You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameStreptokinase
Accession NumberDB00086  (BTD00028, BIOD00028)
TypeBiotech
GroupsApproved
DescriptionStreptokinase, is a sterile, purified preparation of a bacterial protein elaborated by group C (beta) -hemolytic streptococci.
Protein structureDb00086
Related Articles
Protein chemical formulaC2100H3278N566O669S4
Protein average weight47286.7 Da
Sequences
>Streptokinase Sequence DB00086
MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDIS
LKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMSHKLEKADLLKAIQEQLIANVHSN
DDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLSGHVRVRPYKEKPIQNQ
AKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGY
TIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKY
YVLKKGEKPYDPFDRSHLKLFTIKYVDVDTNELLKSEQLLTASERNLDFRDLYDPRDKAK
LLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEER
EVYSYLRYTGTPIPDNPNDK
Download FASTA Format
Synonyms
Streptokinase C precursor
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Kabikinase - Pws 1500000units/vialPowder, for solution1500000 unitIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-312001-07-30Canada
Kabikinase - Pws 250000 Unit/vialPowder, for solution250000 unitIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-311999-08-12Canada
Kabikinase - Pws 750000units/vialPowder, for solution750000 unitIntracoronary; IntravenousPharmacia & Upjohn Inc1995-12-312001-07-30Canada
StreptasePowder, for solution750000 unitIntracoronary; IntravenousCsl Behring Canada Inc1994-12-312012-02-22Canada
StreptasePowder, for solution1500000 unitIntracoronary; IntravenousCsl Behring Canada Inc1994-12-312012-02-22Canada
StreptasePowder, for solution250000 unitIntracoronary; IntravenousCsl Behring Canada Inc1994-12-312012-02-22Canada
Streptase Inj 1500000 Unit/vialPowder, for solution1500000 unitIntravenousHoechst Canada Inc.1991-12-311996-08-29Canada
Streptase Inj 250000unit/vialPowder, for solution250000 unitIntravenousHoechst Canada Inc.1981-12-311996-08-29Canada
Streptase Inj 750000unit/vialPowder, for solution750000 unitIntravenousHoechst Canada Inc.1981-12-311996-08-29Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII8X1OXL3SNU
CAS number9002-01-1
Pharmacology
IndicationFor the treatment of acute evolving transmural myocardial infarction, pulmonary embolism, deep vein thrombosis, arterial thrombosis or emolism and occlusion of arteriovenous cannulae
Structured Indications Not Available
PharmacodynamicsStreptokinase creates an active complex which promotes the cleavage of the Arg/Val bond in plasminogen to form the proteolytic enzyme plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of actionPlasminogen is an inactive molecule that becomes activated to plasmin when the Arg/Val bond is cleaved. Plasmin breaks down fibrin clots created by the blood clotting cascade. Streptokinase forms a highly specific 1:1 enzymatic complex with plasminogen which converts inactive plasminogen molecules into active plasmin. Plasmin degrades fibrin clots as well as fibrinogen and other plasma proteins. This in turn leads to the degradation of blood clots.
TargetKindPharmacological actionActionsOrganismUniProt ID
PlasminogenProteinyes
activator
HumanP00747 details
Proteinase-activated receptor 1Proteinunknown
cleavage
HumanP25116 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Streptokinase Action PathwayDrug actionSMP00282
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AbciximabStreptokinase may increase the anticoagulant activities of Abciximab.Approved
AcebutololThe risk or severity of adverse effects can be increased when Acebutolol is combined with Streptokinase.Approved
AcenocoumarolStreptokinase may increase the anticoagulant activities of Acenocoumarol.Approved
AcetazolamideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Acetazolamide.Approved, Vet Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Acetylsalicylic acid is combined with Streptokinase.Approved, Vet Approved
AldesleukinThe risk or severity of adverse effects can be increased when Aldesleukin is combined with Streptokinase.Approved
AliskirenThe risk or severity of adverse effects can be increased when Aliskiren is combined with Streptokinase.Approved, Investigational
AlprostadilAlprostadil may increase the anticoagulant activities of Streptokinase.Approved, Investigational
AmifostineThe risk or severity of adverse effects can be increased when Amifostine is combined with Streptokinase.Approved, Investigational
AmilorideThe risk or severity of adverse effects can be increased when Amiloride is combined with Streptokinase.Approved
Aminosalicylic AcidThe risk or severity of adverse effects can be increased when Aminosalicylic Acid is combined with Streptokinase.Approved
AmiodaroneThe risk or severity of adverse effects can be increased when Amiodarone is combined with Streptokinase.Approved, Investigational
AmlodipineThe risk or severity of adverse effects can be increased when Amlodipine is combined with Streptokinase.Approved
AmobarbitalAmobarbital may increase the hypotensive activities of Streptokinase.Approved, Illicit
