You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameBecaplermin
Accession NumberDB00102  (BTD00053, BIOD00053)
TypeBiotech
GroupsApproved, Investigational
DescriptionBecaplermin is produced by recombinant DNA technology by insertion of the gene for the B chain of platelet derived growth factor (PDGF) into the yeast, Saccharomyces cerevisiae. Becaplermin has a molecular weight of approximately 25 KD and is a homodimer composed of two identical polypeptide chains that are bound together by disulfide bonds.
Protein structureDb00102
Related Articles
Protein chemical formulaC532H892N162O153S9
Protein average weight12294.4 Da
Sequences
>DB00102 sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQC
RPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Download FASTA Format
Synonyms
c-sis
PDGF B-chain
PDGF-2
PDGF-BB
PDGFB
Platelet-derived growth factor B chain precursor
Platelet-derived growth factor beta polypeptide
SH-POLYPEPTIDE-59
External Identifiers
  • RWJ-60235
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
RegranexGel100 ug/gTopicalHEALTHPOINT, LTD2011-11-012016-01-31Us
RegranexGel100 ug/gTopicalSmith & Nephew, Inc.2011-11-01Not applicableUs
Regranex (becaplermin) 0.01%Gel100 mcgTopicalJanssen Inc1999-02-012011-07-27Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
RegranexGel0.01 %CutaneousJanssen Cilag International Nv1999-03-29Not applicableEu
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII1B56C968OA
CAS number165101-51-9
Pharmacology
IndicationFor topical treatment of skin ulcers (from diabetes)
Structured Indications
PharmacodynamicsUsed for the topical treatment of skin ulcers, Regranex has a biological activity similar to that of endogenous platelet-derived growth factor, which includes promoting the chemotactic recruitment and proliferation of cells involved in wound repair and enhancing the formation of granulation tissue.
Mechanism of actionBinds to the beta platelet-derived growth factor (PDGF) receptor, a tyrosine kinase receptor. PDGF is known to exist as a dimer, and activates its signaling pathway by a ligand induced receptor dimerization and autophosphorylation. PDGF receptors also contain many auto-phosphorylation sites, which serve to mediate binding of SH2 sites and subsequently signal corresponding pathways. There are five different isoforms of PDGF that activate through two different receptors (alpha and beta).
TargetKindPharmacological actionActionsOrganismUniProt ID
Platelet-derived growth factor receptor betaProteinyesNot AvailableHumanP09619 details
Platelet-derived growth factor receptor alphaProteinunknownNot AvailableHumanP16234 details
Alpha-2-macroglobulinProteinunknownNot AvailableHumanP01023 details
Related Articles
Absorptionvery little systemic absorption. 15% of patients experienced complete healing within 8 weeks, while for 25% of patients, it was at 10 weeks.
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AbciximabAbciximab may increase the anticoagulant activities of Becaplermin.Approved
AceclofenacAceclofenac may increase the anticoagulant activities of Becaplermin.Approved
AcenocoumarolBecaplermin may increase the anticoagulant activities of Acenocoumarol.Approved
AcetovanilloneAcetovanillone may increase the anticoagulant activities of Becaplermin.Investigational
Acetylsalicylic acidAcetylsalicylic acid may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
AdapaleneAdapalene may increase the anticoagulant activities of Becaplermin.Approved
AllylestrenolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Allylestrenol.Approved
AlprostadilAlprostadil may increase the anticoagulant activities of Becaplermin.Approved, Investigational
AlteplaseAlteplase may increase the anticoagulant activities of Becaplermin.Approved
AltrenogestThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Altrenogest.Vet Approved
ALX-0081ALX-0081 may increase the anticoagulant activities of Becaplermin.Investigational
Aminosalicylic AcidAminosalicylic Acid may increase the anticoagulant activities of Becaplermin.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Becaplermin.Approved
AncrodBecaplermin may increase the anticoagulant activities of Ancrod.Investigational
AnisodamineAnisodamine may increase the anticoagulant activities of Becaplermin.Investigational
AnistreplaseAnistreplase may increase the anticoagulant activities of Becaplermin.Approved
AntipyrineAntipyrine may increase the anticoagulant activities of Becaplermin.Approved
Antithrombin III humanBecaplermin may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanApixaban may increase the anticoagulant activities of Becaplermin.Approved
