Identification

Name
Streptokinase
Accession Number
DB00086  (BTD00028, BIOD00028)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Thrombolytic agents
Description

Streptokinase, is a sterile, purified preparation of a bacterial protein elaborated by group C (beta) -hemolytic streptococci.

Protein structure
Db00086
Protein chemical formula
C2100H3278N566O669S4
Protein average weight
47286.7 Da
Sequences
>Streptokinase Sequence DB00086
MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDIS
LKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSN
DDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQ
AKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGY
TIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKY
YVLKKGEKPYDPFDRSHLKLFTIKYVDVDTNELLKSEQLLTASERNLDFRDLYDPRDKAK
LLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEER
EVYSYLRYTGTPIPDNPNDK
Download FASTA Format
Synonyms
  • Streptokinase C precursor
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Kabikinase - Pws 1500000units/vialPowder, for solution1500000 unitIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-312001-07-30Canada
Kabikinase - Pws 250000 Unit/vialPowder, for solution250000 unitIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-311999-08-12Canada
Kabikinase - Pws 750000units/vialPowder, for solution750000 unitIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-312001-07-30Canada
StreptasePowder, for solution1500000 unitIntracoronary; IntravenousCsl Behring1994-12-312012-02-22Canada
StreptasePowder, for solution750000 unitIntracoronary; IntravenousCsl Behring1994-12-312012-02-22Canada
StreptasePowder, for solution250000 unitIntracoronary; IntravenousCsl Behring1994-12-312012-02-22Canada
Streptase Inj 1500000 Unit/vialPowder, for solution1500000 unitIntravenousHoechst Canada Inc.1991-12-311996-08-29Canada
Streptase Inj 250000unit/vialPowder, for solution250000 unitIntravenousHoechst Canada Inc.1981-12-311996-08-29Canada
Streptase Inj 750000unit/vialPowder, for solution750000 unitIntravenousHoechst Canada Inc.1981-12-311996-08-29Canada
Categories
UNII
8X1OXL3SNU
CAS number
9002-01-1

Pharmacology

Indication

For the treatment of acute evolving transmural myocardial infarction, pulmonary embolism, deep vein thrombosis, arterial thrombosis or emolism and occlusion of arteriovenous cannulae

Structured Indications
Not Available
Pharmacodynamics

Streptokinase creates an active complex which promotes the cleavage of the Arg/Val bond in plasminogen to form the proteolytic enzyme plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.

Mechanism of action

Plasminogen is an inactive molecule that becomes activated to plasmin when the Arg/Val bond is cleaved. Plasmin breaks down fibrin clots created by the blood clotting cascade. Streptokinase forms a highly specific 1:1 enzymatic complex with plasminogen which converts inactive plasminogen molecules into active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins. This in turn leads to the degradation of blood clots.

