You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameInsulin Aspart
Accession NumberDB01306
TypeBiotech
GroupsApproved
DescriptionInsulin aspart is a recombinant, biosynthetic, fast-acting insulin analogue. It has a single amino acid substitution at position B28 where proline is replaced with aspartic acid. This substitution decreases its propensity to form hexamers and gives it a higher rate of absorption following subcutaneous administration compared to native insulin. Insulin aspart is produced in a genetically modified strain of _Saccharomyces cerevisiae_ and harvested from a bioreactor.
Protein structureDb01306
Related Articles
Protein chemical formulaC256H381N65O79S6
Protein average weight5825.8 Da
Sequences
>A chain
GIVEQCCTSICSLYQLENYCN
>B chain
FVNQHLCGSHLVEALYLVCGERGFFYTDKT
Download FASTA Format
Synonyms
Aspart
Aspart Insulin
B28-Aspart-Insulin
INA-X14
Insulin aspart protamine recombinant
Insulin aspart recombinant
Insulin X14
Insulin, Asp(B28)
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
NovologInjection, solution100 [iU]/mLIntravenous; SubcutaneousTYA Pharmaceuticals2001-08-27Not applicableUs
NovologInjection, solution100 [iU]/mLIntravenous; SubcutaneousNovo Nordisk2001-08-27Not applicableUs
NovologInjection, solution100 [iU]/mLIntravenous; SubcutaneousA S Medication Solutions2003-01-22Not applicableUs
NovologInjection, solution100 [iU]/mLIntravenous; SubcutaneousNovo Nordisk2013-10-31Not applicableUs
NovologInjection, solution100 [iU]/mLIntravenous; SubcutaneousDispensing Solutions, Inc.2003-01-22Not applicableUs
NovologInjection, solution100 [iU]/mLIntravenous; SubcutaneousNovo Nordisk2003-01-22Not applicableUs
NovologInjection, solution100 [iU]/mLIntravenous; SubcutaneousNovo Nordisk2001-08-27Not applicableUs
Novolog Mix 70/30Injection, suspension100 [iU]/mLSubcutaneousNovo Nordisk2003-02-10Not applicableUs
Novolog Mix 70/30Injection, suspension100 [iU]/mLSubcutaneousNovo Nordisk2002-09-11Not applicableUs
Novomix 30 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 30 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 30 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 30 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 30 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 30 PenfillInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 30 PenfillInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 50 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 50 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 50 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 50 PenfillInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 50 PenfillInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 50 PenfillInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 70 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 70 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 70 FlexpenInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 70 PenfillInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 70 PenfillInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
Novomix 70 PenfillInjection, suspension100 U/mlSubcutaneousNovo Nordisk A/s2000-08-01Not applicableEu
NovorapidInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
NovorapidSolution100 unitSubcutaneousNovo Nordisk Canada Inc2012-05-04Not applicableCanada
NovorapidInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
NovorapidSolution100 unitSubcutaneousNovo Nordisk Canada Inc2001-10-31Not applicableCanada
NovorapidInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
NovorapidSolution100 unitSubcutaneousNovo Nordisk Canada Inc2002-06-12Not applicableCanada
Novorapid FlexpenInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlexpenInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlexpenInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlexpenInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlexpenInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlextouchInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlextouchInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlextouchInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlextouchInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid FlextouchInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid InnoletInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid InnoletInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid InnoletInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid PenfillInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid PenfillInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Novorapid PumpcartInjection, solution100 U/mlIntravenous; SubcutaneousNovo Nordisk A/s1999-09-07Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
Novolog FlexPenNovo Nordisk
Novolog PenfillNovo Nordisk
NovoRapid PenfillNovo Nordisk
Brand mixturesNot Available
SaltsNot Available
Categories
UNIID933668QVX
CAS number116094-23-6
Pharmacology
IndicationFor the treatment of Type 1 or 2 diabetes mellitus. Should normally be used in conjunction with an intermediate or long-acting insulin.
