You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameTositumomab
Accession NumberDB00081  (BTD00085, BIOD00085)
TypeBiotech
GroupsApproved
DescriptionMurine IgG2a lambda monoclonal antibody against CD20 antigen (2 heavy chains of 451 residues, 2 lambda chains of 220 residues). It is produced in an antibiotic-free culture of mammalian cells. It can be covalently linked to Iodine 131 (a radioactive isotope of iodine).
Protein structureDb00081
Related Articles
Protein chemical formulaC6416H9874N1688O1987S44
Protein average weight143859.7 Da
Sequences
>Mouse-Human chimeric Anti-CD20 Heavy Chain 1
QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSY
NQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTV
SGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK
>Mouse-Human chimeric Anti-CD20 Light Chain 1
QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPAR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNR
>Mouse-Human chimeric Anti-CD20 Heavy Chain 2
QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSY
NQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTV
SGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK
>Mouse-Human chimeric Anti-CD20 Light Chain 2
QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYAPSNLASGVPAR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWSFNPPTFGAGTKLELKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNR
Download FASTA Format
Synonyms
Ig gamma-1 chain C region
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Bexxar TherapyKit; Solution14 mgIntravenousGlaxosmithkline Inc2006-04-102014-07-31Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
BexxarCorixa Corp
Brand mixturesNot Available
Salts
Name/CASStructureProperties
Tositumomab I-131
192391-48-3
ThumbNot applicableDBSALT001781
Categories
UNII0343IGH41U
CAS number208921-02-2
Pharmacology
IndicationFor treatment of non-Hodgkin's lymphoma (CD20 positive, follicular)
Structured Indications Not Available
PharmacodynamicsTositumomab binds to the CD20 antigen, which is predominantly expressed on mature B cells and on >90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of actionBinds to the CD20 antigen which is found on mature B lymphocytes. The antibody binding appears to induce apoptosis, complement-dependent cytotoxicity and cell death through ionizing radiation.
TargetKindPharmacological actionActionsOrganismUniProt ID
B-lymphocyte antigen CD20Proteinyes
antibody
HumanP11836 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to B lymphocytes, or by human antimurine antibody production

Route of eliminationElimination of Iodine-131 occurs by decay and excretion in the urine.
Half life0.8 hours (mammalian reticulocytes, in vitro)
Clearance
  • 68.2 mg/hr [patients with NHL]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tositumomab.Approved
AcenocoumarolThe risk or severity of adverse effects can be increased when Acenocoumarol is combined with Tositumomab.Approved
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Tositumomab.Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Acetylsalicylic acid is combined with Tositumomab.Approved, Vet Approved
AlprostadilThe risk or severity of adverse effects can be increased when Alprostadil is combined with Tositumomab.Approved, Investigational
ALT-110The risk or severity of adverse effects can be increased when Tositumomab is combined with ALT-110.Investigational
AnagrelideThe risk or severity of adverse effects can be increased when Anagrelide is combined with Tositumomab.Approved
AncrodThe risk or severity of adverse effects can be increased when Ancrod is combined with Tositumomab.Investigational
Antithrombin III humanThe risk or severity of adverse effects can be increased when Antithrombin III human is combined with Tositumomab.Approved
AnvirzelAnvirzel may decrease the cardiotoxic activities of Tositumomab.Investigational
ApixabanThe risk or severity of adverse effects can be increased when Apixaban is combined with Tositumomab.Approved
ArdeparinThe risk or severity of adverse effects can be increased when Ardeparin is combined with Tositumomab.Approved, Withdrawn
ArgatrobanThe risk or severity of adverse effects can be increased when Argatroban is combined with Tositumomab.Approved, Investigational
AzelastineThe risk or severity of adverse effects can be increased when Azelastine is combined with Tositumomab.Approved
BcgThe therapeutic efficacy of Bcg can be decreased when used in combination with Tositumomab.Investigational
BecaplerminThe risk or severity of adverse effects can be increased when Becaplermin is combined with Tositumomab.Approved, Investigational
BeraprostThe risk or severity of adverse effects can be increased when Beraprost is combined with Tositumomab.Investigational
BevacizumabBevacizumab may increase the cardiotoxic activities of Tositumomab.Approved, Investigational