TargetActionsOrganism
APlasminogen
activator
Human
UProteinase-activated receptor 1
cleavage
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Streptokinase Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AbciximabStreptokinase may increase the anticoagulant activities of Abciximab.Approved
AcebutololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Acebutolol.Approved
AcenocoumarolStreptokinase may increase the anticoagulant activities of Acenocoumarol.Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Acetylsalicylic acid is combined with Streptokinase.Approved, Vet Approved
AldesleukinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Aldesleukin.Approved
AliskirenThe risk or severity of adverse effects can be increased when Streptokinase is combined with Aliskiren.Approved, Investigational
AloxiprinThe risk or severity of adverse effects can be increased when Aloxiprin is combined with Streptokinase.Experimental
AlprostadilAlprostadil may increase the anticoagulant activities of Streptokinase.Approved, Investigational
AmifostineThe risk or severity of adverse effects can be increased when Amifostine is combined with Streptokinase.Approved, Investigational
AmilorideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Amiloride.Approved
Aminosalicylic AcidThe risk or severity of adverse effects can be increased when Aminosalicylic Acid is combined with Streptokinase.Approved
AmiodaroneThe risk or severity of adverse effects can be increased when Amiodarone is combined with Streptokinase.Approved, Investigational
AmlodipineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Amlodipine.Approved
AmobarbitalAmobarbital may increase the hypotensive activities of Streptokinase.Approved, Illicit
Amphotericin BThe risk or severity of adverse effects can be increased when Amphotericin B is combined with Streptokinase.Approved, Investigational
Amyl NitriteThe risk or severity of adverse effects can be increased when Streptokinase is combined with Amyl Nitrite.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Streptokinase.Approved
AncrodStreptokinase may increase the anticoagulant activities of Ancrod.Investigational
AndrographolideAndrographolide may increase the anticoagulant activities of Streptokinase.Investigational
Antithrombin III humanStreptokinase may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanStreptokinase may increase the anticoagulant activities of Apixaban.Approved
ApomorphineThe risk or severity of adverse effects can be increased when Apomorphine is combined with Streptokinase.Approved, Investigational
ApraclonidineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Apraclonidine.Approved
AprotininThe therapeutic efficacy of Streptokinase can be decreased when used in combination with Aprotinin.Approved, Withdrawn
ArdeparinStreptokinase may increase the anticoagulant activities of Ardeparin.Approved, Investigational, Withdrawn
ArgatrobanStreptokinase may increase the anticoagulant activities of Argatroban.Approved, Investigational
AripiprazoleAripiprazole may increase the hypotensive activities of Streptokinase.Approved, Investigational
ArotinololThe risk or severity of adverse effects can be increased when Arotinolol is combined with Streptokinase.Approved, Investigational
Arsenic trioxideThe risk or severity of adverse effects can be increased when Arsenic trioxide is combined with Streptokinase.Approved, Investigational
AtenololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Atenolol.Approved
AzelastineAzelastine may increase the anticoagulant activities of Streptokinase.Approved
Azilsartan medoxomilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Azilsartan medoxomil.Approved
BalsalazideThe risk or severity of adverse effects can be increased when Balsalazide is combined with Streptokinase.Approved, Investigational
BarbexacloneBarbexaclone may increase the hypotensive activities of Streptokinase.Experimental
BarbitalBarbital may increase the hypotensive activities of Streptokinase.Illicit
BarnidipineThe risk or severity of adverse effects can be increased when Barnidipine is combined with Streptokinase.Approved
BecaplerminStreptokinase may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BenazeprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Benazepril.Approved, Investigational
BendroflumethiazideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Bendroflumethiazide.Approved
BepridilThe risk or severity of adverse effects can be increased when Bepridil is combined with Streptokinase.Approved, Withdrawn
BeraprostBeraprost may increase the anticoagulant activities of Streptokinase.Investigational
BetaxololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Betaxolol.Approved
BisoprololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Bisoprolol.Approved
BivalirudinStreptokinase may increase the anticoagulant activities of Bivalirudin.Approved, Investigational
BortezomibThe risk or severity of adverse effects can be increased when Bortezomib is combined with Streptokinase.Approved, Investigational
BretyliumThe risk or severity of adverse effects can be increased when Streptokinase is combined with Bretylium.Approved
BrimonidineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Brimonidine.Approved
