Becaplermin

Identification

Name
Becaplermin
Accession Number
DB00102  (BTD00053, BIOD00053)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

Becaplermin is produced by recombinant DNA technology by insertion of the gene for the B chain of platelet derived growth factor (PDGF) into the yeast, Saccharomyces cerevisiae. Becaplermin has a molecular weight of approximately 25 KD and is a homodimer composed of two identical polypeptide chains that are bound together by disulfide bonds.

Protein structure
Db00102
Protein chemical formula
C532H892N162O153S9
Protein average weight
12294.4 Da
Sequences
>DB00102 sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQC
RPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Download FASTA Format
Synonyms
  • c-sis
  • PDGF B-chain
  • PDGF-2
  • PDGF-BB
  • PDGFB
  • Platelet-derived growth factor B chain precursor
  • Platelet-derived growth factor beta polypeptide
  • SH-POLYPEPTIDE-59
External IDs
RWJ-60235
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
RegranexGel100 ug/gTopicalHealthpoint2011-11-012016-01-31Us
RegranexGel100 ug/gTopicalSmith & Nephew, Inc.2011-11-01Not applicableUs
Regranex (becaplermin) 0.01%Gel100 mcgTopicalJanssen Pharmaceuticals1999-02-012011-07-27Canada
Unapproved/Other Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
RegranexBecaplermin (0.01 %)GelCutaneousJanssen Cilag International Nv1999-03-292012-08-15Eu
Categories
UNII
1B56C968OA
CAS number
165101-51-9

Pharmacology

Indication

For topical treatment of skin ulcers (from diabetes)

Associated Conditions
Pharmacodynamics

Used for the topical treatment of skin ulcers, Regranex has a biological activity similar to that of endogenous platelet-derived growth factor, which includes promoting the chemotactic recruitment and proliferation of cells involved in wound repair and enhancing the formation of granulation tissue.

Mechanism of action

Binds to the beta platelet-derived growth factor (PDGF) receptor, a tyrosine kinase receptor. PDGF is known to exist as a dimer, and activates its signaling pathway by a ligand induced receptor dimerization and autophosphorylation. PDGF receptors also contain many auto-phosphorylation sites, which serve to mediate binding of SH2 sites and subsequently signal corresponding pathways. There are five different isoforms of PDGF that activate through two different receptors (alpha and beta).

TargetActionsOrganism
APlatelet-derived growth factor receptor betaNot AvailableHuman
UPlatelet-derived growth factor receptor alphaNot AvailableHuman
UAlpha-2-macroglobulinNot AvailableHuman
Absorption

very little systemic absorption. 15% of patients experienced complete healing within 8 weeks, while for 25% of patients, it was at 10 weeks.

Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
(4R)-limonene(4R)-limonene may increase the anticoagulant activities of Becaplermin.Investigational
AbciximabAbciximab may increase the anticoagulant activities of Becaplermin.Approved
AceclofenacAceclofenac may increase the anticoagulant activities of Becaplermin.Approved, Investigational
AcemetacinThe risk or severity of bleeding can be increased when Becaplermin is combined with Acemetacin.Approved, Experimental, Investigational
AcenocoumarolBecaplermin may increase the anticoagulant activities of Acenocoumarol.Approved, Investigational
Acetylsalicylic acidAcetylsalicylic acid may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
AdapaleneAdapalene may increase the anticoagulant activities of Becaplermin.Approved
AlclofenacAlclofenac may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
AllylestrenolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Allylestrenol.Approved
AlminoprofenAlminoprofen may increase the anticoagulant activities of Becaplermin.Experimental
AloxiprinAloxiprin may increase the anticoagulant activities of Becaplermin.Experimental
AlprostadilAlprostadil may increase the anticoagulant activities of Becaplermin.Approved, Investigational
AlteplaseAlteplase may increase the anticoagulant activities of Becaplermin.Approved
AltrenogestThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Altrenogest.Vet Approved
Aminosalicylic AcidAminosalicylic Acid may increase the anticoagulant activities of Becaplermin.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Becaplermin.Approved
AncrodBecaplermin may increase the anticoagulant activities of Ancrod.Approved, Investigational
AndrographolideAndrographolide may increase the anticoagulant activities of Becaplermin.Investigational
AnisodamineAnisodamine may increase the anticoagulant activities of Becaplermin.Investigational
AnistreplaseAnistreplase may increase the anticoagulant activities of Becaplermin.Approved
AntipyrineAntipyrine may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Antithrombin III humanBecaplermin may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanApixaban may increase the anticoagulant activities of Becaplermin.Approved
ApocyninApocynin may increase the anticoagulant activities of Becaplermin.Investigational
ApremilastApremilast may increase the anticoagulant activities of Becaplermin.Approved, Investigational
ArdeparinBecaplermin may increase the anticoagulant activities of Ardeparin.Approved, Investigational, Withdrawn
ArgatrobanBecaplermin may increase the anticoagulant activities of Argatroban.Approved, Investigational
AstaxanthinAstaxanthin may increase the anticoagulant activities of Becaplermin.Investigational
AzapropazoneAzapropazone may increase the anticoagulant activities of Becaplermin.Withdrawn
AzelastineAzelastine may increase the anticoagulant activities of Becaplermin.Approved
Azficel-TThe risk or severity of adverse effects can be increased when Becaplermin is combined with Azficel-T.Approved, Investigational
BalsalazideBalsalazide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BatroxobinBatroxobin may increase the anticoagulant activities of Becaplermin.Experimental
BazedoxifeneBazedoxifene may decrease the anticoagulant activities of Becaplermin.Approved, Investigational
BemiparinBemiparin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BendazacBendazac may increase the anticoagulant activities of Becaplermin.Experimental
BenorilateBenorilate may increase the anticoagulant activities of Becaplermin.Experimental
BenoxaprofenBenoxaprofen may increase the anticoagulant activities of Becaplermin.Withdrawn
BenzydamineBenzydamine may increase the anticoagulant activities of Becaplermin.Approved
BeraprostBeraprost may increase the anticoagulant activities of Becaplermin.Investigational
BevoniumBevonium may increase the anticoagulant activities of Becaplermin.Experimental
BivalirudinBivalirudin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BrinaseBrinase may increase the anticoagulant activities of Becaplermin.Experimental
BromfenacBromfenac may increase the anticoagulant activities of Becaplermin.Approved
BucillamineBucillamine may increase the anticoagulant activities of Becaplermin.Investigational
BufexamacBufexamac may increase the anticoagulant activities of Becaplermin.Approved, Experimental
BuflomedilBuflomedil may increase the anticoagulant activities of Becaplermin.Experimental
BumadizoneBumadizone may increase the anticoagulant activities of Becaplermin.Experimental
ButylphthalideButylphthalide may increase the anticoagulant activities of Becaplermin.Investigational
CangrelorCangrelor may increase the anticoagulant activities of Becaplermin.Approved
CaplacizumabCaplacizumab may increase the anticoagulant activities of Becaplermin.Investigational
Carbaspirin calciumCarbaspirin calcium may increase the anticoagulant activities of Becaplermin.Experimental, Investigational
CarprofenCarprofen may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved, Withdrawn
CastanospermineCastanospermine may increase the anticoagulant activities of Becaplermin.Experimental
CelecoxibCelecoxib may increase the anticoagulant activities of Becaplermin.Approved, Investigational
