You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameIbritumomab tiuxetan
Accession NumberDB00078  (BTD00069, BIOD00069)
TypeBiotech
GroupsApproved
DescriptionIndium or yttrium conjugated murine IgG1 kappa monoclonal antibody directed against the CD20 antigen, which is found on the surface of normal and malignant B lymphocytes. Ibritumomab is produced in Chinese hamster ovary cells and is composed of two murine gamma 1 heavy chains of 445 amino acids each and two kappa light chains of 213 amino acids each.
Protein structureDb00078
Related Articles
Protein chemical formulaC6382H9830N1672O1979S54
Protein average weight143375.5 Da
Sequences
>Ibritumomab tiuxetan heavy chain
QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSY
NQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTV
SAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYT
LSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSV
FIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTL
RVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTK
KQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVER
NSYSCSVVHEGLHNHHTTKSFSR
>Ibritumomab tiuxetan light chain
QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPAR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRADAAPTVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFN
Download FASTA Format
Synonyms
Ibritumomab
mAb Murine (IGG1) Anti P19437 (CD20_MOUSE)
External Identifiers
  • IDEC-129
  • IDEC-Y2B8
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ZevalinKitSpectrum Pharmaceuticals, Inc.2002-02-19Not applicableUs
ZevalinKit1.6 mg/mlIntravenousSpectrum Pharmaceuticals B.V.2004-01-16Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Salts
Name/CASStructureProperties
Indium In-111 ibritumomab tiuxetan
ThumbNot applicableDBSALT001767
Yttrium y-90 ibritumomab tiuxetan
ThumbNot applicableDBSALT001768
Categories
UNII4Q52C550XK
CAS number206181-63-7
Pharmacology
IndicationFor treatment of non-Hodgkin's lymphoma
Structured Indications Not Available
PharmacodynamicsIbritumomab is a murine monoclonal antibody against CD20 that has been radiolabeled with yttrium-90.
Mechanism of actionThe Fab segment of the antibody targets the CD20 epitope on B-cells, allowing the radioactive yttrium to destroy the cell via production of beta particles.
TargetKindPharmacological actionActionsOrganismUniProt ID
B-lymphocyte antigen CD20Proteinyes
antibody
HumanP11836 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
Complement C1s subcomponentProteinunknownNot AvailableHumanP09871 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Related Articles
AbsorptionNot Available
Volume of distribution

Binding observed on lymphoid cells of the bone marrow, lymph node, thymus, red and white pulp of the spleen, lymphoid follicles of the tonsil, and lymphoid nodules of other organs (e.g., large and small intestines)

Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to B cells, or by human antimurine antibody production

Route of eliminationNot Available
Half life0.8 hours (mammalian reticulocytes, in vitro)
Clearance

Approximately 7.2% of injected dose of yttrium Y 90 ibritumomab tiuxetan is excreted in urine within 7 days.

ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ibritumomab tiuxetan.Approved
AcenocoumarolThe risk or severity of adverse effects can be increased when Acenocoumarol is combined with Ibritumomab tiuxetan.Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Acetylsalicylic acid is combined with Ibritumomab tiuxetan.Approved, Vet Approved
AlprostadilThe risk or severity of adverse effects can be increased when Alprostadil is combined with Ibritumomab tiuxetan.Approved, Investigational
ALT-110The risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with ALT-110.Investigational
AnagrelideThe risk or severity of adverse effects can be increased when Anagrelide is combined with Ibritumomab tiuxetan.Approved
AncrodThe risk or severity of adverse effects can be increased when Ancrod is combined with Ibritumomab tiuxetan.Investigational
Antithrombin III humanThe risk or severity of adverse effects can be increased when Antithrombin III human is combined with Ibritumomab tiuxetan.Approved
ApixabanThe risk or severity of adverse effects can be increased when Apixaban is combined with Ibritumomab tiuxetan.Approved
ArdeparinThe risk or severity of adverse effects can be increased when Ardeparin is combined with Ibritumomab tiuxetan.Approved, Withdrawn
ArgatrobanThe risk or severity of adverse effects can be increased when Argatroban is combined with Ibritumomab tiuxetan.Approved, Investigational
AzelastineThe risk or severity of adverse effects can be increased when Azelastine is combined with Ibritumomab tiuxetan.Approved
BcgThe therapeutic efficacy of Bcg can be decreased when used in combination with Ibritumomab tiuxetan.Investigational