BromocriptineThe risk or severity of adverse effects can be increased when Bromocriptine is combined with Streptokinase.Approved, Investigational
BuflomedilBuflomedil may increase the anticoagulant activities of Streptokinase.Experimental
BumetanideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Bumetanide.Approved
BupivacaineThe risk or severity of adverse effects can be increased when Bupivacaine is combined with Streptokinase.Approved, Investigational
ButylphthalideButylphthalide may increase the anticoagulant activities of Streptokinase.Investigational
CanagliflozinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Canagliflozin.Approved
Candesartan cilexetilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Candesartan cilexetil.Approved
CangrelorCangrelor may increase the anticoagulant activities of Streptokinase.Approved
CaptoprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Captopril.Approved
CarbetocinThe risk or severity of adverse effects can be increased when Carbetocin is combined with Streptokinase.Approved
CarteololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Carteolol.Approved
CarvedilolThe risk or severity of adverse effects can be increased when Streptokinase is combined with Carvedilol.Approved, Investigational
CertoparinStreptokinase may increase the anticoagulant activities of Certoparin.Approved, Investigational
ChlorothiazideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Chlorothiazide.Approved, Vet Approved
ChlorpromazineThe risk or severity of adverse effects can be increased when Chlorpromazine is combined with Streptokinase.Approved, Vet Approved
ChlorthalidoneThe risk or severity of adverse effects can be increased when Streptokinase is combined with Chlorthalidone.Approved
CilazaprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Cilazapril.Approved
CilnidipineThe risk or severity of adverse effects can be increased when Cilnidipine is combined with Streptokinase.Approved, Investigational
CilostazolCilostazol may increase the anticoagulant activities of Streptokinase.Approved
Citric AcidStreptokinase may increase the anticoagulant activities of Citric Acid.Approved, Nutraceutical, Vet Approved
ClevidipineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Clevidipine.Approved
ClofarabineThe risk or severity of adverse effects can be increased when Clofarabine is combined with Streptokinase.Approved, Investigational
ClomipramineThe risk or severity of adverse effects can be increased when Clomipramine is combined with Streptokinase.Approved, Vet Approved
ClonidineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Clonidine.Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Streptokinase.Approved, Nutraceutical
CloricromenCloricromen may increase the anticoagulant activities of Streptokinase.Experimental
ClorindioneStreptokinase may increase the anticoagulant activities of Clorindione.Experimental
ClozapineThe risk or severity of adverse effects can be increased when Clozapine is combined with Streptokinase.Approved
ConivaptanThe risk or severity of adverse effects can be increased when Conivaptan is combined with Streptokinase.Approved, Investigational
Dabigatran etexilateStreptokinase may increase the anticoagulant activities of Dabigatran etexilate.Approved
DalteparinStreptokinase may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidStreptokinase may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DapagliflozinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Dapagliflozin.Approved
DarexabanStreptokinase may increase the anticoagulant activities of Darexaban.Investigational
DefibrotideDefibrotide may increase the anticoagulant activities of Streptokinase.Approved, Investigational
dersalazineThe risk or severity of adverse effects can be increased when dersalazine is combined with Streptokinase.Investigational
DesfluraneThe risk or severity of adverse effects can be increased when Desflurane is combined with Streptokinase.Approved
DesirudinStreptokinase may increase the anticoagulant activities of Desirudin.Approved
DexmedetomidineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Dexmedetomidine.Approved, Vet Approved
DextranStreptokinase may increase the anticoagulant activities of Dextran.Approved, Vet Approved
Dextran 40Streptokinase may increase the anticoagulant activities of Dextran 40.Approved
Dextran 70Streptokinase may increase the anticoagulant activities of Dextran 70.Approved
Dextran 75Streptokinase may increase the anticoagulant activities of Dextran 75.Approved
DiclofenamideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Diclofenamide.Approved
DicoumarolStreptokinase may increase the anticoagulant activities of Dicoumarol.Approved
DiflunisalThe risk or severity of adverse effects can be increased when Diflunisal is combined with Streptokinase.Approved
DiltiazemThe risk or severity of adverse effects can be increased when Streptokinase is combined with Diltiazem.Approved
DinutuximabThe risk or severity of adverse effects can be increased when Streptokinase is combined with Dinutuximab.Approved
DiphenadioneStreptokinase may increase the anticoagulant activities of Diphenadione.Experimental
DipyridamoleThe risk or severity of adverse effects can be increased when Streptokinase is combined with Dipyridamole.Approved
DoxazosinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Doxazosin.Approved