Amphotericin BThe risk or severity of adverse effects can be increased when Amphotericin B is combined with Streptokinase.Approved, Investigational
Amyl NitriteThe risk or severity of adverse effects can be increased when Amyl Nitrite is combined with Streptokinase.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Streptokinase.Approved
AncrodStreptokinase may increase the anticoagulant activities of Ancrod.Investigational
Antithrombin III humanStreptokinase may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanStreptokinase may increase the anticoagulant activities of Apixaban.Approved
ApomorphineThe risk or severity of adverse effects can be increased when Apomorphine is combined with Streptokinase.Approved, Investigational
ApraclonidineThe risk or severity of adverse effects can be increased when Apraclonidine is combined with Streptokinase.Approved
AprotininThe therapeutic efficacy of Streptokinase can be decreased when used in combination with Aprotinin.Approved, Withdrawn
ArdeparinStreptokinase may increase the anticoagulant activities of Ardeparin.Approved, Withdrawn
ArgatrobanStreptokinase may increase the anticoagulant activities of Argatroban.Approved, Investigational
AripiprazoleAripiprazole may increase the hypotensive activities of Streptokinase.Approved, Investigational
ArotinololThe risk or severity of adverse effects can be increased when Arotinolol is combined with Streptokinase.Approved
Arsenic trioxideThe risk or severity of adverse effects can be increased when Arsenic trioxide is combined with Streptokinase.Approved, Investigational
AtenololThe risk or severity of adverse effects can be increased when Atenolol is combined with Streptokinase.Approved
AzelastineAzelastine may increase the anticoagulant activities of Streptokinase.Approved
Azilsartan medoxomilThe risk or severity of adverse effects can be increased when Azilsartan medoxomil is combined with Streptokinase.Approved
BalsalazideThe risk or severity of adverse effects can be increased when Balsalazide is combined with Streptokinase.Approved, Investigational
BarbexacloneBarbexaclone may increase the hypotensive activities of Streptokinase.Experimental
BarbitalBarbital may increase the hypotensive activities of Streptokinase.Illicit
BarnidipineThe risk or severity of adverse effects can be increased when Barnidipine is combined with Streptokinase.Approved
BecaplerminStreptokinase may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BenazeprilThe risk or severity of adverse effects can be increased when Benazepril is combined with Streptokinase.Approved, Investigational
BendroflumethiazideThe risk or severity of adverse effects can be increased when Bendroflumethiazide is combined with Streptokinase.Approved
BepridilThe risk or severity of adverse effects can be increased when Bepridil is combined with Streptokinase.Approved, Withdrawn
BeraprostBeraprost may increase the anticoagulant activities of Streptokinase.Investigational
BetaxololThe risk or severity of adverse effects can be increased when Betaxolol is combined with Streptokinase.Approved
BisoprololThe risk or severity of adverse effects can be increased when Bisoprolol is combined with Streptokinase.Approved
BivalirudinStreptokinase may increase the anticoagulant activities of Bivalirudin.Approved, Investigational
BortezomibThe risk or severity of adverse effects can be increased when Bortezomib is combined with Streptokinase.Approved, Investigational
BretyliumThe risk or severity of adverse effects can be increased when Bretylium is combined with Streptokinase.Approved
BrimonidineThe risk or severity of adverse effects can be increased when Brimonidine is combined with Streptokinase.Approved
BromocriptineThe risk or severity of adverse effects can be increased when Bromocriptine is combined with Streptokinase.Approved, Investigational
BumetanideThe risk or severity of adverse effects can be increased when Bumetanide is combined with Streptokinase.Approved
BupivacaineThe risk or severity of adverse effects can be increased when Bupivacaine is combined with Streptokinase.Approved, Investigational
ButylphthalideButylphthalide may increase the anticoagulant activities of Streptokinase.Investigational
CanagliflozinThe risk or severity of adverse effects can be increased when Canagliflozin is combined with Streptokinase.Approved
CandesartanThe risk or severity of adverse effects can be increased when Candesartan is combined with Streptokinase.Approved
CangrelorCangrelor may increase the anticoagulant activities of Streptokinase.Approved
CaptoprilThe risk or severity of adverse effects can be increased when Captopril is combined with Streptokinase.Approved
CarbetocinThe risk or severity of adverse effects can be increased when Carbetocin is combined with Streptokinase.Approved
CarteololThe risk or severity of adverse effects can be increased when Carteolol is combined with Streptokinase.Approved
CarvedilolThe risk or severity of adverse effects can be increased when Carvedilol is combined with Streptokinase.Approved, Investigational