CertoparinBecaplermin may increase the anticoagulant activities of Certoparin.Approved, Investigational
ChlormadinoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Chlormadinone.Experimental
ChloroquineChloroquine may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Becaplermin.Investigational, Withdrawn
Choline magnesium trisalicylateCholine magnesium trisalicylate may increase the anticoagulant activities of Becaplermin.Approved
CilostazolCilostazol may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Citric AcidBecaplermin may increase the anticoagulant activities of Citric Acid.Approved, Nutraceutical, Vet Approved
ClonixinClonixin may increase the anticoagulant activities of Becaplermin.Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Becaplermin.Approved
CloricromenCloricromen may increase the anticoagulant activities of Becaplermin.Experimental
ClorindioneClorindione may increase the anticoagulant activities of Becaplermin.Experimental
Collagenase clostridium histolyticumThe risk or severity of adverse effects can be increased when Becaplermin is combined with Collagenase clostridium histolyticum.Approved, Investigational
Conjugated estrogensConjugated estrogens may decrease the anticoagulant activities of Becaplermin.Approved
CurcuminCurcumin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Dabigatran etexilateDabigatran etexilate may increase the anticoagulant activities of Becaplermin.Approved
DaidzeinDaidzein may decrease the anticoagulant activities of Becaplermin.Experimental
DalteparinBecaplermin may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidBecaplermin may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DarexabanBecaplermin may increase the anticoagulant activities of Darexaban.Investigational
DasatinibDasatinib may increase the anticoagulant activities of Becaplermin.Approved, Investigational
DeferasiroxThe risk or severity of adverse effects can be increased when Becaplermin is combined with Deferasirox.Approved, Investigational
DefibrotideDefibrotide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
DemegestoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Demegestone.Approved
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Becaplermin is combined with Deoxycholic Acid.Approved
DersalazineDersalazine may increase the anticoagulant activities of Becaplermin.Investigational
DesirudinBecaplermin may increase the anticoagulant activities of Desirudin.Approved
DesmoteplaseDesmoteplase may increase the anticoagulant activities of Becaplermin.Investigational
DesogestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Desogestrel.Approved
DextranBecaplermin may increase the anticoagulant activities of Dextran.Approved, Investigational, Vet Approved
DiclofenacDiclofenac may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
DicoumarolBecaplermin may increase the anticoagulant activities of Dicoumarol.Approved
DienestrolDienestrol may decrease the anticoagulant activities of Becaplermin.Approved, Investigational
DienogestThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Dienogest.Approved
DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Becaplermin.Approved, Investigational
DifenpiramideDifenpiramide may increase the anticoagulant activities of Becaplermin.Experimental
DiflunisalDiflunisal may increase the anticoagulant activities of Becaplermin.Approved, Investigational
DiphenadioneDiphenadione may increase the anticoagulant activities of Becaplermin.Experimental
DipyridamoleDipyridamole may increase the anticoagulant activities of Becaplermin.Approved
DitazoleDitazole may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
DrospirenoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Drospirenone.Approved
Drotrecogin alfaDrotrecogin alfa may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
DroxicamDroxicam may increase the anticoagulant activities of Becaplermin.Withdrawn
DuvelisibDuvelisib may increase the anticoagulant activities of Becaplermin.Investigational
DydrogesteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Dydrogesterone.Approved, Investigational, Withdrawn
E-6201E-6201 may increase the anticoagulant activities of Becaplermin.Investigational
Edetic AcidBecaplermin may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanEdoxaban may increase the anticoagulant activities of Becaplermin.Approved
EnoxaparinBecaplermin may increase the anticoagulant activities of Enoxaparin.Approved
EpimestrolEpimestrol may decrease the anticoagulant activities of Becaplermin.Experimental
EpinastineEpinastine may increase the anticoagulant activities of Becaplermin.Approved, Investigational
EpirizoleEpirizole may increase the anticoagulant activities of Becaplermin.Approved
EplivanserinEplivanserin may increase the anticoagulant activities of Becaplermin.Investigational
eplivanserineeplivanserine may increase the anticoagulant activities of Becaplermin.Investigational
EpoprostenolEpoprostenol may increase the anticoagulant activities of Becaplermin.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
EquolEquol may decrease the anticoagulant activities of Becaplermin.Investigational
EstradiolEstradiol may decrease the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
Estradiol acetateEstradiol acetate may decrease the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
