang R, Wang YL, Zhu ZL, Chen T, Yang JH: [Expression of soluble GM-CSF-Ralpha in patients with acute myeloid leukemia]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2006 Apr;14(2):225-7. [PubMed:16638185 ]
  5. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Interleukin-3 receptor activity
Specific Function:
This is a receptor for interleukin-3.
Gene Name:
IL3RA
Uniprot ID:
P26951
Molecular Weight:
43329.585 Da
References
  1. Eksioglu EA, Mahmood SS, Chang M, Reddy V: GM-CSF promotes differentiation of human dendritic cells and T lymphocytes toward a predominantly type 1 proinflammatory response. Exp Hematol. 2007 Aug;35(8):1163-71. Epub 2007 Jun 11. [PubMed:17562355 ]
  2. Sakhno LV, Leplina OIu, Tikhonova MA, Raspai ZhM, Gileva IP, Nikonov SD, Zhdanov OA, Ostanin AA, Chernykh ER: [Characteristics of A-interferon-generated dendritic cells in patients with pulmonary tuberculosis]. Probl Tuberk Bolezn Legk. 2007;(3):42-6. [PubMed:17500228 ]
  3. Ward KA, Stewart LA, Schwarer AP: CD34+-derived CD11c+ + + BDCA-1+ + CD123+ + DC: expansion of a phenotypically undescribed myeloid DC1 population for use in adoptive immunotherapy. Cytotherapy. 2006;8(2):130-40. [PubMed:16698686 ]
  4. Lencz T, Morgan TV, Athanasiou M, Dain B, Reed CR, Kane JM, Kucherlapati R, Malhotra AK: Converging evidence for a pseudoautosomal cytokine receptor gene locus in schizophrenia. Mol Psychiatry. 2007 Jun;12(6):572-80. Epub 2007 Mar 20. [PubMed:17522711 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
High affinity receptor for interleukin-3, interleukin-5 and granulocyte-macrophage colony-stimulating factor.
Gene Name:
CSF2RB
Uniprot ID:
P32927
Molecular Weight:
97334.89 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Shen Y, Baker E, Callen DF, Sutherland GR, Willson TA, Rakar S, Gough NM: Localization of the human GM-CSF receptor beta chain gene (CSF2RB) to chromosome 22q12.2-->q13.1. Cytogenet Cell Genet. 1992;61(3):175-7. [PubMed:1424804 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
agonist
General Function:
Pdz domain binding
Specific Function:
Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).
Gene Name:
SDC2
Uniprot ID:
P34741
Molecular Weight:
22159.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Modrowski D, Basle M, Lomri A, Marie PJ: Syndecan-2 is involved in the mitogenic activity and signaling of granulocyte-macrophage colony-stimulating factor in osteoblasts. J Biol Chem. 2000 Mar 31;275(13):9178-85. [PubMed:10734053 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Heparin binding
Specific Function:
Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Gene Name:
PRG2
Uniprot ID:
P13727
Molecular Weight:
25205.345 Da
References
  1. Menon K, Wu Y, Haas J, Sahu SK, Yang B, Zaheer A: Diminished degradation of myelin basic protein by anti-sulfatide antibody and interferon-gamma in myelin from glia maturation factor-deficient mice. Neurosci Res. 2007 Jun;58(2):156-63. Epub 2007 Feb 22. [PubMed:17383764 ]
  2. Letuve S, Lajoie-Kadoch S, Audusseau S, Rothenberg ME, Fiset PO, Ludwig MS, Hamid Q: IL-17E upregulates the expression of proinflammatory cytokines in lung fibroblasts. J Allergy Clin Immunol. 2006 Mar;117(3):590-6. Epub 2006 Feb 8. [PubMed:16522458 ]
  3. Kang JH, Lee da H, Seo H, Park JS, Nam KH, Shin SY, Park CS, Chung IY: Regulation of functional phenotypes of cord blood derived eosinophils by gamma-secretase inhibitor. Am J Respir Cell Mol Biol. 2007 Nov;37(5):571-7. Epub 2007 Jun 28. [PubMed:17600316 ]
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23