CertoparinStreptokinase may increase the anticoagulant activities of Certoparin.Approved
ChlorothiazideThe risk or severity of adverse effects can be increased when Chlorothiazide is combined with Streptokinase.Approved, Vet Approved
ChlorpromazineThe risk or severity of adverse effects can be increased when Chlorpromazine is combined with Streptokinase.Approved, Vet Approved
ChlorthalidoneThe risk or severity of adverse effects can be increased when Chlorthalidone is combined with Streptokinase.Approved
CilazaprilThe risk or severity of adverse effects can be increased when Cilazapril is combined with Streptokinase.Approved
CilnidipineThe risk or severity of adverse effects can be increased when Cilnidipine is combined with Streptokinase.Approved
CilostazolCilostazol may increase the anticoagulant activities of Streptokinase.Approved
Citric AcidStreptokinase may increase the anticoagulant activities of Citric Acid.Nutraceutical, Vet Approved
ClevidipineThe risk or severity of adverse effects can be increased when Clevidipine is combined with Streptokinase.Approved
ClofarabineThe risk or severity of adverse effects can be increased when Clofarabine is combined with Streptokinase.Approved, Investigational
ClomipramineThe risk or severity of adverse effects can be increased when Clomipramine is combined with Streptokinase.Approved, Vet Approved
ClonidineThe risk or severity of adverse effects can be increased when Clonidine is combined with Streptokinase.Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Streptokinase.Approved, Nutraceutical
ClozapineThe risk or severity of adverse effects can be increased when Clozapine is combined with Streptokinase.Approved
ConivaptanThe risk or severity of adverse effects can be increased when Conivaptan is combined with Streptokinase.Approved, Investigational
Dabigatran etexilateStreptokinase may increase the anticoagulant activities of Dabigatran etexilate.Approved
DalteparinStreptokinase may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidStreptokinase may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DapagliflozinThe risk or severity of adverse effects can be increased when Dapagliflozin is combined with Streptokinase.Approved
DefibrotideDefibrotide may increase the anticoagulant activities of Streptokinase.Approved, Investigational
dersalazineThe risk or severity of adverse effects can be increased when dersalazine is combined with Streptokinase.Investigational
DesfluraneThe risk or severity of adverse effects can be increased when Desflurane is combined with Streptokinase.Approved
DesirudinStreptokinase may increase the anticoagulant activities of Desirudin.Approved
DexmedetomidineThe risk or severity of adverse effects can be increased when Dexmedetomidine is combined with Streptokinase.Approved, Vet Approved
DextranStreptokinase may increase the anticoagulant activities of Dextran.Approved, Vet Approved
Dextran 40Streptokinase may increase the anticoagulant activities of Dextran 40.Approved
Dextran 70Streptokinase may increase the anticoagulant activities of Dextran 70.Approved
Dextran 75Streptokinase may increase the anticoagulant activities of Dextran 75.Approved
DiclofenamideThe risk or severity of adverse effects can be increased when Diclofenamide is combined with Streptokinase.Approved
DicoumarolStreptokinase may increase the anticoagulant activities of Dicoumarol.Approved
DiflunisalThe risk or severity of adverse effects can be increased when Diflunisal is combined with Streptokinase.Approved
DiltiazemThe risk or severity of adverse effects can be increased when Diltiazem is combined with Streptokinase.Approved
DinutuximabThe risk or severity of adverse effects can be increased when Dinutuximab is combined with Streptokinase.Approved
DipyridamoleThe risk or severity of adverse effects can be increased when Dipyridamole is combined with Streptokinase.Approved
DoxazosinThe risk or severity of adverse effects can be increased when Doxazosin is combined with Streptokinase.Approved
DuloxetineStreptokinase may increase the orthostatic hypotensive activities of Duloxetine.Approved
Edetic AcidStreptokinase may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanStreptokinase may increase the anticoagulant activities of Edoxaban.Approved
EfonidipineThe risk or severity of adverse effects can be increased when Efonidipine is combined with Streptokinase.Approved
EmpagliflozinThe risk or severity of adverse effects can be increased when Empagliflozin is combined with Streptokinase.Approved
EnalaprilThe risk or severity of adverse effects can be increased when Enalapril is combined with Streptokinase.Approved, Vet Approved
EnalaprilatThe risk or severity of adverse effects can be increased when Enalaprilat is combined with Streptokinase.Approved
EnoxaparinStreptokinase may increase the anticoagulant activities of Enoxaparin.Approved
EpinastineEpinastine may increase the anticoagulant activities of Streptokinase.Approved, Investigational
EplerenoneThe risk or severity of adverse effects can be increased when Eplerenone is combined with Streptokinase.Approved