BivalirudinThe risk or severity of adverse effects can be increased when Bivalirudin is combined with Tositumomab.Approved, Investigational
ButylphthalideThe risk or severity of adverse effects can be increased when Butylphthalide is combined with Tositumomab.Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Tositumomab.Approved
CangrelorThe risk or severity of adverse effects can be increased when Cangrelor is combined with Tositumomab.Approved
CDX-110The risk or severity of adverse effects can be increased when Tositumomab is combined with CDX-110.Investigational
CertoparinThe risk or severity of adverse effects can be increased when Certoparin is combined with Tositumomab.Approved
CilostazolThe risk or severity of adverse effects can be increased when Cilostazol is combined with Tositumomab.Approved
Citric AcidThe risk or severity of adverse effects can be increased when Citric Acid is combined with Tositumomab.Nutraceutical, Vet Approved
ClopidogrelThe risk or severity of adverse effects can be increased when Clopidogrel is combined with Tositumomab.Approved, Nutraceutical
ClozapineThe risk or severity of adverse effects can be increased when Tositumomab is combined with Clozapine.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Tositumomab.Approved, Investigational
Dabigatran etexilateThe risk or severity of adverse effects can be increased when Dabigatran etexilate is combined with Tositumomab.Approved
DalteparinThe risk or severity of adverse effects can be increased when Dalteparin is combined with Tositumomab.Approved
DanaparoidThe risk or severity of adverse effects can be increased when Danaparoid is combined with Tositumomab.Approved, Withdrawn
DefibrotideThe risk or severity of adverse effects can be increased when Defibrotide is combined with Tositumomab.Approved, Investigational
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Tositumomab.Approved
DesirudinThe risk or severity of adverse effects can be increased when Desirudin is combined with Tositumomab.Approved
DeslanosideDeslanoside may decrease the cardiotoxic activities of Tositumomab.Approved
DextranThe risk or severity of adverse effects can be increased when Dextran is combined with Tositumomab.Approved, Vet Approved
Dextran 40The risk or severity of adverse effects can be increased when Dextran 40 is combined with Tositumomab.Approved
Dextran 70The risk or severity of adverse effects can be increased when Dextran 70 is combined with Tositumomab.Approved
Dextran 75The risk or severity of adverse effects can be increased when Dextran 75 is combined with Tositumomab.Approved
DicoumarolThe risk or severity of adverse effects can be increased when Dicoumarol is combined with Tositumomab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Tositumomab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Tositumomab.Approved
DipyridamoleThe risk or severity of adverse effects can be increased when Dipyridamole is combined with Tositumomab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Tositumomab.Approved, Investigational
Edetic AcidThe risk or severity of adverse effects can be increased when Edetic Acid is combined with Tositumomab.Approved, Vet Approved
EdoxabanThe risk or severity of adverse effects can be increased when Edoxaban is combined with Tositumomab.Approved
EnoxaparinThe risk or severity of adverse effects can be increased when Enoxaparin is combined with Tositumomab.Approved
EpinastineThe risk or severity of adverse effects can be increased when Epinastine is combined with Tositumomab.Approved, Investigational
eplivanserineThe risk or severity of adverse effects can be increased when eplivanserine is combined with Tositumomab.Investigational
EpoprostenolThe risk or severity of adverse effects can be increased when Epoprostenol is combined with Tositumomab.Approved
EptifibatideThe risk or severity of adverse effects can be increased when Eptifibatide is combined with Tositumomab.Approved, Investigational
Ethyl biscoumacetateThe risk or severity of adverse effects can be increased when Ethyl biscoumacetate is combined with Tositumomab.Withdrawn
FingolimodTositumomab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
FluindioneThe risk or severity of adverse effects can be increased when Fluindione is combined with Tositumomab.Investigational
FondaparinuxThe risk or severity of adverse effects can be increased when Fondaparinux is combined with Tositumomab.Investigational
Fondaparinux sodiumThe risk or severity of adverse effects can be increased when Fondaparinux sodium is combined with Tositumomab.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Tositumomab is combined with G17DT.Investigational
GabexateThe risk or severity of adverse effects can be increased when Gabexate is combined with Tositumomab.Investigational