DuloxetineStreptokinase may increase the orthostatic hypotensive activities of Duloxetine.Approved
Edetic AcidStreptokinase may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanStreptokinase may increase the anticoagulant activities of Edoxaban.Approved
EfonidipineThe risk or severity of adverse effects can be increased when Efonidipine is combined with Streptokinase.Approved, Investigational
EmpagliflozinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Empagliflozin.Approved
EnalaprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Enalapril.Approved, Vet Approved
EnalaprilatThe risk or severity of adverse effects can be increased when Enalaprilat is combined with Streptokinase.Approved
EnoxaparinStreptokinase may increase the anticoagulant activities of Enoxaparin.Approved
EpinastineEpinastine may increase the anticoagulant activities of Streptokinase.Approved, Investigational
EplerenoneThe risk or severity of adverse effects can be increased when Streptokinase is combined with Eplerenone.Approved
EplivanserinEplivanserin may increase the anticoagulant activities of Streptokinase.Investigational
eplivanserineeplivanserine may increase the anticoagulant activities of Streptokinase.Investigational
EpoprostenolThe risk or severity of adverse effects can be increased when Epoprostenol is combined with Streptokinase.Approved
EprosartanThe risk or severity of adverse effects can be increased when Streptokinase is combined with Eprosartan.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Streptokinase.Approved, Investigational
EsmololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Esmolol.Approved
Etacrynic acidThe risk or severity of adverse effects can be increased when Streptokinase is combined with Etacrynic acid.Approved
Ethyl biscoumacetateStreptokinase may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
FelodipineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Felodipine.Approved, Investigational
FenoldopamThe risk or severity of adverse effects can be increased when Fenoldopam is combined with Streptokinase.Approved
Ferulic acidStreptokinase may increase the anticoagulant activities of Ferulic acid.Experimental
FimasartanThe risk or severity of adverse effects can be increased when Fimasartan is combined with Streptokinase.Approved, Investigational
FluindioneStreptokinase may increase the anticoagulant activities of Fluindione.Investigational
FondaparinuxStreptokinase may increase the anticoagulant activities of Fondaparinux.Investigational
Fondaparinux sodiumStreptokinase may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
FosinoprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Fosinopril.Approved
FurosemideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Furosemide.Approved, Vet Approved
GabexateStreptokinase may increase the anticoagulant activities of Gabexate.Investigational
GuacetisalThe risk or severity of adverse effects can be increased when Guacetisal is combined with Streptokinase.Experimental
GuanfacineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Guanfacine.Approved, Investigational
HalothaneThe risk or severity of adverse effects can be increased when Halothane is combined with Streptokinase.Approved, Vet Approved
Hemoglobin crosfumarilThe risk or severity of adverse effects can be increased when Hemoglobin crosfumaril is combined with Streptokinase.Experimental
HeparinStreptokinase may increase the anticoagulant activities of Heparin.Approved, Investigational
HexobarbitalHexobarbital may increase the hypotensive activities of Streptokinase.Approved
HydralazineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Hydralazine.Approved
HydrochlorothiazideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Hydrochlorothiazide.Approved, Vet Approved
HydroflumethiazideThe risk or severity of adverse effects can be increased when Hydroflumethiazide is combined with Streptokinase.Approved, Investigational
HydroxytyrosolHydroxytyrosol may increase the anticoagulant activities of Streptokinase.Investigational
IbudilastIbudilast may increase the anticoagulant activities of Streptokinase.Approved, Investigational
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Streptokinase.Approved, Nutraceutical
IdraparinuxStreptokinase may increase the anticoagulant activities of Idraparinux.Investigational
IfenprodilIfenprodil may increase the anticoagulant activities of Streptokinase.Approved, Investigational, Withdrawn
IfetrobanIfetroban may increase the anticoagulant activities of Streptokinase.Investigational
IloprostThe risk or severity of adverse effects can be increased when Iloprost is combined with Streptokinase.Approved, Investigational
ImidaprilThe risk or severity of adverse effects can be increased when Imidapril is combined with Streptokinase.Investigational
ImipramineThe risk or severity of adverse effects can be increased when Imipramine is combined with Streptokinase.Approved
IndapamideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Indapamide.Approved
IndobufenIndobufen may increase the anticoagulant activities of Streptokinase.Investigational
IndoraminThe risk or severity of adverse effects can be increased when Indoramin is combined with Streptokinase.Withdrawn
IrbesartanThe risk or severity of adverse effects can be increased when Streptokinase is combined with Irbesartan.Approved, Investigational