Structured Indications
PharmacodynamicsInsulin is a natural hormone produced by beta cells of the pancreas. In non-diabetic individuals, a basal level of insulin is supplemented with insulin spikes following meals. Postprandial insulin spikes are responsible for the metabolic changes that occur as the body transitions from a postabsorptive to absorptive state. Insulin promotes cellular uptake of glucose, particularly in muscle and adipose tissues, promotes energy storage via glycogenesis, opposes catabolism of energy stores, increases DNA replication and protein synthesis by stimulating amino acid uptake by liver, muscle and adipose tissue, and modifies the activity of numerous enzymes involved in glycogen synthesis and glycolysis. Insulin also promotes growth and is required for the actions of growth hormone (e.g. protein synthesis, cell division, DNA synthesis). Insulin aspart is a rapid-acting insulin analogue used to mimic postprandial insulin spikes in diabetic individuals. The onset of action of insulin aspart is 10-15 minutes. Its activity peaks 60-90 minutes following subcutaneous injection and its duration of action is 4-5 hours.
Mechanism of actionInsulin aspart binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor autophosphorylates and phosphorylates numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. Activation of these proteins leads to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC), both of which play critical roles in metabolism and catabolism. In humans, insulin is stored in the form of hexamers; however, only insulin monomers are able to interact with IR. Substitution of the proline residue at B28 with aspartic acid reduces the tendency to form hexamers and results in a faster rate of absorption and onset of action and shorter duration of action.
TargetKindPharmacological actionActionsOrganismUniProt ID
Insulin receptorProteinyes
agonist
HumanP06213 details
Related Articles
AbsorptionRapidly absorbed following subcutaneous administration (more so than regular human insulin). Furthermore, insulin aspart has a faster absorption, a faster onset of action, and a shorter duration of action than regular human insulin after subcutaneous injection. It takes 40 - 50 minutes to reach maximum concentration. When a dose of 0.15 U/kg body weight was injected in type 1 diabetes patients, the mean maximum concentration (Cmax) was 82 mU/L. The site of injection has no impact on extent or speed of absorption.
Volume of distributionNot Available
Protein binding<10% bound to plasma proteins.
MetabolismNot Available
Route of eliminationNot Available
Half life81 minutes (following subcutaneous administration in healthy subjects).
Clearance
  • 1.2 L/h/kg [healthy Caucasian male], excreted in the urine
ToxicityInappropriately high dosages relative to food intake and/or energy expenditure may result in severe and sometimes prolonged and life-threatening hypoglycemia. Neurogenic (autonomic) signs and symptoms of hypoglycemia include trembling, palpitations, sweating, anxiety, hunger, nausea and tingling. Neuroglycopenic signs and symptoms of hypoglycemia include difficulty concentrating, lethargy/weakness, confusion, drowsiness, vision changes, difficulty speaking, headache, and dizziness. Mild hypoglycemia is characterized by the presence of autonomic symptoms. Moderate hypoglycemia is characterized by the presence of autonomic and neuroglycopenic symptoms. Individuals may become unconscious in severe cases of hypoglycemia.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Insulin Aspart.Experimental
AcarboseAcarbose may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Insulin Aspart.Approved, Vet Approved
AicarAicar may increase the hypoglycemic activities of Insulin Aspart.Experimental
AlogliptinAlogliptin may increase the hypoglycemic activities of Insulin Aspart.Approved
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Insulin Aspart.Approved
AripiprazoleThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Atazanavir.Approved, Investigational
BalaglitazoneBalaglitazone may increase the hypoglycemic activities of Insulin Aspart.Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
BendroflumethiazideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
BetamethasoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BrexpiprazoleThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Brexpiprazole.Approved
BuforminBuformin may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
BumetanideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Buserelin.Approved
CanagliflozinCanagliflozin may increase the hypoglycemic activities of Insulin Aspart.Approved
CaroxazoneCaroxazone may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
CastanospermineCastanospermine may increase the hypoglycemic activities of Insulin Aspart.Experimental
CeritinibThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorpropamideChlorpropamide may increase the hypoglycemic activities of Insulin Aspart.Approved
ChlorthalidoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Chlorthalidone.Approved
CiglitazoneCiglitazone may increase the hypoglycemic activities of Insulin Aspart.Experimental
CinoxacinCinoxacin may increase the hypoglycemic activities of Insulin Aspart.Approved, Withdrawn
CiprofloxacinCiprofloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
CitalopramCitalopram may increase the hypoglycemic activities of Insulin Aspart.Approved
ClozapineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Cortisone acetate.Approved
Cyproterone acetateThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Insulin Aspart.Investigational
DarunavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Darunavir.Approved
DeoxyspergualinDeoxyspergualin may increase the hypoglycemic activities of Insulin Aspart.Investigational