GI-5005The risk or severity of adverse effects can be increased when Tositumomab is combined with GI-5005.Investigational
HeparinThe risk or severity of adverse effects can be increased when Heparin is combined with Tositumomab.Approved, Investigational
HirulogThe risk or severity of adverse effects can be increased when Hirulog is combined with Tositumomab.Experimental
IbudilastThe risk or severity of adverse effects can be increased when Ibudilast is combined with Tositumomab.Approved, Investigational
Icosapent ethylThe risk or severity of adverse effects can be increased when Icosapent ethyl is combined with Tositumomab.Approved, Nutraceutical
idraparinuxThe risk or severity of adverse effects can be increased when idraparinux is combined with Tositumomab.Investigational
IfenprodilThe risk or severity of adverse effects can be increased when Ifenprodil is combined with Tositumomab.Approved, Withdrawn
IloprostThe risk or severity of adverse effects can be increased when Iloprost is combined with Tositumomab.Approved, Investigational
INGN 201The risk or severity of adverse effects can be increased when Tositumomab is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Tositumomab is combined with INGN 225.Investigational
KetanserinThe risk or severity of adverse effects can be increased when Ketanserin is combined with Tositumomab.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Tositumomab is combined with Leflunomide.Approved, Investigational
LepirudinThe risk or severity of adverse effects can be increased when Lepirudin is combined with Tositumomab.Approved
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Tositumomab.Withdrawn
MilrinoneThe risk or severity of adverse effects can be increased when Milrinone is combined with Tositumomab.Approved
NadroparinThe risk or severity of adverse effects can be increased when Nadroparin is combined with Tositumomab.Approved
NafamostatThe risk or severity of adverse effects can be increased when Nafamostat is combined with Tositumomab.Investigational
NaftopidilThe risk or severity of adverse effects can be increased when Naftopidil is combined with Tositumomab.Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Tositumomab is combined with Natalizumab.Approved, Investigational
NCX 4016The risk or severity of adverse effects can be increased when NCX 4016 is combined with Tositumomab.Investigational
NimesulideThe risk or severity of adverse effects can be increased when Nimesulide is combined with Tositumomab.Approved, Withdrawn
NitroaspirinThe risk or severity of adverse effects can be increased when Nitroaspirin is combined with Tositumomab.Investigational
OtamixabanThe risk or severity of adverse effects can be increased when Otamixaban is combined with Tositumomab.Investigational
OuabainOuabain may decrease the cardiotoxic activities of Tositumomab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Tositumomab.Approved, Vet Approved
Pentosan PolysulfateThe risk or severity of adverse effects can be increased when Pentosan Polysulfate is combined with Tositumomab.Approved
PentoxifyllineThe risk or severity of adverse effects can be increased when Pentoxifylline is combined with Tositumomab.Approved, Investigational
PhenindioneThe risk or severity of adverse effects can be increased when Phenindione is combined with Tositumomab.Approved
PhenprocoumonThe risk or severity of adverse effects can be increased when Phenprocoumon is combined with Tositumomab.Approved
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Tositumomab.Approved, Investigational
PrasugrelThe risk or severity of adverse effects can be increased when Prasugrel is combined with Tositumomab.Approved
Protein CThe risk or severity of adverse effects can be increased when Protein C is combined with Tositumomab.Approved
Protein S humanThe risk or severity of adverse effects can be increased when Protein S human is combined with Tositumomab.Approved
ProtocatechualdehydeThe risk or severity of adverse effects can be increased when Protocatechualdehyde is combined with Tositumomab.Approved
Rabies vaccineThe risk or severity of adverse effects can be increased when Tositumomab is combined with Rabies vaccine.Approved
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Tositumomab.Approved
RamatrobanThe risk or severity of adverse effects can be increased when Ramatroban is combined with Tositumomab.Investigational
ResveratrolThe risk or severity of adverse effects can be increased when Resveratrol is combined with Tositumomab.Experimental, Investigational
ReviparinThe risk or severity of adverse effects can be increased when Reviparin is combined with Tositumomab.Approved
RidogrelThe risk or severity of adverse effects can be increased when Ridogrel is combined with Tositumomab.Approved
RivaroxabanThe risk or severity of adverse effects can be increased when Rivaroxaban is combined with Tositumomab.Approved