ApremilastApremilast may increase the anticoagulant activities of Becaplermin.Approved, Investigational
ArdeparinBecaplermin may increase the anticoagulant activities of Ardeparin.Approved, Withdrawn
ArgatrobanBecaplermin may increase the anticoagulant activities of Argatroban.Approved, Investigational
AstaxanthinAstaxanthin may increase the anticoagulant activities of Becaplermin.Investigational
AzapropazoneAzapropazone may increase the anticoagulant activities of Becaplermin.Withdrawn
AzelastineAzelastine may increase the anticoagulant activities of Becaplermin.Approved
BalsalazideBalsalazide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BatroxobinBatroxobin may increase the anticoagulant activities of Becaplermin.Experimental
BazedoxifeneBazedoxifene may decrease the anticoagulant activities of Becaplermin.Approved, Investigational
BemiparinBemiparin may increase the anticoagulant activities of Becaplermin.Approved
BenoxaprofenBenoxaprofen may increase the anticoagulant activities of Becaplermin.Withdrawn
BeraprostBeraprost may increase the anticoagulant activities of Becaplermin.Investigational
Betulinic AcidBetulinic Acid may increase the anticoagulant activities of Becaplermin.Investigational
BivalirudinBivalirudin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BromfenacBromfenac may increase the anticoagulant activities of Becaplermin.Approved
BucillamineBucillamine may increase the anticoagulant activities of Becaplermin.Investigational
ButylphthalideButylphthalide may increase the anticoagulant activities of Becaplermin.Investigational
CangrelorCangrelor may increase the anticoagulant activities of Becaplermin.Approved
CarprofenCarprofen may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved, Withdrawn
CastanospermineCastanospermine may increase the anticoagulant activities of Becaplermin.Experimental
CelecoxibCelecoxib may increase the anticoagulant activities of Becaplermin.Approved, Investigational
CertoparinBecaplermin may increase the anticoagulant activities of Certoparin.Approved
ChloroquineChloroquine may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Becaplermin.Withdrawn
CilostazolCilostazol may increase the anticoagulant activities of Becaplermin.Approved
Citric AcidBecaplermin may increase the anticoagulant activities of Citric Acid.Nutraceutical, Vet Approved
ClonixinClonixin may increase the anticoagulant activities of Becaplermin.Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Becaplermin.Approved, Nutraceutical
CollagenaseThe risk or severity of adverse effects can be increased when Becaplermin is combined with Collagenase.Approved
Conjugated Equine EstrogensConjugated Equine Estrogens may decrease the anticoagulant activities of Becaplermin.Approved
CurcuminCurcumin may increase the anticoagulant activities of Becaplermin.Investigational
D-LimoneneD-Limonene may increase the anticoagulant activities of Becaplermin.Investigational
Dabigatran etexilateDabigatran etexilate may increase the anticoagulant activities of Becaplermin.Approved
DalteparinBecaplermin may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidBecaplermin may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DasatinibDasatinib may increase the anticoagulant activities of Becaplermin.Approved, Investigational
DeferasiroxThe risk or severity of adverse effects can be increased when Becaplermin is combined with Deferasirox.Approved, Investigational
DefibrotideDefibrotide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Becaplermin is combined with Deoxycholic Acid.Approved
dersalazinedersalazine may increase the anticoagulant activities of Becaplermin.Investigational
DesirudinBecaplermin may increase the anticoagulant activities of Desirudin.Approved
DesmoteplaseDesmoteplase may increase the anticoagulant activities of Becaplermin.Investigational
DesogestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Desogestrel.Approved
DextranBecaplermin may increase the anticoagulant activities of Dextran.Approved, Vet Approved
Dextran 40Becaplermin may increase the anticoagulant activities of Dextran 40.Approved
Dextran 70Becaplermin may increase the anticoagulant activities of Dextran 70.Approved
Dextran 75Becaplermin may increase the anticoagulant activities of Dextran 75.Approved
DiclofenacDiclofenac may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
DicoumarolBecaplermin may increase the anticoagulant activities of Dicoumarol.Approved
DienestrolDienestrol may decrease the anticoagulant activities of Becaplermin.Approved
DienogestThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Dienogest.Approved
DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Becaplermin.Approved