Estradiol cypionateEstradiol cypionate may decrease the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
Estradiol valerateEstradiol valerate may decrease the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
EstriolEstriol may decrease the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
Estrogens, esterifiedEstrogens, esterified may decrease the anticoagulant activities of Becaplermin.Approved
EstroneEstrone may decrease the anticoagulant activities of Becaplermin.Approved
EtanerceptEtanercept may increase the anticoagulant activities of Becaplermin.Approved, Investigational
EthenzamideEthenzamide may increase the anticoagulant activities of Becaplermin.Experimental
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Becaplermin.Approved
Ethyl biscoumacetateBecaplermin may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
EthynodiolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Ethynodiol.Experimental
EtodolacEtodolac may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
EtofenamateEtofenamate may increase the anticoagulant activities of Becaplermin.Approved, Investigational
EtonogestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoricoxibEtoricoxib may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Evening primrose oilEvening primrose oil may increase the anticoagulant activities of Becaplermin.Investigational, Nutraceutical
ExisulindExisulind may increase the anticoagulant activities of Becaplermin.Investigational
FelbinacFelbinac may increase the anticoagulant activities of Becaplermin.Experimental
FenbufenFenbufen may increase the anticoagulant activities of Becaplermin.Approved
FenoprofenFenoprofen may increase the anticoagulant activities of Becaplermin.Approved
FentiazacFentiazac may increase the anticoagulant activities of Becaplermin.Experimental
FeprazoneFeprazone may increase the anticoagulant activities of Becaplermin.Experimental
Ferulic acidFerulic acid may increase the anticoagulant activities of Becaplermin.Experimental
FibrinolysinFibrinolysin may increase the anticoagulant activities of Becaplermin.Investigational
FloctafenineFloctafenine may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
FluindioneBecaplermin may increase the anticoagulant activities of Fluindione.Approved, Investigational
FlunixinFlunixin may increase the anticoagulant activities of Becaplermin.Vet Approved
FlunoxaprofenFlunoxaprofen may increase the anticoagulant activities of Becaplermin.Experimental
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Becaplermin.Approved, Investigational
FondaparinuxBecaplermin may increase the anticoagulant activities of Fondaparinux.Approved, Investigational
Fondaparinux sodiumBecaplermin may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
GabexateBecaplermin may increase the anticoagulant activities of Gabexate.Investigational
GenisteinGenistein may decrease the anticoagulant activities of Becaplermin.Investigational
GestodeneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Gestodene.Approved, Investigational
GestonoroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Gestonorone.Experimental
GestrinoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Gestrinone.Approved
GuacetisalGuacetisal may increase the anticoagulant activities of Becaplermin.Experimental
HeminHemin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Hemoglobin crosfumarilHemoglobin crosfumaril may increase the anticoagulant activities of Becaplermin.Experimental
HeparinBecaplermin may increase the anticoagulant activities of Heparin.Approved, Investigational
HexestrolHexestrol may decrease the anticoagulant activities of Becaplermin.Withdrawn
HigenamineHigenamine may increase the anticoagulant activities of Becaplermin.Investigational
Hydroxyprogesterone caproateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Hydroxyprogesterone caproate.Approved, Investigational
HydroxytyrosolHydroxytyrosol may increase the anticoagulant activities of Becaplermin.Investigational
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Becaplermin is combined with Ibritumomab tiuxetan.Approved, Investigational
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Becaplermin.Approved
IbudilastIbudilast may increase the anticoagulant activities of Becaplermin.Approved, Investigational
IbuprofenIbuprofen may increase the anticoagulant activities of Becaplermin.Approved
IbuproxamIbuproxam may increase the anticoagulant activities of Becaplermin.Withdrawn
IcatibantIcatibant may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Nutraceutical
IdraparinuxBecaplermin may increase the anticoagulant activities of Idraparinux.Investigational
IfenprodilIfenprodil may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
IfetrobanIfetroban may increase the anticoagulant activities of Becaplermin.Investigational
IloprostIloprost may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Imidazole salicylateImidazole salicylate may increase the anticoagulant activities of Becaplermin.Experimental
IndobufenIndobufen may increase the anticoagulant activities of Becaplermin.Investigational
IndomethacinIndomethacin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
IndoprofenIndoprofen may increase the anticoagulant activities of Becaplermin.Withdrawn