eplivanserineeplivanserine may increase the anticoagulant activities of Streptokinase.Investigational
EpoprostenolThe risk or severity of adverse effects can be increased when Epoprostenol is combined with Streptokinase.Approved
EprosartanThe risk or severity of adverse effects can be increased when Eprosartan is combined with Streptokinase.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Streptokinase.Approved, Investigational
EsmololThe risk or severity of adverse effects can be increased when Esmolol is combined with Streptokinase.Approved
Etacrynic acidThe risk or severity of adverse effects can be increased when Etacrynic acid is combined with Streptokinase.Approved
Ethyl biscoumacetateStreptokinase may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
FelodipineThe risk or severity of adverse effects can be increased when Felodipine is combined with Streptokinase.Approved, Investigational
FenoldopamThe risk or severity of adverse effects can be increased when Fenoldopam is combined with Streptokinase.Approved
FimasartanThe risk or severity of adverse effects can be increased when Fimasartan is combined with Streptokinase.Approved
FluindioneStreptokinase may increase the anticoagulant activities of Fluindione.Investigational
FondaparinuxStreptokinase may increase the anticoagulant activities of Fondaparinux.Investigational
Fondaparinux sodiumStreptokinase may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
FosinoprilThe risk or severity of adverse effects can be increased when Fosinopril is combined with Streptokinase.Approved
FurosemideThe risk or severity of adverse effects can be increased when Furosemide is combined with Streptokinase.Approved, Vet Approved
GabexateStreptokinase may increase the anticoagulant activities of Gabexate.Investigational
GuanfacineThe risk or severity of adverse effects can be increased when Guanfacine is combined with Streptokinase.Approved, Investigational
HalothaneThe risk or severity of adverse effects can be increased when Halothane is combined with Streptokinase.Approved, Vet Approved
HeparinStreptokinase may increase the anticoagulant activities of Heparin.Approved, Investigational
HexobarbitalHexobarbital may increase the hypotensive activities of Streptokinase.Approved
HirulogStreptokinase may increase the anticoagulant activities of Hirulog.Experimental
HydralazineThe risk or severity of adverse effects can be increased when Hydralazine is combined with Streptokinase.Approved
HydrochlorothiazideThe risk or severity of adverse effects can be increased when Hydrochlorothiazide is combined with Streptokinase.Approved, Vet Approved
HydroflumethiazideThe risk or severity of adverse effects can be increased when Hydroflumethiazide is combined with Streptokinase.Approved
IbudilastIbudilast may increase the anticoagulant activities of Streptokinase.Approved, Investigational
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Streptokinase.Approved, Nutraceutical
idraparinuxStreptokinase may increase the anticoagulant activities of idraparinux.Investigational
IfenprodilIfenprodil may increase the anticoagulant activities of Streptokinase.Approved, Withdrawn
IloprostThe risk or severity of adverse effects can be increased when Iloprost is combined with Streptokinase.Approved, Investigational
ImidaprilThe risk or severity of adverse effects can be increased when Imidapril is combined with Streptokinase.Investigational
ImipramineThe risk or severity of adverse effects can be increased when Imipramine is combined with Streptokinase.Approved
IndapamideThe risk or severity of adverse effects can be increased when Indapamide is combined with Streptokinase.Approved
IndoraminThe risk or severity of adverse effects can be increased when Indoramin is combined with Streptokinase.Withdrawn
IrbesartanThe risk or severity of adverse effects can be increased when Irbesartan is combined with Streptokinase.Approved, Investigational
IsocarboxazidThe risk or severity of adverse effects can be increased when Isocarboxazid is combined with Streptokinase.Approved
IsofluraneThe risk or severity of adverse effects can be increased when Isoflurane is combined with Streptokinase.Approved, Vet Approved
Isosorbide DinitrateThe risk or severity of adverse effects can be increased when Isosorbide Dinitrate is combined with Streptokinase.Approved
Isosorbide MononitrateThe risk or severity of adverse effects can be increased when Isosorbide Mononitrate is combined with Streptokinase.Approved
IsoxsuprineThe risk or severity of adverse effects can be increased when Isoxsuprine is combined with Streptokinase.Approved, Withdrawn
IsradipineThe risk or severity of adverse effects can be increased when Isradipine is combined with Streptokinase.Approved
KetanserinKetanserin may increase the anticoagulant activities of Streptokinase.Investigational
LabetalolThe risk or severity of adverse effects can be increased when Labetalol is combined with Streptokinase.Approved
LacidipineThe risk or severity of adverse effects can be increased when Lacidipine is combined with Streptokinase.Approved
LepirudinStreptokinase may increase the anticoagulant activities of Lepirudin.Approved