IsocarboxazidThe risk or severity of adverse effects can be increased when Isocarboxazid is combined with Streptokinase.Approved
IsofluraneThe risk or severity of adverse effects can be increased when Isoflurane is combined with Streptokinase.Approved, Vet Approved
Isosorbide DinitrateThe risk or severity of adverse effects can be increased when Streptokinase is combined with Isosorbide Dinitrate.Approved
Isosorbide MononitrateThe risk or severity of adverse effects can be increased when Streptokinase is combined with Isosorbide Mononitrate.Approved
IsoxsuprineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Isoxsuprine.Approved, Withdrawn
IsradipineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Isradipine.Approved
KetanserinKetanserin may increase the anticoagulant activities of Streptokinase.Investigational
LabetalolThe risk or severity of adverse effects can be increased when Streptokinase is combined with Labetalol.Approved
LacidipineThe risk or severity of adverse effects can be increased when Lacidipine is combined with Streptokinase.Approved, Investigational
LepirudinStreptokinase may increase the anticoagulant activities of Lepirudin.Approved
LercanidipineThe risk or severity of adverse effects can be increased when Lercanidipine is combined with Streptokinase.Approved, Investigational
LetaxabanStreptokinase may increase the anticoagulant activities of Letaxaban.Investigational
LevobunololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Levobunolol.Approved
LevobupivacaineThe risk or severity of adverse effects can be increased when Levobupivacaine is combined with Streptokinase.Approved, Investigational
LevodopaStreptokinase may increase the orthostatic hypotensive activities of Levodopa.Approved
LevosimendanThe risk or severity of adverse effects can be increased when Levosimendan is combined with Streptokinase.Approved, Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Streptokinase.Approved, Investigational
LinsidomineLinsidomine may increase the anticoagulant activities of Streptokinase.Experimental
LisinoprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Lisinopril.Approved, Investigational
LofexidineThe risk or severity of adverse effects can be increased when Lofexidine is combined with Streptokinase.Approved, Investigational
LosartanThe risk or severity of adverse effects can be increased when Streptokinase is combined with Losartan.Approved
MannitolThe risk or severity of adverse effects can be increased when Streptokinase is combined with Mannitol.Approved, Investigational
MecamylamineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Mecamylamine.Approved
MelagatranStreptokinase may increase the anticoagulant activities of Melagatran.Experimental
MesalazineThe risk or severity of adverse effects can be increased when Mesalazine is combined with Streptokinase.Approved
MethazolamideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Methazolamide.Approved
MethohexitalMethohexital may increase the hypotensive activities of Streptokinase.Approved
MethyclothiazideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Methyclothiazide.Approved
Methyl salicylateThe risk or severity of adverse effects can be increased when Methyl salicylate is combined with Streptokinase.Approved, Vet Approved
MethyldopaThe risk or severity of adverse effects can be increased when Streptokinase is combined with Methyldopa.Approved
MethylphenobarbitalMethylphenobarbital may increase the hypotensive activities of Streptokinase.Approved
MetipranololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Metipranolol.Approved
MetolazoneThe risk or severity of adverse effects can be increased when Streptokinase is combined with Metolazone.Approved
MetoprololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Metoprolol.Approved, Investigational
MilrinoneMilrinone may increase the anticoagulant activities of Streptokinase.Approved
MinoxidilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Minoxidil.Approved
MoexiprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Moexipril.Approved
MorphineThe risk or severity of adverse effects can be increased when Morphine is combined with Streptokinase.Approved, Investigational
MoxonidineThe risk or severity of adverse effects can be increased when Moxonidine is combined with Streptokinase.Approved, Investigational
NabiloneThe risk or severity of adverse effects can be increased when Nabilone is combined with Streptokinase.Approved, Investigational
NadololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nadolol.Approved
NadroparinStreptokinase may increase the anticoagulant activities of Nadroparin.Approved
NafamostatStreptokinase may increase the anticoagulant activities of Nafamostat.Approved, Investigational
NaftopidilNaftopidil may increase the anticoagulant activities of Streptokinase.Investigational
NebivololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nebivolol.Approved, Investigational
NesiritideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nesiritide.Approved, Investigational
NicardipineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nicardipine.Approved
NicorandilNicorandil may increase the hypotensive activities of Streptokinase.Approved, Investigational
NifedipineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nifedipine.Approved
NilvadipineThe risk or severity of adverse effects can be increased when Nilvadipine is combined with Streptokinase.Approved, Investigational
NimesulideNimesulide may increase the anticoagulant activities of Streptokinase.Approved, Investigational, Withdrawn
NimodipineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nimodipine.Approved
NisoldipineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nisoldipine.Approved
NitrendipineThe risk or severity of adverse effects can be increased when Nitrendipine is combined with Streptokinase.Approved, Investigational
Nitric OxideThe risk or severity of adverse effects can be increased when Nitric Oxide is combined with Streptokinase.Approved
NitroaspirinThe risk or severity of adverse effects can be increased when Nitroaspirin is combined with Streptokinase.Investigational
NitroglycerinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nitroglycerin.Approved, Investigational
NitroprussideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nitroprusside.Approved
ObinutuzumabThe risk or severity of adverse effects can be increased when Obinutuzumab is combined with Streptokinase.Approved
OlmesartanThe risk or severity of adverse effects can be increased when Streptokinase is combined with Olmesartan.Approved, Investigational
OlsalazineThe risk or severity of adverse effects can be increased when Olsalazine is combined with Streptokinase.Approved
OtamixabanStreptokinase may increase the anticoagulant activities of Otamixaban.Investigational
OxprenololThe risk or severity of adverse effects can be increased when Oxprenolol is combined with Streptokinase.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Streptokinase.Approved, Vet Approved
PapaverineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Papaverine.Approved
PenbutololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Penbutolol.Approved, Investigational
Pentaerythritol TetranitrateStreptokinase may increase the anticoagulant activities of Pentaerythritol Tetranitrate.Approved
PentobarbitalPentobarbital may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
Pentosan PolysulfateStreptokinase may increase the anticoagulant activities of Pentosan Polysulfate.Approved
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Streptokinase.Approved, Investigational
PerindoprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Perindopril.Approved
PhenelzineThe risk or severity of adverse effects can be increased when Phenelzine is combined with Streptokinase.Approved
PhenindioneStreptokinase may increase the anticoagulant activities of Phenindione.Approved, Investigational
PhenobarbitalPhenobarbital may increase the hypotensive activities of Streptokinase.Approved
PhenoxybenzamineThe risk or severity of adverse effects can be increased when Phenoxybenzamine is combined with Streptokinase.Approved
PhenprocoumonStreptokinase may increase the anticoagulant activities of Phenprocoumon.Approved, Investigational
PhentolamineThe risk or severity of adverse effects can be increased when Phentolamine is combined with Streptokinase.Approved
PicotamidePicotamide may increase the anticoagulant activities of Streptokinase.Experimental
PindololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Pindolol.Approved
PipamperoneThe risk or severity of adverse effects can be increased when Pipamperone is combined with Streptokinase.Approved, Investigational
PramipexoleThe risk or severity of adverse effects can be increased when Pramipexole is combined with Streptokinase.Approved, Investigational
PrasugrelPrasugrel may increase the anticoagulant activities of Streptokinase.Approved
PrazosinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Prazosin.Approved
PrimidonePrimidone may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
PropofolThe risk or severity of adverse effects can be increased when Propofol is combined with Streptokinase.Approved, Investigational, Vet Approved
PropranololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Propranolol.Approved, Investigational
Protein CStreptokinase may increase the anticoagulant activities of Protein C.Approved
Protein S humanStreptokinase may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeStreptokinase may increase the anticoagulant activities of Protocatechualdehyde.Approved
QuetiapineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Quetiapine.Approved
QuinaprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Quinapril.Approved, Investigational
RamatrobanRamatroban may increase the anticoagulant activities of Streptokinase.Investigational
RamiprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Ramipril.Approved
RasagilineThe risk or severity of adverse effects can be increased when Rasagiline is combined with Streptokinase.Approved
RemifentanilThe risk or severity of adverse effects can be increased when Remifentanil is combined with Streptokinase.Approved
ReserpineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Reserpine.Approved, Investigational
ResveratrolResveratrol may increase the anticoagulant activities of Streptokinase.Approved, Experimental, Investigational
ReviparinStreptokinase may increase the anticoagulant activities of Reviparin.Approved, Investigational
RidogrelRidogrel may increase the anticoagulant activities of Streptokinase.Approved