BecaplerminThe risk or severity of adverse effects can be increased when Becaplermin is combined with Ibritumomab tiuxetan.Approved, Investigational
BeraprostThe risk or severity of adverse effects can be increased when Beraprost is combined with Ibritumomab tiuxetan.Investigational
BivalirudinThe risk or severity of adverse effects can be increased when Bivalirudin is combined with Ibritumomab tiuxetan.Approved, Investigational
ButylphthalideThe risk or severity of adverse effects can be increased when Butylphthalide is combined with Ibritumomab tiuxetan.Investigational
CangrelorThe risk or severity of adverse effects can be increased when Cangrelor is combined with Ibritumomab tiuxetan.Approved
CDX-110The risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with CDX-110.Investigational
CertoparinThe risk or severity of adverse effects can be increased when Certoparin is combined with Ibritumomab tiuxetan.Approved
CilostazolThe risk or severity of adverse effects can be increased when Cilostazol is combined with Ibritumomab tiuxetan.Approved
Citric AcidThe risk or severity of adverse effects can be increased when Citric Acid is combined with Ibritumomab tiuxetan.Nutraceutical, Vet Approved
ClopidogrelThe risk or severity of adverse effects can be increased when Clopidogrel is combined with Ibritumomab tiuxetan.Approved, Nutraceutical
ClozapineThe risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with Clozapine.Approved
Dabigatran etexilateThe risk or severity of adverse effects can be increased when Dabigatran etexilate is combined with Ibritumomab tiuxetan.Approved
DalteparinThe risk or severity of adverse effects can be increased when Dalteparin is combined with Ibritumomab tiuxetan.Approved
DanaparoidThe risk or severity of adverse effects can be increased when Danaparoid is combined with Ibritumomab tiuxetan.Approved, Withdrawn
DefibrotideThe risk or severity of adverse effects can be increased when Defibrotide is combined with Ibritumomab tiuxetan.Approved, Investigational
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Ibritumomab tiuxetan.Approved
DesirudinThe risk or severity of adverse effects can be increased when Desirudin is combined with Ibritumomab tiuxetan.Approved
DextranThe risk or severity of adverse effects can be increased when Dextran is combined with Ibritumomab tiuxetan.Approved, Vet Approved
Dextran 40The risk or severity of adverse effects can be increased when Dextran 40 is combined with Ibritumomab tiuxetan.Approved
Dextran 70The risk or severity of adverse effects can be increased when Dextran 70 is combined with Ibritumomab tiuxetan.Approved
Dextran 75The risk or severity of adverse effects can be increased when Dextran 75 is combined with Ibritumomab tiuxetan.Approved
DicoumarolThe risk or severity of adverse effects can be increased when Dicoumarol is combined with Ibritumomab tiuxetan.Approved
DipyridamoleThe risk or severity of adverse effects can be increased when Dipyridamole is combined with Ibritumomab tiuxetan.Approved
Edetic AcidThe risk or severity of adverse effects can be increased when Edetic Acid is combined with Ibritumomab tiuxetan.Approved, Vet Approved
EdoxabanThe risk or severity of adverse effects can be increased when Edoxaban is combined with Ibritumomab tiuxetan.Approved
EnoxaparinThe risk or severity of adverse effects can be increased when Enoxaparin is combined with Ibritumomab tiuxetan.Approved
EpinastineThe risk or severity of adverse effects can be increased when Epinastine is combined with Ibritumomab tiuxetan.Approved, Investigational
eplivanserineThe risk or severity of adverse effects can be increased when eplivanserine is combined with Ibritumomab tiuxetan.Investigational
EpoprostenolThe risk or severity of adverse effects can be increased when Epoprostenol is combined with Ibritumomab tiuxetan.Approved
EptifibatideThe risk or severity of adverse effects can be increased when Eptifibatide is combined with Ibritumomab tiuxetan.Approved, Investigational
Ethyl biscoumacetateThe risk or severity of adverse effects can be increased when Ethyl biscoumacetate is combined with Ibritumomab tiuxetan.Withdrawn
FingolimodIbritumomab tiuxetan may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
FluindioneThe risk or severity of adverse effects can be increased when Fluindione is combined with Ibritumomab tiuxetan.Investigational
FondaparinuxThe risk or severity of adverse effects can be increased when Fondaparinux is combined with Ibritumomab tiuxetan.Investigational
Fondaparinux sodiumThe risk or severity of adverse effects can be increased when Fondaparinux sodium is combined with Ibritumomab tiuxetan.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with G17DT.Investigational
GabexateThe risk or severity of adverse effects can be increased when Gabexate is combined with Ibritumomab tiuxetan.Investigational