IsoxicamIsoxicam may increase the anticoagulant activities of Becaplermin.Withdrawn
KebuzoneKebuzone may increase the anticoagulant activities of Becaplermin.Experimental
KetanserinKetanserin may increase the anticoagulant activities of Becaplermin.Investigational
KetoprofenKetoprofen may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
KetorolacKetorolac may increase the anticoagulant activities of Becaplermin.Approved
LeflunomideLeflunomide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
LepirudinBecaplermin may increase the anticoagulant activities of Lepirudin.Approved
LetaxabanBecaplermin may increase the anticoagulant activities of Letaxaban.Investigational
LevonorgestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Levonorgestrel.Approved, Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Becaplermin.Approved, Investigational
LinsidomineLinsidomine may increase the anticoagulant activities of Becaplermin.Experimental
LisofyllineLisofylline may increase the anticoagulant activities of Becaplermin.Investigational
LonazolacLonazolac may increase the anticoagulant activities of Becaplermin.Experimental
LornoxicamLornoxicam may increase the anticoagulant activities of Becaplermin.Approved, Investigational
LoxoprofenLoxoprofen may increase the anticoagulant activities of Becaplermin.Approved, Investigational
LumiracoxibLumiracoxib may increase the anticoagulant activities of Becaplermin.Approved, Investigational
LynestrenolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Lynestrenol.Approved, Investigational
Magnesium salicylateMagnesium salicylate may increase the anticoagulant activities of Becaplermin.Approved
MasoprocolMasoprocol may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Meclofenamic acidMeclofenamic acid may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
MedrogestoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Medrogestone.Approved
Medroxyprogesterone acetateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Becaplermin.Approved
Megestrol acetateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Megestrol acetate.Approved, Investigational, Vet Approved
MelagatranBecaplermin may increase the anticoagulant activities of Melagatran.Experimental
MeloxicamMeloxicam may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
MesalazineMesalazine may increase the anticoagulant activities of Becaplermin.Approved
MestranolMestranol may decrease the anticoagulant activities of Becaplermin.Approved
MetamizoleMetamizole may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
MethallenestrilMethallenestril may decrease the anticoagulant activities of Becaplermin.Experimental
Methyl salicylateMethyl salicylate may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
MethylestrenoloneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Methylestrenolone.Experimental
MilrinoneMilrinone may increase the anticoagulant activities of Becaplermin.Approved
MizoribineMizoribine may increase the anticoagulant activities of Becaplermin.Investigational
MofebutazoneMofebutazone may increase the anticoagulant activities of Becaplermin.Experimental
MoxestrolMoxestrol may decrease the anticoagulant activities of Becaplermin.Experimental
Mycophenolate mofetilMycophenolate mofetil may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Mycophenolic acidMycophenolic acid may increase the anticoagulant activities of Becaplermin.Approved
NabumetoneNabumetone may increase the anticoagulant activities of Becaplermin.Approved
NadroparinBecaplermin may increase the anticoagulant activities of Nadroparin.Approved, Investigational
NafamostatNafamostat may increase the anticoagulant activities of Becaplermin.Approved, Investigational
NaftifineNaftifine may increase the anticoagulant activities of Becaplermin.Approved
NaftopidilNaftopidil may increase the anticoagulant activities of Becaplermin.Investigational
NaproxenNaproxen may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
NepafenacNepafenac may increase the anticoagulant activities of Becaplermin.Approved, Investigational
NifenazoneNifenazone may increase the anticoagulant activities of Becaplermin.Experimental
Niflumic AcidNiflumic Acid may increase the anticoagulant activities of Becaplermin.Approved
NimesulideNimesulide may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
NintedanibThe risk or severity of adverse effects can be increased when Becaplermin is combined with Nintedanib.Approved
NitroaspirinNitroaspirin may increase the anticoagulant activities of Becaplermin.Investigational
NomegestrolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Nomegestrol.Approved
NorethisteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Norethisterone.Approved
NorgestrienoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Norgestrienone.Experimental
ObinutuzumabThe risk or severity of adverse effects can be increased when Becaplermin is combined with Obinutuzumab.Approved, Investigational
OlopatadineOlopatadine may increase the anticoagulant activities of Becaplermin.Approved
OlsalazineOlsalazine may increase the anticoagulant activities of Becaplermin.Approved
Omacetaxine mepesuccinateThe risk or severity of bleeding can be increased when Becaplermin is combined with Omacetaxine mepesuccinate.Approved, Investigational
