Identification

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates
Name
Anakinra
Accession Number
DB00026  (BTD00060, BIOD00060)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Interleukin-based products
Description

Anakinra is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between anakinra and the native human IL-1Ra is that anakinra has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. Anakinra is composed of 153 amino acid residues. FDA approved on November 14, 2001.

Protein structure
Db00026
Protein chemical formula
C759H1186N208O232S10
Protein average weight
17257.6 Da
Sequences
>DB00026 sequence
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLG
IHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGW
FLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Download FASTA Format
Synonyms
  • Anakinra
  • IL-1RA
  • Interleukin-1 receptor antagonist anakinra
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
KineretInjection, solution100 mg/0.67mlSubcutaneousSWEDISH ORPHAN BIOVITRUM AB (PUBL)2002-03-08Not applicableEu
KineretInjection, solution100 mg/0.67mlSubcutaneousSWEDISH ORPHAN BIOVITRUM AB (PUBL)2002-03-08Not applicableEu
KineretSolution150 mgSubcutaneousSWEDISH ORPHAN BIOVITRUM AB (PUBL)2002-05-29Not applicableCanada
KineretInjection, solution100 mgSubcutaneousSWEDISH ORPHAN BIOVITRUM AB (PUBL)2002-03-08Not applicableEu
KineretInjection, solution100 mg/0.67mLSubcutaneousSWEDISH ORPHAN BIOVITRUM AB (PUBL)2009-12-15Not applicableUs
KineretInjection, solution100 mgSubcutaneousSWEDISH ORPHAN BIOVITRUM AB (PUBL)2002-03-08Not applicableEu
KineretInjection, solution100 mg/0.67mlSubcutaneousSWEDISH ORPHAN BIOVITRUM AB (PUBL)2002-03-08Not applicableEu
KineretInjection, solution100 mgSubcutaneousSWEDISH ORPHAN BIOVITRUM AB (PUBL)2002-03-08Not applicableEu
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more
Categories
UNII
9013DUQ28K
CAS number
143090-92-0

Pharmacology

Indication

For the treatment of adult rheumatoid arthritis and treatment of Neonatal-Onset Multisystem Inflammatory Disease (NOMID).

Associated Conditions
Pharmacodynamics

Used to treat rheumatoid arthritis, Anakinra blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.

Mechanism of action

Anakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.

TargetActionsOrganism
AInterleukin-1 receptor type 1
antagonist
Humans
Additional Data Available
Adverse Effects

Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.

Learn more
Additional Data Available
Contraindications

Structured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.

Learn more
Additional Data Available
Blackbox Warnings

Structured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.

Learn more
Absorption

When a 70 mg subcutaneous bolus injection is given to healthy subjects, the absolute bioavailability is 95%. Accumulation does not occur following daily subcutaneous doses. Tmax, SubQ, 1-2 mg/kg, healthy subjects = 3-7 hours; Cmax, SubQ, 3 mg/kg once daily, NOMID patients = 3628 ng/mL.

Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

Healthy subjects = 4 - 6 hours; NOMID patients = 5.7 hours (range of 3.1 - 28.2 hours).

Clearance

Clearance is variable and increases with increasing creatinine clearance and body weight. However, gender and age were not significant factors.

Toxicity

Most common adverse reactions (incidence ≥ 5%) are injection site reaction, worsening of rheumatoid arthritis, upper respiratory tract infection, headache, nausea, diarrhea, sinusitis, arthralgia, flu like-symptoms, and abdominal pain when anakinra is used in RA patients. In NOMID patients, the most common AEs during the first 6 months of treatment (incidence >10%) are injection site reaction, headache, vomiting, arthralgia, pyrexia, and nasopharyngitis.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
(R)-warfarinThe metabolism of (R)-warfarin can be increased when combined with Anakinra.
(S)-WarfarinThe metabolism of (S)-Warfarin can be increased when combined with Anakinra.
2-MethoxyethanolThe risk or severity of adverse effects can be increased when Anakinra is combined with 2-Methoxyethanol.
4-hydroxycoumarinThe metabolism of 4-hydroxycoumarin can be increased when combined with Anakinra.
4-MethoxyamphetamineThe metabolism of 4-Methoxyamphetamine can be increased when combined with Anakinra.
5-methoxy-N,N-dimethyltryptamineThe metabolism of 5-methoxy-N,N-dimethyltryptamine can be increased when combined with Anakinra.
6-O-benzylguanineThe metabolism of 6-O-benzylguanine can be increased when combined with Anakinra.
8-azaguanineThe metabolism of 8-azaguanine can be increased when combined with Anakinra.
8-chlorotheophyllineThe metabolism of 8-chlorotheophylline can be increased when combined with Anakinra.
9-(N-methyl-L-isoleucine)-cyclosporin AThe risk or severity of adverse effects can be increased when Anakinra is combined with 9-(N-methyl-L-isoleucine)-cyclosporin A.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