GI-5005The risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with GI-5005.Investigational
HeparinThe risk or severity of adverse effects can be increased when Heparin is combined with Ibritumomab tiuxetan.Approved, Investigational
HirulogThe risk or severity of adverse effects can be increased when Hirulog is combined with Ibritumomab tiuxetan.Experimental
IbudilastThe risk or severity of adverse effects can be increased when Ibudilast is combined with Ibritumomab tiuxetan.Approved, Investigational
Icosapent ethylThe risk or severity of adverse effects can be increased when Icosapent ethyl is combined with Ibritumomab tiuxetan.Approved, Nutraceutical
idraparinuxThe risk or severity of adverse effects can be increased when idraparinux is combined with Ibritumomab tiuxetan.Investigational
IfenprodilThe risk or severity of adverse effects can be increased when Ifenprodil is combined with Ibritumomab tiuxetan.Approved, Withdrawn
IloprostThe risk or severity of adverse effects can be increased when Iloprost is combined with Ibritumomab tiuxetan.Approved, Investigational
INGN 201The risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with INGN 225.Investigational
KetanserinThe risk or severity of adverse effects can be increased when Ketanserin is combined with Ibritumomab tiuxetan.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with Leflunomide.Approved, Investigational
LepirudinThe risk or severity of adverse effects can be increased when Lepirudin is combined with Ibritumomab tiuxetan.Approved
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Ibritumomab tiuxetan.Withdrawn
MilrinoneThe risk or severity of adverse effects can be increased when Milrinone is combined with Ibritumomab tiuxetan.Approved
NadroparinThe risk or severity of adverse effects can be increased when Nadroparin is combined with Ibritumomab tiuxetan.Approved
NafamostatThe risk or severity of adverse effects can be increased when Nafamostat is combined with Ibritumomab tiuxetan.Investigational
NaftopidilThe risk or severity of adverse effects can be increased when Naftopidil is combined with Ibritumomab tiuxetan.Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with Natalizumab.Approved, Investigational
NCX 4016The risk or severity of adverse effects can be increased when NCX 4016 is combined with Ibritumomab tiuxetan.Investigational
NimesulideThe risk or severity of adverse effects can be increased when Nimesulide is combined with Ibritumomab tiuxetan.Approved, Withdrawn
NitroaspirinThe risk or severity of adverse effects can be increased when Nitroaspirin is combined with Ibritumomab tiuxetan.Investigational
OtamixabanThe risk or severity of adverse effects can be increased when Otamixaban is combined with Ibritumomab tiuxetan.Investigational
Pentosan PolysulfateThe risk or severity of adverse effects can be increased when Pentosan Polysulfate is combined with Ibritumomab tiuxetan.Approved
PentoxifyllineThe risk or severity of adverse effects can be increased when Pentoxifylline is combined with Ibritumomab tiuxetan.Approved, Investigational
PhenindioneThe risk or severity of adverse effects can be increased when Phenindione is combined with Ibritumomab tiuxetan.Approved
PhenprocoumonThe risk or severity of adverse effects can be increased when Phenprocoumon is combined with Ibritumomab tiuxetan.Approved
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Ibritumomab tiuxetan.Approved, Investigational
PrasugrelThe risk or severity of adverse effects can be increased when Prasugrel is combined with Ibritumomab tiuxetan.Approved
Protein CThe risk or severity of adverse effects can be increased when Protein C is combined with Ibritumomab tiuxetan.Approved
Protein S humanThe risk or severity of adverse effects can be increased when Protein S human is combined with Ibritumomab tiuxetan.Approved
ProtocatechualdehydeThe risk or severity of adverse effects can be increased when Protocatechualdehyde is combined with Ibritumomab tiuxetan.Approved
Rabies vaccineThe risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with Rabies vaccine.Approved
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Ibritumomab tiuxetan.Approved
RamatrobanThe risk or severity of adverse effects can be increased when Ramatroban is combined with Ibritumomab tiuxetan.Investigational
ResveratrolThe risk or severity of adverse effects can be increased when Resveratrol is combined with Ibritumomab tiuxetan.Experimental, Investigational
ReviparinThe risk or severity of adverse effects can be increased when Reviparin is combined with Ibritumomab tiuxetan.Approved
RidogrelThe risk or severity of adverse effects can be increased when Ridogrel is combined with Ibritumomab tiuxetan.Approved
RivaroxabanThe risk or severity of adverse effects can be increased when Rivaroxaban is combined with Ibritumomab tiuxetan.Approved