DiflunisalDiflunisal may increase the anticoagulant activities of Becaplermin.Approved
DipyridamoleDipyridamole may increase the anticoagulant activities of Becaplermin.Approved
DitazoleDitazole may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
DrospirenoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Drospirenone.Approved
Drotrecogin alfaDrotrecogin alfa may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
DroxicamDroxicam may increase the anticoagulant activities of Becaplermin.Approved
DuvelisibDuvelisib may increase the anticoagulant activities of Becaplermin.Investigational
DydrogesteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Dydrogesterone.Approved, Withdrawn
E6201E6201 may increase the anticoagulant activities of Becaplermin.Investigational
EbselenEbselen may increase the anticoagulant activities of Becaplermin.Investigational
Edetic AcidBecaplermin may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanEdoxaban may increase the anticoagulant activities of Becaplermin.Approved
EnoxaparinBecaplermin may increase the anticoagulant activities of Enoxaparin.Approved
EpinastineEpinastine may increase the anticoagulant activities of Becaplermin.Approved, Investigational
EpirizoleEpirizole may increase the anticoagulant activities of Becaplermin.Approved
eplivanserineeplivanserine may increase the anticoagulant activities of Becaplermin.Investigational
EpoprostenolEpoprostenol may increase the anticoagulant activities of Becaplermin.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
EstradiolEstradiol may decrease the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
EstriolEstriol may decrease the anticoagulant activities of Becaplermin.Approved, Vet Approved
EstroneEstrone may decrease the anticoagulant activities of Becaplermin.Approved
EtanerceptEtanercept may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Becaplermin.Approved
Ethyl biscoumacetateBecaplermin may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
Ethynodiol diacetateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Ethynodiol diacetate.Approved
EtodolacEtodolac may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Vet Approved
EtofenamateEtofenamate may increase the anticoagulant activities of Becaplermin.Approved
EtonogestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoricoxibEtoricoxib may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Evening primrose oilEvening primrose oil may increase the anticoagulant activities of Becaplermin.Approved
exisulindexisulind may increase the anticoagulant activities of Becaplermin.Investigational
FenbufenFenbufen may increase the anticoagulant activities of Becaplermin.Approved
FenoprofenFenoprofen may increase the anticoagulant activities of Becaplermin.Approved
FibrinolysinFibrinolysin may increase the anticoagulant activities of Becaplermin.Approved
FloctafenineFloctafenine may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
FluindioneBecaplermin may increase the anticoagulant activities of Fluindione.Investigational
FlunixinFlunixin may increase the anticoagulant activities of Becaplermin.Vet Approved
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Becaplermin.Approved, Investigational
FondaparinuxBecaplermin may increase the anticoagulant activities of Fondaparinux.Investigational
Fondaparinux sodiumBecaplermin may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
GabexateBecaplermin may increase the anticoagulant activities of Gabexate.Investigational
GenisteinGenistein may decrease the anticoagulant activities of Becaplermin.Investigational
GestodeneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Gestodene.Approved
GestrinoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Gestrinone.Approved
HeminHemin may increase the anticoagulant activities of Becaplermin.Approved
HeparinBecaplermin may increase the anticoagulant activities of Heparin.Approved, Investigational
HexestrolHexestrol may decrease the anticoagulant activities of Becaplermin.Withdrawn
HigenamineHigenamine may increase the anticoagulant activities of Becaplermin.Investigational
HirulogBecaplermin may increase the anticoagulant activities of Hirulog.Experimental
HMPL-004HMPL-004 may increase the anticoagulant activities of Becaplermin.Investigational
Hydroxyprogesterone caproateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Becaplermin is combined with Ibritumomab tiuxetan.Approved
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Becaplermin.Approved
IbudilastIbudilast may increase the anticoagulant activities of Becaplermin.Approved, Investigational
IbuprofenIbuprofen may increase the anticoagulant activities of Becaplermin.Approved