RiociguatThe risk or severity of adverse effects can be increased when Streptokinase is combined with Riociguat.Approved
RisperidoneStreptokinase may increase the hypotensive activities of Risperidone.Approved, Investigational
RivaroxabanStreptokinase may increase the anticoagulant activities of Rivaroxaban.Approved
RopiniroleThe risk or severity of adverse effects can be increased when Ropinirole is combined with Streptokinase.Approved, Investigational
RopivacaineThe risk or severity of adverse effects can be increased when Ropivacaine is combined with Streptokinase.Approved
RotigotineThe risk or severity of adverse effects can be increased when Rotigotine is combined with Streptokinase.Approved
SacubitrilThe risk or severity of adverse effects can be increased when Sacubitril is combined with Streptokinase.Approved
Salicylic acidThe risk or severity of adverse effects can be increased when Salicylic acid is combined with Streptokinase.Approved, Vet Approved
SarpogrelateSarpogrelate may increase the anticoagulant activities of Streptokinase.Investigational
SecobarbitalSecobarbital may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
SelegilineThe risk or severity of adverse effects can be increased when Selegiline is combined with Streptokinase.Approved, Investigational, Vet Approved
SevofluraneThe risk or severity of adverse effects can be increased when Sevoflurane is combined with Streptokinase.Approved, Vet Approved
Sodium NitriteThe risk or severity of adverse effects can be increased when Sodium Nitrite is combined with Streptokinase.Approved
SotalolThe risk or severity of adverse effects can be increased when Streptokinase is combined with Sotalol.Approved
SpironolactoneThe risk or severity of adverse effects can be increased when Streptokinase is combined with Spironolactone.Approved
SRT501SRT501 may increase the anticoagulant activities of Streptokinase.Investigational
SufentanilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Sufentanil.Approved, Investigational
SulodexideStreptokinase may increase the anticoagulant activities of Sulodexide.Approved, Investigational
TamsulosinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tamsulosin.Approved, Investigational
TelmisartanThe risk or severity of adverse effects can be increased when Streptokinase is combined with Telmisartan.Approved, Investigational
TerazosinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Terazosin.Approved
TesmilifeneTesmilifene may increase the anticoagulant activities of Streptokinase.Investigational
ThalidomideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Thalidomide.Approved, Investigational, Withdrawn
ThiamylalThiamylal may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
ThiopentalThiopental may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
ThioridazineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Thioridazine.Approved, Withdrawn
TicagrelorTicagrelor may increase the anticoagulant activities of Streptokinase.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Streptokinase.Approved
TimololThe risk or severity of adverse effects can be increased when Streptokinase is combined with Timolol.Approved
TioclomarolStreptokinase may increase the anticoagulant activities of Tioclomarol.Experimental
TirofibanTirofiban may increase the anticoagulant activities of Streptokinase.Approved
TizanidineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tizanidine.Approved
TolazolineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tolazoline.Approved, Vet Approved
TolcaponeThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tolcapone.Approved, Withdrawn
TorasemideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Torasemide.Approved
TrandolaprilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Trandolapril.Approved
TranilastTranilast may increase the anticoagulant activities of Streptokinase.Approved, Investigational
TranylcypromineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tranylcypromine.Approved
TrapidilTrapidil may increase the anticoagulant activities of Streptokinase.Approved
TreprostinilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Treprostinil.Approved, Investigational
TretinoinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tretinoin.Approved, Investigational, Nutraceutical
TriamtereneThe risk or severity of adverse effects can be increased when Streptokinase is combined with Triamterene.Approved
TriflusalTriflusal may increase the anticoagulant activities of Streptokinase.Approved, Investigational
Trolamine salicylateThe risk or severity of adverse effects can be increased when Trolamine salicylate is combined with Streptokinase.Approved
TroxerutinStreptokinase may increase the anticoagulant activities of Troxerutin.Investigational
ValsartanThe risk or severity of adverse effects can be increased when Streptokinase is combined with Valsartan.Approved, Investigational
VerapamilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Verapamil.Approved
VorapaxarVorapaxar may increase the anticoagulant activities of Streptokinase.Approved
WarfarinStreptokinase may increase the anticoagulant activities of Warfarin.Approved
XimelagatranStreptokinase may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
Food Interactions
Not Available