dersalazinedersalazine may increase the hypoglycemic activities of Insulin Aspart.Investigational
DesogestrelThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Insulin Aspart.Approved
DexamethasoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DiazoxideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Diazoxide.Approved
DienogestThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Insulin Aspart.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Insulin Aspart.Illicit
DisopyramideDisopyramide may increase the hypoglycemic activities of Insulin Aspart.Approved
DrospirenoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Drospirenone.Approved
DulaglutideDulaglutide may increase the hypoglycemic activities of Insulin Aspart.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Insulin Aspart.Approved
EmpagliflozinEmpagliflozin may increase the hypoglycemic activities of Insulin Aspart.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Insulin Aspart.Approved
EpinephrineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
EstradiolThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Etacrynic acid.Approved
Ethinyl EstradiolThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Ethinyl Estradiol.Approved
Ethynodiol diacetateThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Insulin Aspart.Approved
EverolimusThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Everolimus.Approved
ExenatideExenatide may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
FleroxacinFleroxacin may increase the hypoglycemic activities of Insulin Aspart.Approved
FludrocortisoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Insulin Aspart.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Insulin Aspart.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Insulin Aspart.Approved, Vet Approved
FurosemideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Furosemide.Approved, Vet Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Insulin Aspart.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
GlibornurideGlibornuride may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
GliclazideGliclazide may increase the hypoglycemic activities of Insulin Aspart.Approved
GlimepirideGlimepiride may increase the hypoglycemic activities of Insulin Aspart.Approved
GlipizideGlipizide may increase the hypoglycemic activities of Insulin Aspart.Approved
GliquidoneGliquidone may increase the hypoglycemic activities of Insulin Aspart.Approved
GlyburideGlyburide may increase the hypoglycemic activities of Insulin Aspart.Approved
GoserelinThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
GusperimusGusperimus may increase the hypoglycemic activities of Insulin Aspart.Investigational
HistrelinThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Histrelin.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Insulin Aspart.Approved
HydrochlorothiazideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Hydroflumethiazide.Approved
Hydroxyprogesterone caproateThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
IloperidoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Insulin Aspart.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Indinavir.Approved
Insulin DetemirInsulin Aspart may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineInsulin Glargine may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin GlulisineInsulin Aspart may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanInsulin Human may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
Insulin LisproInsulin Lispro may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin PorkInsulin Pork may increase the hypoglycemic activities of Insulin Aspart.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Insulin Aspart.Approved
LanreotideInsulin Aspart may increase the hypoglycemic activities of Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Insulin Aspart.Approved
LevonorgestrelThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Levonorgestrel.Approved, Investigational
LinagliptinLinagliptin may increase the hypoglycemic activities of Insulin Aspart.Approved
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Insulin Aspart.Approved, Nutraceutical
LiraglutideLiraglutide may increase the hypoglycemic activities of Insulin Aspart.Approved
LomefloxacinLomefloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved
LopinavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Lurasidone.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
MecaserminMecasermin may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Insulin Aspart.Approved
MestranolThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Mestranol.Approved
MetforminMetformin may increase the hypoglycemic activities of Insulin Aspart.Approved
MethotrimeprazineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Methotrimeprazine.Approved
MethyclothiazideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Methyclothiazide.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Insulin Aspart.Investigational
MethylprednisoloneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Insulin Aspart.Approved
MetolazoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Metolazone.Approved
MifepristoneMifepristone may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
MiglitolMiglitol may increase the hypoglycemic activities of Insulin Aspart.Approved
MiglustatMiglustat may increase the hypoglycemic activities of Insulin Aspart.Approved
MilnacipranMilnacipran may increase the hypoglycemic activities of Insulin Aspart.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Insulin Aspart.Approved
MitiglinideMitiglinide may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
MoclobemideMoclobemide may increase the hypoglycemic activities of Insulin Aspart.Approved
MoxifloxacinMoxifloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Insulin Aspart.Approved