References

General References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  2. Lequerre T, Quartier P, Rosellini D, Alaoui F, De Bandt M, Mejjad O, Kone-Paut I, Michel M, Dernis E, Khellaf M, Limal N, Job-Deslandre C, Fautrel B, Le Loet X, Sibilia J: Interleukin-1 receptor antagonist (anakinra) treatment in patients with systemic-onset juvenile idiopathic arthritis or adult onset Still disease: preliminary experience in France. Ann Rheum Dis. 2008 Mar;67(3):302-8. Epub 2007 Oct 18. [PubMed:17947302]
External Links
UniProt
P18510
Genbank
M55646
KEGG Drug
D02934
PubChem Substance
46507944
ChEMBL
CHEMBL1201570
Therapeutic Targets Database
DAP000095
PharmGKB
PA10799
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Anakinra
ATC Codes
L04AC03 — Anakinra
AHFS Codes
  • 92:36.00 — Disease-modifying Antirheumatic Agents
FDA label
Download (62.3 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentAdenocarcinoma of the Pancreas1
0Active Not RecruitingTreatmentChronic Granulomatous Disease (CGD)1
0Not Yet RecruitingTreatmentAnakinra / Endometriosis / Markers of Inflammation1
0Not Yet RecruitingTreatmentAnterior Cruciate Ligament Injuries1
1Active Not RecruitingTreatmentAdvanced Cancers / Advanced Malignant Neoplasm / Metastatic Malignant Neoplasm / Recurrent Malignant Neoplasm / Refractory Malignant Neoplasm1
1Active Not RecruitingTreatmentMalignant Neoplasm of Pancreas1
1CompletedNot AvailablePostprandial Fatigue1
1CompletedBasic ScienceHealthy Control Subjects1
1CompletedTreatmentFamilial Cold Autoinflammatory Syndrome (FCAS)1
1CompletedTreatmentHealthy Volunteers1
1CompletedTreatmentPulmonary Arterial Hypertension (PAH)1
1CompletedTreatmentUnspecified Adult Solid Tumor, Protocol Specific1
1RecruitingTreatmentBlepharokeratoconjunctivitis1
1RecruitingTreatmentKnee Osteoarthritis (Knee OA)1
1RecruitingTreatmentMacrophage Activation Syndrome1
1RecruitingTreatmentMetastatic Breast Cancer1
1TerminatedOtherHuman Immunodeficiency Virus (HIV) Infections / Neurologic Disorders1
1TerminatedTreatmentAllergic Disease / Anakinra / Atopic Dermatitis (AD) / Dermatitis, Eczematous / Kineret1
1, 2CompletedOtherHeart Failure1
1, 2CompletedTreatmentAutoimmune Inner Ear Disease / Sensorineural Hearing Loss1
1, 2CompletedTreatmentAutoimmune/Connective Tissue Diseases / Immune System Diseases1
1, 2CompletedTreatmentCorneal Neovascularization1
1, 2CompletedTreatmentHeart Failure1
1, 2CompletedTreatmentIndolent Plasma Cell Myeloma / Plasma Cell Myeloma / Smoldering Plasma Cell Myeloma1
1, 2CompletedTreatmentKnee Injuries1
1, 2CompletedTreatmentPosterior Blepharitis1
1, 2CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus2
1, 2Enrolling by InvitationTreatmentAsthma2
1, 2Not Yet RecruitingTreatmentAsthma, Allergic1
1, 2RecruitingTreatmentDisseminated Sclerosis1
1, 2RecruitingTreatmentMucocutaneous Lymph Node Syndrome1
1, 2RecruitingTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
1, 2TerminatedTreatmentArthropathy, Neurogenic / Nervous System Malformations / Optic discs blurred / Urticaria1
1, 2TerminatedTreatmentHearing Loss, Sudden1
1, 2TerminatedTreatmentPulmonary Hypertension (PH)1
2Active Not RecruitingSupportive CareMultiple Myeloma (MM)1
2CompletedTreatmentAcrodermatitis Continua of Hallopeau / Palmoplantar Pustulosis / Pustular Dermatosis / Pustular Psoriasis / Sneddon-Wilkinson1
2CompletedTreatmentAcute Gouty Arthritis1