IbuproxamIbuproxam may increase the anticoagulant activities of Becaplermin.Withdrawn
IcatibantIcatibant may increase the anticoagulant activities of Becaplermin.Approved
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Becaplermin.Approved, Nutraceutical
idraparinuxBecaplermin may increase the anticoagulant activities of idraparinux.Investigational
IfenprodilIfenprodil may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
IloprostIloprost may increase the anticoagulant activities of Becaplermin.Approved, Investigational
IndobufenIndobufen may increase the anticoagulant activities of Becaplermin.Investigational
IndomethacinIndomethacin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
IndoprofenIndoprofen may increase the anticoagulant activities of Becaplermin.Withdrawn
IsoxicamIsoxicam may increase the anticoagulant activities of Becaplermin.Withdrawn
Kct 0809Kct 0809 may increase the anticoagulant activities of Becaplermin.Investigational
KebuzoneKebuzone may increase the anticoagulant activities of Becaplermin.Experimental
KetanserinKetanserin may increase the anticoagulant activities of Becaplermin.Investigational
KetoprofenKetoprofen may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
KetorolacKetorolac may increase the anticoagulant activities of Becaplermin.Approved
LeflunomideLeflunomide may increase the anticoagulant activities of Becaplermin.Approved, Investigational
LepirudinLepirudin may increase the anticoagulant activities of Becaplermin.Approved
LevonorgestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Levonorgestrel.Approved, Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Becaplermin.Approved
LisofyllineLisofylline may increase the anticoagulant activities of Becaplermin.Investigational
LornoxicamLornoxicam may increase the anticoagulant activities of Becaplermin.Approved
LoxoprofenLoxoprofen may increase the anticoagulant activities of Becaplermin.Approved
LumiracoxibLumiracoxib may increase the anticoagulant activities of Becaplermin.Approved, Investigational
LynestrenolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Lynestrenol.Investigational
Magnesium salicylateMagnesium salicylate may increase the anticoagulant activities of Becaplermin.Approved
MasoprocolMasoprocol may increase the anticoagulant activities of Becaplermin.Approved
Meclofenamic acidMeclofenamic acid may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
MedrogestoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Medrogestone.Approved
Medroxyprogesterone acetateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Becaplermin.Approved
Megestrol acetateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MeloxicamMeloxicam may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
MesalazineMesalazine may increase the anticoagulant activities of Becaplermin.Approved
MestranolMestranol may decrease the anticoagulant activities of Becaplermin.Approved
MetamizoleMetamizole may increase the anticoagulant activities of Becaplermin.Withdrawn
MethallenestrilMethallenestril may decrease the anticoagulant activities of Becaplermin.Experimental
MilrinoneMilrinone may increase the anticoagulant activities of Becaplermin.Approved
MizoribineMizoribine may increase the anticoagulant activities of Becaplermin.Investigational
Mycophenolate mofetilMycophenolate mofetil may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Mycophenolic acidMycophenolic acid may increase the anticoagulant activities of Becaplermin.Approved
NabumetoneNabumetone may increase the anticoagulant activities of Becaplermin.Approved
NadroparinBecaplermin may increase the anticoagulant activities of Nadroparin.Approved
NafamostatNafamostat may increase the anticoagulant activities of Becaplermin.Investigational
NaftifineNaftifine may increase the anticoagulant activities of Becaplermin.Approved
NaftopidilNaftopidil may increase the anticoagulant activities of Becaplermin.Investigational
NaproxenNaproxen may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
NCX 4016NCX 4016 may increase the anticoagulant activities of Becaplermin.Investigational
NepafenacNepafenac may increase the anticoagulant activities of Becaplermin.Approved
Niflumic AcidNiflumic Acid may increase the anticoagulant activities of Becaplermin.Approved
NimesulideNimesulide may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
NintedanibThe risk or severity of adverse effects can be increased when Becaplermin is combined with Nintedanib.Approved
NitroaspirinNitroaspirin may increase the anticoagulant activities of Becaplermin.Investigational
NomegestrolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Nomegestrol.Approved
NorethisteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Norethisterone.Approved
ObinutuzumabThe risk or severity of adverse effects can be increased when Becaplermin is combined with Obinutuzumab.Approved
OlopatadineOlopatadine may increase the anticoagulant activities of Becaplermin.Approved
OlsalazineOlsalazine may increase the anticoagulant activities of Becaplermin.Approved
Omacetaxine mepesuccinateThe risk or severity of adverse effects can be increased when Becaplermin is combined with Omacetaxine mepesuccinate.Approved
Omega-3 fatty acidsOmega-3 fatty acids may increase the anticoagulant activities of Becaplermin.Approved
OrgoteinOrgotein may increase the anticoagulant activities of Becaplermin.Vet Approved
OtamixabanBecaplermin may increase the anticoagulant activities of Otamixaban.Investigational
OxaprozinOxaprozin may increase the anticoagulant activities of Becaplermin.Approved
OxyphenbutazoneOxyphenbutazone may increase the anticoagulant activities of Becaplermin.Withdrawn
ParecoxibParecoxib may increase the anticoagulant activities of Becaplermin.Approved
ParnaparinParnaparin may increase the anticoagulant activities of Becaplermin.Approved
Pentosan PolysulfatePentosan Polysulfate may increase the anticoagulant activities of Becaplermin.Approved
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Becaplermin.Approved, Investigational
PhenindioneBecaplermin may increase the anticoagulant activities of Phenindione.Approved
PhenprocoumonBecaplermin may increase the anticoagulant activities of Phenprocoumon.Approved
PhenylbutazonePhenylbutazone may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
PimecrolimusPimecrolimus may increase the anticoagulant activities of Becaplermin.Approved, Investigational
PirfenidonePirfenidone may increase the anticoagulant activities of Becaplermin.Investigational
PiroxicamPiroxicam may increase the anticoagulant activities of Becaplermin.Approved, Investigational
PlasminPlasmin may increase the anticoagulant activities of Becaplermin.Investigational
Polyestradiol phosphatePolyestradiol phosphate may decrease the anticoagulant activities of Becaplermin.Approved
PrasugrelPrasugrel may increase the anticoagulant activities of Becaplermin.Approved
ProgesteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Progesterone.Approved, Vet Approved
PromestrienePromestriene may decrease the anticoagulant activities of Becaplermin.Investigational
PropacetamolPropacetamol may increase the anticoagulant activities of Becaplermin.Approved
Protein CBecaplermin may increase the anticoagulant activities of Protein C.Approved
Protein S humanBecaplermin may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeBecaplermin may increase the anticoagulant activities of Protocatechualdehyde.Approved
PTC299PTC299 may increase the anticoagulant activities of Becaplermin.Investigational
QuinestrolQuinestrol may decrease the anticoagulant activities of Becaplermin.Approved
RamatrobanRamatroban may increase the anticoagulant activities of Becaplermin.Investigational
ResveratrolResveratrol may increase the anticoagulant activities of Becaplermin.Experimental, Investigational
ReteplaseReteplase may increase the anticoagulant activities of Becaplermin.Approved
ReviparinBecaplermin may increase the anticoagulant activities of Reviparin.Approved
RidogrelRidogrel may increase the anticoagulant activities of Becaplermin.Approved
RivaroxabanBecaplermin may increase the anticoagulant activities of Rivaroxaban.Approved
RofecoxibRofecoxib may increase the anticoagulant activities of Becaplermin.Investigational, Withdrawn
RosiglitazoneRosiglitazone may increase the anticoagulant activities of Becaplermin.Approved, Investigational
S EquolS Equol may decrease the anticoagulant activities of Becaplermin.Investigational
SalicylamideSalicylamide may increase the anticoagulant activities of Becaplermin.Approved
Salicylic acidSalicylic acid may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
SalsalateSalsalate may increase the anticoagulant activities of Becaplermin.Approved
SCH-530348SCH-530348 may increase the anticoagulant activities of Becaplermin.Investigational
SecoisolariciresinolSecoisolariciresinol may decrease the anticoagulant activities of Becaplermin.Investigational
SelexipagSelexipag may increase the anticoagulant activities of Becaplermin.Approved
SeratrodastSeratrodast may increase the anticoagulant activities of Becaplermin.Approved, Investigational
SevofluraneSevoflurane may increase the anticoagulant activities of Becaplermin.Approved, Vet Approved
SRT501SRT501 may increase the anticoagulant activities of Becaplermin.Investigational