LercanidipineThe risk or severity of adverse effects can be increased when Lercanidipine is combined with Streptokinase.Approved, Investigational
LevobunololThe risk or severity of adverse effects can be increased when Levobunolol is combined with Streptokinase.Approved
LevobupivacaineThe risk or severity of adverse effects can be increased when Levobupivacaine is combined with Streptokinase.Approved
LevodopaStreptokinase may increase the orthostatic hypotensive activities of Levodopa.Approved
LevosimendanThe risk or severity of adverse effects can be increased when Levosimendan is combined with Streptokinase.Approved, Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Streptokinase.Approved
LisinoprilThe risk or severity of adverse effects can be increased when Lisinopril is combined with Streptokinase.Approved, Investigational
LofexidineThe risk or severity of adverse effects can be increased when Lofexidine is combined with Streptokinase.Approved, Investigational
LosartanThe risk or severity of adverse effects can be increased when Losartan is combined with Streptokinase.Approved
MannitolThe risk or severity of adverse effects can be increased when Mannitol is combined with Streptokinase.Approved, Investigational
MecamylamineThe risk or severity of adverse effects can be increased when Mecamylamine is combined with Streptokinase.Approved
MesalazineThe risk or severity of adverse effects can be increased when Mesalazine is combined with Streptokinase.Approved
MethazolamideThe risk or severity of adverse effects can be increased when Methazolamide is combined with Streptokinase.Approved
MethohexitalMethohexital may increase the hypotensive activities of Streptokinase.Approved
MethyclothiazideThe risk or severity of adverse effects can be increased when Methyclothiazide is combined with Streptokinase.Approved
MethyldopaThe risk or severity of adverse effects can be increased when Methyldopa is combined with Streptokinase.Approved
MethylphenobarbitalMethylphenobarbital may increase the hypotensive activities of Streptokinase.Approved
MetipranololThe risk or severity of adverse effects can be increased when Metipranolol is combined with Streptokinase.Approved
MetolazoneThe risk or severity of adverse effects can be increased when Metolazone is combined with Streptokinase.Approved
MetoprololThe risk or severity of adverse effects can be increased when Metoprolol is combined with Streptokinase.Approved, Investigational
MilrinoneMilrinone may increase the anticoagulant activities of Streptokinase.Approved
MinoxidilThe risk or severity of adverse effects can be increased when Minoxidil is combined with Streptokinase.Approved
MoexiprilThe risk or severity of adverse effects can be increased when Moexipril is combined with Streptokinase.Approved
MorphineThe risk or severity of adverse effects can be increased when Morphine is combined with Streptokinase.Approved, Investigational
MoxonidineThe risk or severity of adverse effects can be increased when Moxonidine is combined with Streptokinase.Approved
NabiloneThe risk or severity of adverse effects can be increased when Nabilone is combined with Streptokinase.Approved, Investigational
NadololThe risk or severity of adverse effects can be increased when Nadolol is combined with Streptokinase.Approved
NadroparinStreptokinase may increase the anticoagulant activities of Nadroparin.Approved
NafamostatStreptokinase may increase the anticoagulant activities of Nafamostat.Investigational
NaftopidilNaftopidil may increase the anticoagulant activities of Streptokinase.Investigational
NCX 4016The risk or severity of adverse effects can be increased when NCX 4016 is combined with Streptokinase.Investigational
NebivololThe risk or severity of adverse effects can be increased when Nebivolol is combined with Streptokinase.Approved, Investigational
NesiritideThe risk or severity of adverse effects can be increased when Nesiritide is combined with Streptokinase.Approved, Investigational
NicardipineThe risk or severity of adverse effects can be increased when Nicardipine is combined with Streptokinase.Approved
NicorandilNicorandil may increase the hypotensive activities of Streptokinase.Approved
NifedipineThe risk or severity of adverse effects can be increased when Nifedipine is combined with Streptokinase.Approved
NilvadipineThe risk or severity of adverse effects can be increased when Nilvadipine is combined with Streptokinase.Approved
NimesulideNimesulide may increase the anticoagulant activities of Streptokinase.Approved, Withdrawn
NimodipineThe risk or severity of adverse effects can be increased when Nimodipine is combined with Streptokinase.Approved
NisoldipineThe risk or severity of adverse effects can be increased when Nisoldipine is combined with Streptokinase.Approved
NitrendipineThe risk or severity of adverse effects can be increased when Nitrendipine is combined with Streptokinase.Approved
Nitric OxideThe risk or severity of adverse effects can be increased when Nitric Oxide is combined with Streptokinase.Approved