2CompletedTreatmentAcute Myocardial Infarction (AMI) / Heart Failure1
2CompletedTreatmentAdult-Onset Still's Disease1
2CompletedTreatmentChildren / Mucocutaneous Lymph Node Syndrome1
2CompletedTreatmentESRD1
2CompletedTreatmentFatigue / Primary Sjogren1
2CompletedTreatmentHeart Failure With Normal Ejection Fraction1
2CompletedTreatmentHidradenitis Suppurativa (HS)2
2CompletedTreatmentJuvenile Chronic Arthritis1
2CompletedTreatmentMetastatic Colorectal Cancer (MCRC)1
2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2CompletedTreatmentOsteoarthritis (OA)1
2CompletedTreatmentRheumatoid Arthritis1
2CompletedTreatmentType 2 Diabetes Mellitus1
2Not Yet RecruitingTreatmentAlcoholic Hepatitis (AH)1
2Not Yet RecruitingTreatmentAutoimmune Diseases / Inflammatory Diseases1
2Not Yet RecruitingTreatmentCytokine Release Syndrome / Neurologic toxicity / Neurotoxicity Syndromes / Non-Hodgkin's Lymphoma (NHL) / Refractory Non-Hodgkin's lymphoma / Relapsed Non Hodgkin Lymphoma1
2Not Yet RecruitingTreatmentTraumatic Brain Injury (TBI)1
2RecruitingSupportive CareMultiple Myeloma (MM)1
2RecruitingTreatmentAnterior Cruciate Ligament Tear1
2RecruitingTreatmentAutoimmune Inner Ear Disease1
2RecruitingTreatmentB Cell ALL / B-cell Non Hodgkin's Lymphoma / Lymphoma, B-Cell1
2RecruitingTreatmentBiotherapy / Uveitis1
2RecruitingTreatmentCardiac Sarcoidosis1
2RecruitingTreatmentCerebral Hemorrhage1
2RecruitingTreatmentEnd-Stage Renal Disease (ESRD)1
2RecruitingTreatmentHeart Failure, Systolic / Inflammatory Reaction1
2RecruitingTreatmentMacrophage Activation Syndrome / Sepsis1
2RecruitingTreatmentPolycystic Ovaries Syndrome1
2RecruitingTreatmentAcute Pericarditis1
2TerminatedTreatmentRefractory Hemochromatosis Rheumatism1
2TerminatedTreatmentRheumatoid Arthritis1
2Unknown StatusTreatmentAmyotrophic Lateral Sclerosis (ALS)1
2Unknown StatusTreatmentDiabetes Mellitus (DM)1
2Unknown StatusTreatmentInsulin Resistance / Type 2 Diabetes Mellitus1
2WithdrawnTreatmentChronic Kidney Disease (CKD) / Heart Failure, Systolic / Renal Disease, End Stage1
2WithdrawnTreatmentType I Diabetes1
2, 3CompletedTreatmentAcute Alcoholic Hepatitis1
2, 3CompletedTreatmentAcute Myocardial Infarction (AMI)1
2, 3CompletedTreatmentDermatomyositis / Inclusion Body Myositis (IBM) / Polymyositis1
2, 3CompletedTreatmentHeart Failure2
2, 3CompletedTreatmentMyalgic Encephalomyelitis (ME)1
2, 3CompletedTreatmentSystemic-Onset Juvenile Idiopathic Arthritis1
2, 3CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
2, 3Not Yet RecruitingTreatmentMucopolysaccharidosis III1
2, 3RecruitingTreatmentChronic Kidney Disease (CKD) / Gouty Arthritis1
2, 3RecruitingTreatmentMyocarditis Acute1
3CompletedNot AvailableHypersecretion; Cortisol / Metabolic Syndromes1
3CompletedTreatmentBMI >30 kg/m2 / Hypogonadism / Metabolic Syndromes1
3CompletedTreatmentFamilial Mediterranean Fever (FMF )1
3CompletedTreatmentRheumatoid Arthritis1
3CompletedTreatmentST Segment Elevation Acute Myocardial Infarction1
3Not Yet RecruitingTreatmentGiant Cells Arteritis1
3RecruitingTreatmentSubarachnoid Hemorrhage1
3TerminatedTreatmentStill's Disease, Adult-Onset / Still's Disease, Juvenile-Onset1
4Active Not RecruitingTreatmentKnee Injuries1
4CompletedTreatmentIdiopathic Recurrent Pericarditis1
4CompletedTreatmentRheumatoid Arthritis2
4TerminatedTreatmentRheumatoid Arthritis / Type 2 Diabetes Mellitus1