StreptokinaseStreptokinase may increase the anticoagulant activities of Becaplermin.Approved
SugammadexSugammadex may increase the anticoagulant activities of Becaplermin.Approved
SulfasalazineSulfasalazine may increase the anticoagulant activities of Becaplermin.Approved
SulindacSulindac may increase the anticoagulant activities of Becaplermin.Approved
SulodexideBecaplermin may increase the anticoagulant activities of Sulodexide.Approved, Investigational
SuprofenSuprofen may increase the anticoagulant activities of Becaplermin.Approved, Withdrawn
Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Becaplermin.Approved
Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Becaplermin.Approved
TenecteplaseTenecteplase may increase the anticoagulant activities of Becaplermin.Approved
TenoxicamTenoxicam may increase the anticoagulant activities of Becaplermin.Approved
TepoxalinTepoxalin may increase the anticoagulant activities of Becaplermin.Vet Approved
TeriflunomideTeriflunomide may increase the anticoagulant activities of Becaplermin.Approved
TesmilifeneTesmilifene may increase the anticoagulant activities of Becaplermin.Investigational
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Becaplermin.Approved
TiboloneTibolone may increase the anticoagulant activities of Becaplermin.Approved
TicagrelorTicagrelor may increase the anticoagulant activities of Becaplermin.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Becaplermin.Approved
TinoridineTinoridine may increase the anticoagulant activities of Becaplermin.Investigational
TinzaparinTinzaparin may increase the anticoagulant activities of Becaplermin.Approved
TipranavirTipranavir may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TirofibanTirofiban may increase the anticoagulant activities of Becaplermin.Approved
Tolfenamic AcidTolfenamic Acid may increase the anticoagulant activities of Becaplermin.Approved
TolmetinTolmetin may increase the anticoagulant activities of Becaplermin.Approved
TositumomabThe risk or severity of adverse effects can be increased when Becaplermin is combined with Tositumomab.Approved
TranilastTranilast may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TrapidilTrapidil may increase the anticoagulant activities of Becaplermin.Approved
TreprostinilTreprostinil may increase the anticoagulant activities of Becaplermin.Approved, Investigational
TriflusalTriflusal may increase the anticoagulant activities of Becaplermin.Approved
Trisalicylate-cholineTrisalicylate-choline may increase the anticoagulant activities of Becaplermin.Approved
UrokinaseUrokinase may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
ValdecoxibValdecoxib may increase the anticoagulant activities of Becaplermin.Investigational, Withdrawn
Vitamin EVitamin E may increase the anticoagulant activities of Becaplermin.Approved, Nutraceutical, Vet Approved
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Becaplermin.Approved
WarfarinBecaplermin may increase the anticoagulant activities of Warfarin.Approved
XimelagatranBecaplermin may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
Ym150Becaplermin may increase the anticoagulant activities of Ym150.Investigational
ZaltoprofenZaltoprofen may increase the anticoagulant activities of Becaplermin.Approved
ZeranolZeranol may decrease the anticoagulant activities of Becaplermin.Vet Approved
ZileutonZileuton may increase the anticoagulant activities of Becaplermin.Approved, Investigational, Withdrawn
ZomepiracZomepirac may increase the anticoagulant activities of Becaplermin.Withdrawn
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Link [Link]
  2. Link [Link]
External Links
ATC CodesA01AD08D03AX06
AHFS Codes
  • 84:16.00
PDB Entries
FDA labelDownload (248 KB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
GelCutaneous0.01 %
GelTopical100 ug/g
GelTopical100 mcg
Prices
Unit descriptionCostUnit
Regranex 0.01% Gel 15 gm Tube723.82USD tube
Regranex 0.01% gel46.4USD g
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1340846 No1999-12-072015-12-15Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.160Not Available
isoelectric point9.38Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Vascular endothelial growth factor binding
Specific Function:
Tyrosine-protein kinase that acts as cell-surface receptor for homodimeric PDGFB and PDGFD and for heterodimers formed by PDGFA and PDGFB, and plays an essential role in the regulation of embryonic development, cell proliferation, survival, differentiation, chemotaxis and migration. Plays an essential role in blood vessel development by promoting proliferation, migration and recruitment of peri...