NitroaspirinThe risk or severity of adverse effects can be increased when Nitroaspirin is combined with Streptokinase.Investigational
NitroglycerinThe risk or severity of adverse effects can be increased when Nitroglycerin is combined with Streptokinase.Approved, Investigational
NitroprussideThe risk or severity of adverse effects can be increased when Nitroprusside is combined with Streptokinase.Approved
ObinutuzumabThe risk or severity of adverse effects can be increased when Obinutuzumab is combined with Streptokinase.Approved
OlmesartanThe risk or severity of adverse effects can be increased when Olmesartan is combined with Streptokinase.Approved, Investigational
OlsalazineThe risk or severity of adverse effects can be increased when Olsalazine is combined with Streptokinase.Approved
OtamixabanStreptokinase may increase the anticoagulant activities of Otamixaban.Investigational
OxprenololThe risk or severity of adverse effects can be increased when Oxprenolol is combined with Streptokinase.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Streptokinase.Approved, Vet Approved
PapaverineThe risk or severity of adverse effects can be increased when Papaverine is combined with Streptokinase.Approved
PenbutololThe risk or severity of adverse effects can be increased when Penbutolol is combined with Streptokinase.Approved, Investigational
PentobarbitalPentobarbital may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
Pentosan PolysulfateStreptokinase may increase the anticoagulant activities of Pentosan Polysulfate.Approved
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Streptokinase.Approved, Investigational
PerindoprilThe risk or severity of adverse effects can be increased when Perindopril is combined with Streptokinase.Approved
PhenelzineThe risk or severity of adverse effects can be increased when Phenelzine is combined with Streptokinase.Approved
PhenindioneStreptokinase may increase the anticoagulant activities of Phenindione.Approved
PhenobarbitalPhenobarbital may increase the hypotensive activities of Streptokinase.Approved
PhenoxybenzamineThe risk or severity of adverse effects can be increased when Phenoxybenzamine is combined with Streptokinase.Approved
PhenprocoumonStreptokinase may increase the anticoagulant activities of Phenprocoumon.Approved
PhentolamineThe risk or severity of adverse effects can be increased when Phentolamine is combined with Streptokinase.Approved
PindololThe risk or severity of adverse effects can be increased when Pindolol is combined with Streptokinase.Approved
PipamperoneThe risk or severity of adverse effects can be increased when Pipamperone is combined with Streptokinase.Approved
PramipexoleThe risk or severity of adverse effects can be increased when Pramipexole is combined with Streptokinase.Approved, Investigational
PrasugrelPrasugrel may increase the anticoagulant activities of Streptokinase.Approved
PrazosinThe risk or severity of adverse effects can be increased when Prazosin is combined with Streptokinase.Approved
PrimidonePrimidone may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
PropofolThe risk or severity of adverse effects can be increased when Propofol is combined with Streptokinase.Approved, Investigational, Vet Approved
PropranololThe risk or severity of adverse effects can be increased when Propranolol is combined with Streptokinase.Approved, Investigational
Protein CStreptokinase may increase the anticoagulant activities of Protein C.Approved
Protein S humanStreptokinase may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeStreptokinase may increase the anticoagulant activities of Protocatechualdehyde.Approved
QuetiapineThe risk or severity of adverse effects can be increased when Quetiapine is combined with Streptokinase.Approved
QuinaprilThe risk or severity of adverse effects can be increased when Quinapril is combined with Streptokinase.Approved, Investigational
RamatrobanRamatroban may increase the anticoagulant activities of Streptokinase.Investigational
RamiprilThe risk or severity of adverse effects can be increased when Ramipril is combined with Streptokinase.Approved
RasagilineThe risk or severity of adverse effects can be increased when Rasagiline is combined with Streptokinase.Approved
RemifentanilThe risk or severity of adverse effects can be increased when Remifentanil is combined with Streptokinase.Approved
ReserpineThe risk or severity of adverse effects can be increased when Reserpine is combined with Streptokinase.Approved
ResveratrolResveratrol may increase the anticoagulant activities of Streptokinase.Experimental, Investigational
ReviparinStreptokinase may increase the anticoagulant activities of Reviparin.Approved
RidogrelRidogrel may increase the anticoagulant activities of Streptokinase.Approved
RiociguatThe risk or severity of adverse effects can be increased when Riociguat is combined with Streptokinase.Approved
RisperidoneStreptokinase may increase the hypotensive activities of Risperidone.Approved, Investigational
RivaroxabanStreptokinase may increase the anticoagulant activities of Rivaroxaban.Approved