Omega-3 fatty acidsOmega-3 fatty acids may increase the anticoagulant activities of Becaplermin.Approved, Nutraceutical
Omega-3-carboxylic acidsThe therapeutic efficacy of Becaplermin can be increased when used in combination with Omega-3-carboxylic acids.Approved, Investigational
OrgoteinOrgotein may increase the anticoagulant activities of Becaplermin.Vet Approved
OtamixabanBecaplermin may increase the anticoagulant activities of Otamixaban.Investigational
OxaprozinOxaprozin may increase the anticoagulant activities of Becaplermin.Approved
OxyphenbutazoneOxyphenbutazone may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
OzagrelOzagrel may increase the anticoagulant activities of Becaplermin.Investigational
PalmidrolPalmidrol may increase the anticoagulant activities of Becaplermin.Experimental, Nutraceutical
ParecoxibParecoxib may increase the anticoagulant activities of Becaplermin.Approved
ParnaparinParnaparin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
ParthenolideParthenolide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Pentaerythritol TetranitrateBecaplermin may increase the anticoagulant activities of Pentaerythritol Tetranitrate.Approved
Pentosan PolysulfatePentosan Polysulfate may increase the anticoagulant activities of Becaplermin.Approved
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Becaplermin.Approved, Investigational
PhenindioneBecaplermin may increase the anticoagulant activities of Phenindione.Approved, Investigational
PhenprocoumonBecaplermin may increase the anticoagulant activities of Phenprocoumon.Approved, Investigational
Phenyl aminosalicylatePhenyl aminosalicylate may increase the anticoagulant activities of Becaplermin.Approved
PhenylbutazonePhenylbutazone may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
PicotamidePicotamide may increase the anticoagulant activities of Becaplermin.Experimental
PimecrolimusPimecrolimus may increase the anticoagulant activities of Becaplermin.Approved, Investigational
PirfenidonePirfenidone may increase the anticoagulant activities of Becaplermin.Approved, Investigational
PiroxicamPiroxicam may increase the anticoagulant activities of Becaplermin.Approved, Investigational
PirprofenPirprofen may increase the anticoagulant activities of Becaplermin.Experimental
Polyestradiol phosphatePolyestradiol phosphate may decrease the anticoagulant activities of Becaplermin.Approved
Potassium CitrateBecaplermin may increase the anticoagulant activities of Potassium Citrate.Approved, Investigational, Vet Approved
PranoprofenPranoprofen may increase the anticoagulant activities of Becaplermin.Experimental, Investigational
PrasugrelPrasugrel may increase the anticoagulant activities of Becaplermin.Approved
ProgesteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Progesterone.Approved, Vet Approved
ProglumetacinProglumetacin may increase the anticoagulant activities of Becaplermin.Experimental
PromegestoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Promegestone.Experimental
PromestrienePromestriene may decrease the anticoagulant activities of Becaplermin.Investigational
PropacetamolPropacetamol may increase the anticoagulant activities of Becaplermin.Approved, Investigational
PropyphenazonePropyphenazone may increase the anticoagulant activities of Becaplermin.Experimental
ProquazoneProquazone may increase the anticoagulant activities of Becaplermin.Experimental
Protein CBecaplermin may increase the anticoagulant activities of Protein C.Approved
Protein S humanBecaplermin may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeBecaplermin may increase the anticoagulant activities of Protocatechualdehyde.Approved
PTC299PTC299 may increase the anticoagulant activities of Becaplermin.Investigational
QuinestrolQuinestrol may decrease the anticoagulant activities of Becaplermin.Approved
QuingestanolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Quingestanol.Experimental
RamatrobanRamatroban may increase the anticoagulant activities of Becaplermin.Investigational
RelcovaptanRelcovaptan may increase the anticoagulant activities of Becaplermin.Investigational
ResveratrolResveratrol may increase the anticoagulant activities of Becaplermin.Approved, Experimental, Investigational
ReteplaseReteplase may increase the anticoagulant activities of Becaplermin.Approved, Investigational
ReviparinBecaplermin may increase the anticoagulant activities of Reviparin.Approved, Investigational
RidogrelRidogrel may increase the anticoagulant activities of Becaplermin.Approved
RivaroxabanBecaplermin may increase the anticoagulant activities of Rivaroxaban.Approved
RofecoxibRofecoxib may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
RosiglitazoneRosiglitazone may increase the anticoagulant activities of Becaplermin.Approved, Investigational
SalicylamideSalicylamide may increase the anticoagulant activities of Becaplermin.Approved
Salicylic acidSalicylic acid may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
SalsalateSalsalate may increase the anticoagulant activities of Becaplermin.Approved
SarpogrelateSarpogrelate may increase the anticoagulant activities of Becaplermin.Investigational
SaruplaseSaruplase may increase the anticoagulant activities of Becaplermin.Experimental