RoflumilastRoflumilast may increase the immunosuppressive activities of Ibritumomab tiuxetan.Approved
SCH-530348The risk or severity of adverse effects can be increased when SCH-530348 is combined with Ibritumomab tiuxetan.Investigational
SevofluraneThe risk or severity of adverse effects can be increased when Sevoflurane is combined with Ibritumomab tiuxetan.Approved, Vet Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Ibritumomab tiuxetan.Approved
SRP 299The risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with SRP 299.Investigational
SRT501The risk or severity of adverse effects can be increased when SRT501 is combined with Ibritumomab tiuxetan.Investigational
SulodexideThe risk or severity of adverse effects can be increased when Sulodexide is combined with Ibritumomab tiuxetan.Approved, Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Ibritumomab tiuxetan.Approved, Investigational
TesmilifeneThe risk or severity of adverse effects can be increased when Tesmilifene is combined with Ibritumomab tiuxetan.Investigational
TG4010The risk or severity of adverse effects can be increased when Ibritumomab tiuxetan is combined with TG4010.Investigational
TiclopidineThe risk or severity of adverse effects can be increased when Ticlopidine is combined with Ibritumomab tiuxetan.Approved
TirofibanThe risk or severity of adverse effects can be increased when Tirofiban is combined with Ibritumomab tiuxetan.Approved
TofacitinibIbritumomab tiuxetan may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
TranilastThe risk or severity of adverse effects can be increased when Tranilast is combined with Ibritumomab tiuxetan.Approved, Investigational
TrapidilThe risk or severity of adverse effects can be increased when Trapidil is combined with Ibritumomab tiuxetan.Approved
TrastuzumabTrastuzumab may increase the neutropenic activities of Ibritumomab tiuxetan.Approved, Investigational
TriflusalThe risk or severity of adverse effects can be increased when Triflusal is combined with Ibritumomab tiuxetan.Approved
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Ibritumomab tiuxetan.Approved
WarfarinThe risk or severity of adverse effects can be increased when Warfarin is combined with Ibritumomab tiuxetan.Approved
XimelagatranThe risk or severity of adverse effects can be increased when Ximelagatran is combined with Ibritumomab tiuxetan.Approved, Investigational, Withdrawn
Ym150The risk or severity of adverse effects can be increased when Ym150 is combined with Ibritumomab tiuxetan.Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Link [Link]
External Links
ATC CodesNot Available
AHFS CodesNot Available
PDB Entries
FDA labelDownload (102 KB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Kit
KitIntravenous1.6 mg/ml
Prices
Unit descriptionCostUnit
Zevalin y-90 kit37800.0USD kit
Zevalin in-111 kit4200.0USD kit
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2149329 No2008-07-152013-11-12Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.359Not Available
isoelectric point7.91Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Mhc class ii protein complex binding
Specific Function:
This protein may be involved in the regulation of B-cell activation and proliferation.
Gene Name:
MS4A1
Uniprot ID:
P11836
Molecular Weight:
33076.99 Da
References
  1. Wiseman GA, White CA, Witzig TE, Gordon LI, Emmanouilides C, Raubitschek A, Janakiraman N, Gutheil J, Schilder RJ, Spies S, Silverman DH, Grillo-Lopez AJ: Radioimmunotherapy of relapsed non-Hodgkin's lymphoma with zevalin, a 90Y-labeled anti-CD20 monoclonal antibody. Clin Cancer Res. 1999 Oct;5(10 Suppl):3281s-3286s. [PubMed:10541376 ]
  2. Goldenberg DM: The role of radiolabeled antibodies in the treatment of non-Hodgkin's lymphoma: the coming of age of radioimmunotherapy. Crit Rev Oncol Hematol. 2001 Jul-Aug;39(1-2):195-201. [PubMed:11418316 ]
  3. Dillman RO: Monoclonal antibody therapy for lymphoma: an update. Cancer Pract. 2001 Mar-Apr;9(2):71-80. [PubMed:11879282 ]
  4. Witzig TE, Gordon LI, Cabanillas F, Czuczman MS, Emmanouilides C, Joyce R, Pohlman BL, Bartlett NL, Wiseman GA, Padre N, Grillo-Lopez AJ, Multani P, White CA: Randomized controlled trial of yttrium-90-labeled ibritumomab tiuxetan radioimmunotherapy versus rituximab immunotherapy for patients with relapsed or refractory low-grade, follicular, or transformed B-cell non-Hodgkin's lymphoma. J Clin Oncol. 2002 May 15;20(10):2453-63. [PubMed:12011122 ]
  5. Witzig TE: Yttrium-90-ibritumomab tiuxetan radioimmunotherapy: a new treatment approach for B-cell non-Hodgkin's lymphoma. Drugs Today (Barc). 2004 Feb;40(2):111-9. [PubMed:15045033 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  7. Goldsmith SJ: Radioimmunotherapy of lymphoma: Bexxar and Zevalin. Semin Nucl Med. 2010 Mar;40(2):122-35. doi: 10.1053/j.semnuclmed.2009.11.002. [PubMed:20113680 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23