Not AvailableActive Not RecruitingNot AvailableCryopyrin-associated Periodic Syndromes (CAPS)1
Not AvailableCompletedNot AvailablePsoriatic Arthritis / Rheumatoid Arthritis / Spondyloarthritis1
Not AvailableCompletedNot AvailableRheumatoid Arthritis3
Not AvailableCompletedNot AvailableStill Disease, Juvenile Onset1
Not AvailableCompletedBasic ScienceType 2 Diabetes Mellitus1
Not AvailableCompletedDiagnosticLate Dumping Syndrome / Post-gastrointestinal bypass surgery / Postprandial Hypoglycemia1
Not AvailableCompletedOtherAdiposity1
Not AvailableCompletedTreatmentCoronary Artery Disease / Inflammatory Reaction / Rheumatoid Arthritis1
Not AvailableCompletedTreatmentEnd Stage Renal Disease (ESRD)1
Not AvailableCompletedTreatmentHeart Failure1
Not AvailableUnknown StatusNot AvailableImpaired Glucose Tolerance / Impaired Insulin Secretion / Type 2 Diabetes Mellitus1
Not AvailableUnknown StatusTreatmentInflammatory Reaction / Pain1
Not AvailableWithdrawnBasic ScienceType 2 Diabetes Mellitus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Amgen Inc.
  • BioVitrum AB
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous100 mg
Injection, solutionSubcutaneous100 mg/0.67ml
SolutionSubcutaneous150 mg
Prices
Unit descriptionCostUnit
Kineret 1 Box = 7 Syringes, 4.69ml Box449.9USD box
Kineret 100 mg/0.67 ml syr61.8USD syringe
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2141953No2008-04-082013-09-17Canada
CA1341322No2001-11-272018-11-27Canada
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.412Not Available
isoelectric point5.46Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antagonist
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the corecptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependen...
Gene Name
IL1R1
Uniprot ID
P14778
Uniprot Name
Interleukin-1 receptor type 1
Molecular Weight
65401.91 Da
References
  1. Tang YH, Zhang SP, Liang Y, Deng CQ: [Effects of Panax notoginseng saponins on mRNA expressions of interleukin-1 beta, its correlative factors and cysteinyl-aspartate specific protease after cerebral ischemia-reperfusion in rats]. Zhong Xi Yi Jie He Xue Bao. 2007 May;5(3):328-32. [PubMed:17498496]
  2. Dayer JM: The pivotal role of interleukin-1 in the clinical manifestations of rheumatoid arthritis. Rheumatology (Oxford). 2003 May;42 Suppl 2:ii3-10. [PubMed:12817089]
  3. Vamvakopoulos J, Green C, Metcalfe S: Genetic control of IL-1beta bioactivity through differential regulation of the IL-1 receptor antagonist. Eur J Immunol. 2002 Oct;32(10):2988-96. [PubMed:12355453]
  4. Do H, Vasilescu A, Carpentier W, Meyer L, Diop G, Hirtzig T, Coulonges C, Labib T, Spadoni JL, Therwath A, Lathrop M, Matsuda F, Zagury JF: Exhaustive genotyping of the interleukin-1 family genes and associations with AIDS progression in a French cohort. J Infect Dis. 2006 Dec 1;194(11):1492-504. Epub 2006 Oct 26. [PubMed:17083033]
  5. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  6. So A, De Smedt T, Revaz S, Tschopp J: A pilot study of IL-1 inhibition by anakinra in acute gout. Arthritis Res Ther. 2007;9(2):R28. [PubMed:17352828]
  7. Vannier E, Kaser A, Atkins MB, Fantuzzi G, Dinarello CA, Mier JW, Tilg H: Elevated circulating levels of soluble interleukin-1 receptor type II during interleukin-2 immunotherapy. Eur Cytokine Netw. 1999 Mar;10(1):37-42. [PubMed:10210771]

Drug created on June 13, 2005 07:24 / Updated on December 06, 2019 11:39