RopiniroleThe risk or severity of adverse effects can be increased when Ropinirole is combined with Streptokinase.Approved, Investigational
RopivacaineThe risk or severity of adverse effects can be increased when Ropivacaine is combined with Streptokinase.Approved
RotigotineThe risk or severity of adverse effects can be increased when Rotigotine is combined with Streptokinase.Approved
SacubitrilThe risk or severity of adverse effects can be increased when Sacubitril is combined with Streptokinase.Approved
Salicylic acidThe risk or severity of adverse effects can be increased when Salicylic acid is combined with Streptokinase.Approved, Vet Approved
SCH-530348SCH-530348 may increase the anticoagulant activities of Streptokinase.Investigational
SecobarbitalSecobarbital may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
SelegilineThe risk or severity of adverse effects can be increased when Selegiline is combined with Streptokinase.Approved, Investigational, Vet Approved
SevofluraneThe risk or severity of adverse effects can be increased when Sevoflurane is combined with Streptokinase.Approved, Vet Approved
Sodium NitriteThe risk or severity of adverse effects can be increased when Sodium Nitrite is combined with Streptokinase.Approved
SotalolThe risk or severity of adverse effects can be increased when Sotalol is combined with Streptokinase.Approved
SpironolactoneThe risk or severity of adverse effects can be increased when Spironolactone is combined with Streptokinase.Approved
SRT501SRT501 may increase the anticoagulant activities of Streptokinase.Investigational
SufentanilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Sufentanil.Approved, Investigational
SulodexideStreptokinase may increase the anticoagulant activities of Sulodexide.Approved, Investigational
TamsulosinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tamsulosin.Approved, Investigational
TelmisartanThe risk or severity of adverse effects can be increased when Telmisartan is combined with Streptokinase.Approved, Investigational
TerazosinThe risk or severity of adverse effects can be increased when Terazosin is combined with Streptokinase.Approved
TesmilifeneTesmilifene may increase the anticoagulant activities of Streptokinase.Investigational
ThalidomideThe risk or severity of adverse effects can be increased when Streptokinase is combined with Thalidomide.Approved, Investigational, Withdrawn
ThiamylalThiamylal may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
ThiopentalThiopental may increase the hypotensive activities of Streptokinase.Approved, Vet Approved
ThioridazineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Thioridazine.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Streptokinase.Approved
TimololThe risk or severity of adverse effects can be increased when Timolol is combined with Streptokinase.Approved
TirofibanTirofiban may increase the anticoagulant activities of Streptokinase.Approved
TizanidineThe risk or severity of adverse effects can be increased when Tizanidine is combined with Streptokinase.Approved
TolazolineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tolazoline.Approved, Vet Approved
TolcaponeThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tolcapone.Approved, Withdrawn
TorasemideThe risk or severity of adverse effects can be increased when Torasemide is combined with Streptokinase.Approved
TrandolaprilThe risk or severity of adverse effects can be increased when Trandolapril is combined with Streptokinase.Approved
TranilastTranilast may increase the anticoagulant activities of Streptokinase.Approved, Investigational
TranylcypromineThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tranylcypromine.Approved
TrapidilTrapidil may increase the anticoagulant activities of Streptokinase.Approved
TreprostinilThe risk or severity of adverse effects can be increased when Streptokinase is combined with Treprostinil.Approved, Investigational
TretinoinThe risk or severity of adverse effects can be increased when Streptokinase is combined with Tretinoin.Approved, Investigational, Nutraceutical
TriamtereneThe risk or severity of adverse effects can be increased when Triamterene is combined with Streptokinase.Approved
TriflusalTriflusal may increase the anticoagulant activities of Streptokinase.Approved
ValsartanThe risk or severity of adverse effects can be increased when Valsartan is combined with Streptokinase.Approved, Investigational
VerapamilThe risk or severity of adverse effects can be increased when Verapamil is combined with Streptokinase.Approved
VorapaxarVorapaxar may increase the anticoagulant activities of Streptokinase.Approved
WarfarinStreptokinase may increase the anticoagulant activities of Warfarin.Approved
XimelagatranStreptokinase may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
Ym150Streptokinase may increase the anticoagulant activities of Ym150.Investigational
Food InteractionsNot Available
References
Synthesis Reference

Lawrence Isaac Galler, “Streptokinase derivatives with high affinity for activated platelets and methods of their production and use in thrombolytic therapy.” U.S. Patent US6087332, issued July, 1997.