Gene Name:
PDGFRB
Uniprot ID:
P09619
Molecular Weight:
123966.895 Da
References
  1. Papanas N, Maltezos E: Becaplermin gel in the treatment of diabetic neuropathic foot ulcers. Clin Interv Aging. 2008;3(2):233-40. [PubMed:18686746 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Vascular endothelial growth factor-activated receptor activity
Specific Function:
Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chemotaxis. Depending on the context, promotes or inhibits cell proliferation and cell migration. Plays an important role in the differentiation of bone marrow-derived mesenchymal stem cells. Required for...
Gene Name:
PDGFRA
Uniprot ID:
P16234
Molecular Weight:
122668.46 Da
References
  1. Abdiu A, Walz TM, Nishikawa BK, Wingren S, Larsson SE, Wasteson A: Human malignant fibrous histiocytomas in vitro: growth characteristics and their association with expression of mRNA for platelet-derived growth factor, transforming growth factor-alpha and their receptors. Eur J Cancer. 1998 Dec;34(13):2094-100. [PubMed:10070317 ]
  2. Ebert M, Yokoyama M, Friess H, Kobrin MS, Buchler MW, Korc M: Induction of platelet-derived growth factor A and B chains and over-expression of their receptors in human pancreatic cancer. Int J Cancer. 1995 Sep 4;62(5):529-35. [PubMed:7665222 ]
  3. Miller-Kasprzak E, Niemir ZI, Czekalski S: [Structure and function of PDGF-R-alpha and its expression in normal kidney and kidney diseases]. Przegl Lek. 2002;59(10):826-31. [PubMed:12632922 ]
  4. Heidaran MA, Pierce JH, Lombardi D, Ruggiero M, Gutkind JS, Matsui T, Aaronson SA: Deletion or substitution within the alpha platelet-derived growth factor receptor kinase insert domain: effects on functional coupling with intracellular signaling pathways. Mol Cell Biol. 1991 Jan;11(1):134-42. [PubMed:1702511 ]
  5. Yu J, Liu XW, Kim HR: Platelet-derived growth factor (PDGF) receptor-alpha-activated c-Jun NH2-terminal kinase-1 is critical for PDGF-induced p21WAF1/CIP1 promoter activity independent of p53. J Biol Chem. 2003 Dec 5;278(49):49582-8. Epub 2003 Sep 23. [PubMed:14506245 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Tumor necrosis factor binding
Specific Function:
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight...
Gene Name:
A2M
Uniprot ID:
P01023
Molecular Weight:
163289.945 Da
References
  1. Lizonova A, Bizik J, Grofova M, Vaheri A: Coexpression of tumor-associated alpha 2-macroglobulin and growth factors in human melanoma cell lines. J Cell Biochem. 1990 Aug;43(4):315-25. [PubMed:1697862 ]
  2. Bonner JC, Osornio-Vargas AR: Differential binding and regulation of platelet-derived growth factor A and B chain isoforms by alpha 2-macroglobulin. J Biol Chem. 1995 Jul 7;270(27):16236-42. [PubMed:7541796 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23