SecoisolariciresinolSecoisolariciresinol may decrease the anticoagulant activities of Becaplermin.Investigational
SelexipagSelexipag may increase the anticoagulant activities of Becaplermin.Approved
SemapimodSemapimod may increase the anticoagulant activities of Becaplermin.Investigational
SeratrodastSeratrodast may increase the anticoagulant activities of Becaplermin.Approved
SerrapeptaseSerrapeptase may increase the anticoagulant activities of Becaplermin.Investigational
SevofluraneSevoflurane may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
Sodium CitrateBecaplermin may increase the anticoagulant activities of Sodium Citrate.Approved, Investigational
SRT501SRT501 may increase the anticoagulant activities of Becaplermin.Investigational
StreptokinaseStreptokinase may increase the anticoagulant activities of Becaplermin.Approved, Investigational
SugammadexSugammadex may increase the anticoagulant activities of Becaplermin.Approved
SulfasalazineSulfasalazine may increase the anticoagulant activities of Becaplermin.Approved
SulindacSulindac may increase the anticoagulant activities of Becaplermin.Approved, Investigational
SulodexideBecaplermin may increase the anticoagulant activities of Sulodexide.Approved, Investigational
SuprofenSuprofen may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
SuxibuzoneSuxibuzone may increase the anticoagulant activities of Becaplermin.Experimental
Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Becaplermin.Approved
Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Becaplermin.Approved
TarenflurbilTarenflurbil may increase the anticoagulant activities of Becaplermin.Investigational
TenecteplaseTenecteplase may increase the anticoagulant activities of Becaplermin.Approved
TenidapTenidap may increase the anticoagulant activities of Becaplermin.Experimental
TenoxicamTenoxicam may increase the anticoagulant activities of Becaplermin.Approved
TepoxalinTepoxalin may increase the anticoagulant activities of Becaplermin.Vet Approved
TeriflunomideTeriflunomide may increase the anticoagulant activities of Becaplermin.Approved
TesmilifeneTesmilifene may increase the anticoagulant activities of Becaplermin.Investigational
Testosterone cypionateThe therapeutic efficacy of Becaplermin can be increased when used in combination with Testosterone cypionate.Approved
Testosterone enanthateThe therapeutic efficacy of Becaplermin can be increased when used in combination with Testosterone enanthate.Approved
Testosterone undecanoateThe therapeutic efficacy of Becaplermin can be increased when used in combination with Testosterone undecanoate.Approved, Investigational
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Becaplermin.Approved
TiboloneTibolone may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TicagrelorTicagrelor may increase the anticoagulant activities of Becaplermin.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Becaplermin.Approved
TinoridineTinoridine may increase the anticoagulant activities of Becaplermin.Investigational
TinzaparinTinzaparin may increase the anticoagulant activities of Becaplermin.Approved
TioclomarolTioclomarol may increase the anticoagulant activities of Becaplermin.Experimental
TipranavirTipranavir may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TirofibanTirofiban may increase the anticoagulant activities of Becaplermin.Approved
Tolfenamic AcidTolfenamic Acid may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TolmetinTolmetin may increase the anticoagulant activities of Becaplermin.Approved
TositumomabThe risk or severity of adverse effects can be increased when Becaplermin is combined with Tositumomab.Approved, Investigational
TranilastTranilast may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TrapidilTrapidil may increase the anticoagulant activities of Becaplermin.Approved
TreprostinilTreprostinil may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TribenosideTribenoside may increase the anticoagulant activities of Becaplermin.Experimental
TriflusalTriflusal may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TriptolideTriptolide may increase the anticoagulant activities of Becaplermin.Investigational
Trolamine salicylateTrolamine salicylate may increase the anticoagulant activities of Becaplermin.Approved
TroxerutinBecaplermin may increase the anticoagulant activities of Troxerutin.Investigational
UrokinaseUrokinase may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
ValdecoxibValdecoxib may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
Vitamin EVitamin E may increase the anticoagulant activities of Becaplermin.Approved, Nutraceutical, Vet Approved
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Becaplermin.Approved
WarfarinBecaplermin may increase the anticoagulant activities of Warfarin.Approved
XimelagatranBecaplermin may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
ZaltoprofenZaltoprofen may increase the anticoagulant activities of Becaplermin.Approved, Investigational
ZeranolZeranol may decrease the anticoagulant activities of Becaplermin.Vet Approved
ZileutonZileuton may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
ZomepiracZomepirac may increase the anticoagulant activities of Becaplermin.Withdrawn
Food Interactions
Not Available