References

Synthesis Reference

Lawrence Isaac Galler, "Streptokinase derivatives with high affinity for activated platelets and methods of their production and use in thrombolytic therapy." U.S. Patent US6087332, issued July, 1997.

US6087332
General References
Not Available
External Links
UniProt
P00779
Genbank
K02986
PubChem Substance
46505625
ChEMBL
CHEMBL2108147
Therapeutic Targets Database
DAP001198
PharmGKB
PA164754919
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Streptokinase
ATC Codes
B01AD01 — StreptokinaseB06AA55 — Streptokinase, combinations

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
2Unknown StatusTreatmentStroke, Ischemic1
2, 3CompletedTreatmentAcute Pancreatitis (AP)1
3CompletedTreatmentAcute Myocardial Infarction (AMI)1
3CompletedTreatmentCardiovascular Disease (CVD) / Coronary Heart Disease (CHD) / Heart Diseases / Myocardial Infarction (MI) / Myocardial Ischemia2
3CompletedTreatmentMyocardial Infarction (MI)1
3CompletedTreatmentProsthetic Valve Thrombosis1
4CompletedTreatmentAcute Coronary Syndromes (ACS) / Acute Myocardial Infarction (AMI) / Reperfusion Injury1
4CompletedTreatmentAcute Myocardial Infarction (AMI)1
4Not Yet RecruitingTreatmentPleural Effusions1
Not AvailableCompletedTreatmentProsthetic Valve Thrombosis1
Not AvailableWithdrawnNot AvailableAcute Coronary Syndromes (ACS) / Non ST Elevation Myocardial Infarction / ST Elevation Myocardial Infarction / Unstable Angina (UA)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Powder, for solutionIntracoronary; Intravenous1500000 unit
Powder, for solutionIntracoronary; Intravenous250000 unit
Powder, for solutionIntracoronary; Intravenous750000 unit
Powder, for solutionIntravenous1500000 unit
Powder, for solutionIntravenous250000 unit
Powder, for solutionIntravenous750000 unit
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.728Not Available
isoelectric point5.12Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Activator
General Function
Serine-type peptidase activity
Specific Function
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In...
Gene Name
PLG
Uniprot ID
P00747
Uniprot Name
Plasminogen
Molecular Weight
90568.415 Da
References
  1. Caballero AR, Lottenberg R, Johnston KH: Cloning, expression, sequence analysis, and characterization of streptokinases secreted by porcine and equine isolates of Streptococcus equisimilis. Infect Immun. 1999 Dec;67(12):6478-86. [PubMed:10569766]
  2. Alessi MC, Juhan-Vague I: [Thrombolytics and their use]. Rev Prat. 1999 Oct 1;49(15):1654-8. [PubMed:10581996]
  3. Chaudhary A, Vasudha S, Rajagopal K, Komath SS, Garg N, Yadav M, Mande SC, Sahni G: Function of the central domain of streptokinase in substrate plasminogen docking and processing revealed by site-directed mutagenesis. Protein Sci. 1999 Dec;8(12):2791-805. [PubMed:10631997]
  4. Parry MA, Zhang XC, Bode I: Molecular mechanisms of plasminogen activation: bacterial cofactors provide clues. Trends Biochem Sci. 2000 Feb;25(2):53-9. [PubMed:10664583]
  5. Korol'chuk VI, Makohonenko IeM, Sederkhol'm-Vil'iams SA: [Plasminogen binding with decapeptide and polypeptide fragments of streptokinase]. Ukr Biokhim Zh (1999). 1999 Sep-Oct;71(5):51-8. [PubMed:10726310]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Cleavage
General Function
Thrombin receptor activity
Specific Function
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
Gene Name
F2R
Uniprot ID
P25116
Uniprot Name
Proteinase-activated receptor 1
Molecular Weight
47439.83 Da
References
  1. McRedmond JP, Harriott P, Walker B, Fitzgerald DJ: Streptokinase-induced platelet activation involves antistreptokinase antibodies and cleavage of protease-activated receptor-1. Blood. 2000 Feb 15;95(4):1301-8. [PubMed:10666203]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Inducer
General Function
Phospholipase a2 activity
Specific Function
Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory...
Gene Name
PLA2G4A
Uniprot ID
P47712
Uniprot Name
Cytosolic phospholipase A2
Molecular Weight
85238.2 Da
References
  1. Kawaguchi H, Iizuka K, Sano H, Yasuda H: Effect of streptokinase on prostacyclin synthesis and phospholipase activity in cultured pulmonary artery endothelial cells. Biochim Biophys Acta. 1990 Dec 10;1055(3):223-9. [PubMed:2265209]

Drug created on June 13, 2005 07:24 / Updated on November 06, 2017 06:43