US6087332
General ReferencesNot Available
External Links
ATC CodesB01AD01B06AA55
AHFS Codes
  • 20:12.20
PDB Entries
FDA labelNot Available
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Powder, for solutionIntracoronary; Intravenous1500000 unit
Powder, for solutionIntracoronary; Intravenous250000 unit
Powder, for solutionIntracoronary; Intravenous750000 unit
Powder, for solutionIntravenous1500000 unit
Powder, for solutionIntravenous250000 unit
Powder, for solutionIntravenous750000 unit
PricesNot Available
PatentsNot Available
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.728Not Available
isoelectric point5.12Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
activator
General Function:
Serine-type peptidase activity
Specific Function:
Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin ...
Gene Name:
PLG
Uniprot ID:
P00747
Molecular Weight:
90568.415 Da
References
  1. Caballero AR, Lottenberg R, Johnston KH: Cloning, expression, sequence analysis, and characterization of streptokinases secreted by porcine and equine isolates of Streptococcus equisimilis. Infect Immun. 1999 Dec;67(12):6478-86. [PubMed:10569766 ]
  2. Alessi MC, Juhan-Vague I: [Thrombolytics and their use]. Rev Prat. 1999 Oct 1;49(15):1654-8. [PubMed:10581996 ]
  3. Chaudhary A, Vasudha S, Rajagopal K, Komath SS, Garg N, Yadav M, Mande SC, Sahni G: Function of the central domain of streptokinase in substrate plasminogen docking and processing revealed by site-directed mutagenesis. Protein Sci. 1999 Dec;8(12):2791-805. [PubMed:10631997 ]
  4. Parry MA, Zhang XC, Bode I: Molecular mechanisms of plasminogen activation: bacterial cofactors provide clues. Trends Biochem Sci. 2000 Feb;25(2):53-9. [PubMed:10664583 ]
  5. Korol'chuk VI, Makohonenko IeM, Sederkhol'm-Vil'iams SA: [Plasminogen binding with decapeptide and polypeptide fragments of streptokinase]. Ukr Biokhim Zh (1999). 1999 Sep-Oct;71(5):51-8. [PubMed:10726310 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
cleavage
General Function:
Thrombin receptor activity
Specific Function:
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
Gene Name:
F2R
Uniprot ID:
P25116
Molecular Weight:
47439.83 Da
References
  1. McRedmond JP, Harriott P, Walker B, Fitzgerald DJ: Streptokinase-induced platelet activation involves antistreptokinase antibodies and cleavage of protease-activated receptor-1. Blood. 2000 Feb 15;95(4):1301-8. [PubMed:10666203 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inducer
General Function:
Phospholipase a2 activity
Specific Function:
Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response.
Gene Name:
PLA2G4A
Uniprot ID:
P47712
Molecular Weight:
85238.2 Da
References
  1. Kawaguchi H, Iizuka K, Sano H, Yasuda H: Effect of streptokinase on prostacyclin synthesis and phospholipase activity in cultured pulmonary artery endothelial cells. Biochim Biophys Acta. 1990 Dec 10;1055(3):223-9. [PubMed:2265209 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23