RoflumilastRoflumilast may increase the immunosuppressive activities of Tositumomab.Approved
SCH-530348The risk or severity of adverse effects can be increased when SCH-530348 is combined with Tositumomab.Investigational
SevofluraneThe risk or severity of adverse effects can be increased when Sevoflurane is combined with Tositumomab.Approved, Vet Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Tositumomab.Approved
SRP 299The risk or severity of adverse effects can be increased when Tositumomab is combined with SRP 299.Investigational
SRT501The risk or severity of adverse effects can be increased when SRT501 is combined with Tositumomab.Investigational
SulodexideThe risk or severity of adverse effects can be increased when Sulodexide is combined with Tositumomab.Approved, Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Tositumomab.Approved, Investigational
TesmilifeneThe risk or severity of adverse effects can be increased when Tesmilifene is combined with Tositumomab.Investigational
TG4010The risk or severity of adverse effects can be increased when Tositumomab is combined with TG4010.Investigational
TiclopidineThe risk or severity of adverse effects can be increased when Ticlopidine is combined with Tositumomab.Approved
TirofibanThe risk or severity of adverse effects can be increased when Tirofiban is combined with Tositumomab.Approved
TofacitinibTositumomab may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
TranilastThe risk or severity of adverse effects can be increased when Tranilast is combined with Tositumomab.Approved, Investigational
TrapidilThe risk or severity of adverse effects can be increased when Trapidil is combined with Tositumomab.Approved
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Tositumomab.Approved, Investigational
TrastuzumabTrastuzumab may increase the neutropenic activities of Tositumomab.Approved, Investigational
TriflusalThe risk or severity of adverse effects can be increased when Triflusal is combined with Tositumomab.Approved
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Tositumomab.Approved
WarfarinThe risk or severity of adverse effects can be increased when Warfarin is combined with Tositumomab.Approved
XimelagatranThe risk or severity of adverse effects can be increased when Ximelagatran is combined with Tositumomab.Approved, Investigational, Withdrawn
Ym150The risk or severity of adverse effects can be increased when Ym150 is combined with Tositumomab.Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General ReferencesNot Available
External Links
ATC CodesNot Available
AHFS Codes
  • 10:00.00
PDB Entries
FDA labelNot Available
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Kit; solutionIntravenous14 mg
Prices
Unit descriptionCostUnit
Bexxar 131 iodine dosimetric180.77USD ml
Bexxar 14 mg/ml dosimetric100.43USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
PatentsNot Available
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.414Not Available
isoelectric point8.68Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Mhc class ii protein complex binding
Specific Function:
This protein may be involved in the regulation of B-cell activation and proliferation.
Gene Name:
MS4A1
Uniprot ID:
P11836
Molecular Weight:
33076.99 Da
References
  1. Goldenberg DM: The role of radiolabeled antibodies in the treatment of non-Hodgkin's lymphoma: the coming of age of radioimmunotherapy. Crit Rev Oncol Hematol. 2001 Jul-Aug;39(1-2):195-201. [PubMed:11418316 ]
  2. Dillman RO: Monoclonal antibody therapy for lymphoma: an update. Cancer Pract. 2001 Mar-Apr;9(2):71-80. [PubMed:11879282 ]
  3. Authors unspecified: Iodine-131 Tositumomab: (131)I-anti-B1 antibody, (131)I-tositumomab, anti-CD20 murine monoclonal antibody-I-131, B1, Bexxar, (131)I-anti-B1 antibody, iodine-131 tositumomab, iodine-131 anti-B1 antibody, tositumomab. BioDrugs. 2003;17(4):290-5. [PubMed:12899647 ]
  4. Friedberg JW, Fisher RI: Iodine-131 tositumomab (Bexxar): radioimmunoconjugate therapy for indolent and transformed B-cell non-Hodgkin's lymphoma. Expert Rev Anticancer Ther. 2004 Feb;4(1):18-26. [PubMed:14748653 ]
  5. Silverman DH, Delpassand ES, Torabi F, Goy A, McLaughlin P, Murray JL: Radiolabeled antibody therapy in non-Hodgkins lymphoma: radiation protection, isotope comparisons and quality of life issues. Cancer Treat Rev. 2004 Apr;30(2):165-72. [PubMed:15023434 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  7. Beeson C, Butrynski JE, Hart MJ, Nourigat C, Matthews DC, Press OW, Senter PD, Bernstein ID: Conditionally cleavable radioimmunoconjugates: a novel approach for the release of radioisotopes from radioimmunoconjugates. Bioconjug Chem. 2003 Sep-Oct;14(5):927-33. [PubMed:13129395 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 19, 2016 10:51