References

General References
  1. Link [Link]
  2. Link [Link]
External Links
UniProt
P01127
Genbank
K01401
PubChem Substance
46508246
ChEMBL
CHEMBL1201556
Therapeutic Targets Database
DAP000028
PharmGKB
PA164749511
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Becaplermin
ATC Codes
A01AD08 — BecaplerminD03AX06 — Becaplermin
FDA label
Download (248 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1WithdrawnTreatmentDiabetic Ulcers1
1, 2CompletedTreatmentDiabetic Foot Ulcers (DFU)1
3CompletedTreatmentHypertensive Leg Ulcer / MARTORELL'S ULCER / Necrotic Angiodermatitis1
3Not Yet RecruitingTreatmentFoot Ulcer, Diabetic / Venous Ulcers1
3TerminatedTreatmentDiabetic Foot / Diabetic Neuropathies / Skin Ulcers / Ulcus Cruris1
Not AvailableCompletedNot AvailableDiabetes Mellitus (DM)1
Not AvailableUnknown StatusTreatmentDiabetic Foot Ulcers (DFU)2

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Janssen-Ortho Inc.
  • McNeil Laboratories
  • OMJ Pharmaceuticals
  • Ortho Mcneil Janssen Pharmaceutical Inc.
  • Ortho-McNeil-Janssen Pharmaceuticals Inc.
Dosage forms
FormRouteStrength
GelCutaneous0.01 %
GelTopical100 ug/g
GelTopical100 mcg
Prices
Unit descriptionCostUnit
Regranex 0.01% Gel 15 gm Tube723.82USD tube
Regranex 0.01% gel46.4USD g
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1340846No1999-12-072015-12-15Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.160Not Available
isoelectric point9.38Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
General Function
Vascular endothelial growth factor binding
Specific Function
Tyrosine-protein kinase that acts as cell-surface receptor for homodimeric PDGFB and PDGFD and for heterodimers formed by PDGFA and PDGFB, and plays an essential role in the regulation of embryonic...
Gene Name
PDGFRB
Uniprot ID
P09619
Uniprot Name
Platelet-derived growth factor receptor beta
Molecular Weight
123966.895 Da
References
  1. Papanas N, Maltezos E: Becaplermin gel in the treatment of diabetic neuropathic foot ulcers. Clin Interv Aging. 2008;3(2):233-40. [PubMed:18686746]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Vascular endothelial growth factor-activated receptor activity
Specific Function
Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chem...
Gene Name
PDGFRA
Uniprot ID
P16234
Uniprot Name
Platelet-derived growth factor receptor alpha
Molecular Weight
122668.46 Da
References
  1. Abdiu A, Walz TM, Nishikawa BK, Wingren S, Larsson SE, Wasteson A: Human malignant fibrous histiocytomas in vitro: growth characteristics and their association with expression of mRNA for platelet-derived growth factor, transforming growth factor-alpha and their receptors. Eur J Cancer. 1998 Dec;34(13):2094-100. [PubMed:10070317]
  2. Ebert M, Yokoyama M, Friess H, Kobrin MS, Buchler MW, Korc M: Induction of platelet-derived growth factor A and B chains and over-expression of their receptors in human pancreatic cancer. Int J Cancer. 1995 Sep 4;62(5):529-35. [PubMed:7665222]
  3. Miller-Kasprzak E, Niemir ZI, Czekalski S: [Structure and function of PDGF-R-alpha and its expression in normal kidney and kidney diseases]. Przegl Lek. 2002;59(10):826-31. [PubMed:12632922]
  4. Heidaran MA, Pierce JH, Lombardi D, Ruggiero M, Gutkind JS, Matsui T, Aaronson SA: Deletion or substitution within the alpha platelet-derived growth factor receptor kinase insert domain: effects on functional coupling with intracellular signaling pathways. Mol Cell Biol. 1991 Jan;11(1):134-42. [PubMed:1702511]
  5. Yu J, Liu XW, Kim HR: Platelet-derived growth factor (PDGF) receptor-alpha-activated c-Jun NH2-terminal kinase-1 is critical for PDGF-induced p21WAF1/CIP1 promoter activity independent of p53. J Biol Chem. 2003 Dec 5;278(49):49582-8. Epub 2003 Sep 23. [PubMed:14506245]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Tumor necrosis factor binding
Specific Function
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for differen...
Gene Name
A2M
Uniprot ID
P01023
Uniprot Name
Alpha-2-macroglobulin
Molecular Weight
163289.945 Da
References
  1. Lizonova A, Bizik J, Grofova M, Vaheri A: Coexpression of tumor-associated alpha 2-macroglobulin and growth factors in human melanoma cell lines. J Cell Biochem. 1990 Aug;43(4):315-25. [PubMed:1697862]
  2. Bonner JC, Osornio-Vargas AR: Differential binding and regulation of platelet-derived growth factor A and B chain isoforms by alpha 2-macroglobulin. J Biol Chem. 1995 Jul 7;270(27):16236-42. [PubMed:7541796]

Drug created on June 13, 2005 07:24 / Updated on June 02, 2018 06:30