NateglinideNateglinide may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
NCX 4016NCX 4016 may increase the hypoglycemic activities of Insulin Aspart.Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Insulin Aspart.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Nelfinavir.Approved
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Insulin Aspart.Investigational
NiacinThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
NilotinibThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Nilotinib.Approved, Investigational
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Insulin Aspart.Investigational
NorethisteroneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved
NorgestimateThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Norgestimate.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
OctreotideOctreotide may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
OfloxacinOfloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved
OlanzapineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Insulin Aspart.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
OxymetholoneOxymetholone may increase the hypoglycemic activities of Insulin Aspart.Approved, Illicit
PaliperidoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Paliperidone.Approved
PargylinePargyline may increase the hypoglycemic activities of Insulin Aspart.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
PasireotideInsulin Aspart may increase the hypoglycemic activities of Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Insulin Aspart.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Insulin Aspart.Approved
PentamidinePentamidine may increase the hypoglycemic activities of Insulin Aspart.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Insulin Aspart.Approved
PhenforminPhenformin may increase the hypoglycemic activities of Insulin Aspart.Approved, Withdrawn
PheniprazinePheniprazine may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
PioglitazonePioglitazone may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
PiperazineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Pipotiazine.Approved
PirlindolePirlindole may increase the hypoglycemic activities of Insulin Aspart.Approved
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
PolythiazideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Polythiazide.Approved
PramlintidePramlintide may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
PrednisoloneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Prednisone.Approved, Vet Approved
ProgesteroneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Progesterone.Approved, Vet Approved
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Insulin Aspart.Investigational
QuetiapineThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Quinethazone.Approved
QuinineQuinine may increase the hypoglycemic activities of Insulin Aspart.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Insulin Aspart.Approved
RepaglinideRepaglinide may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
RisperidoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Ritonavir.Approved, Investigational
RosiglitazoneRosiglitazone may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Insulin Aspart.Approved
SafrazineSafrazine may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Insulin Aspart.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Saquinavir.Approved, Investigational
SaxagliptinSaxagliptin may increase the hypoglycemic activities of Insulin Aspart.Approved
SelegilineSelegiline may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Insulin Aspart.Approved
SirolimusThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Sirolimus.Approved, Investigational
SitagliptinSitagliptin may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved
StanozololStanozolol may increase the hypoglycemic activities of Insulin Aspart.Approved, Vet Approved
SulfadiazineSulfadiazine may increase the hypoglycemic activities of Insulin Aspart.Approved, Vet Approved
SulfamethoxazoleSulfamethoxazole may increase the hypoglycemic activities of Insulin Aspart.Approved
SulfisoxazoleSulfisoxazole may increase the hypoglycemic activities of Insulin Aspart.Approved, Vet Approved
SulodexideSulodexide may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
SunitinibSunitinib may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
TacrolimusThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Tacrolimus.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
TemsirolimusThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
ThiazolidinedioneThiazolidinedione may increase the hypoglycemic activities of Insulin Aspart.Investigational
TipranavirThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamideTolazamide may increase the hypoglycemic activities of Insulin Aspart.Approved
TolbutamideTolbutamide may increase the hypoglycemic activities of Insulin Aspart.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Insulin Aspart.Approved
TorasemideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Insulin Aspart.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Insulin Aspart.Approved
TriamcinoloneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TriptorelinThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Triptorelin.Approved, Vet Approved
TroglitazoneTroglitazone may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Insulin Aspart.Approved, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Insulin Aspart.Approved
VildagliptinVildagliptin may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
VogliboseVoglibose may increase the hypoglycemic activities of Insulin Aspart.Approved, Investigational
VorinostatThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Vorinostat.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Insulin Aspart.Withdrawn
ZiprasidoneThe therapeutic efficacy of Insulin Aspart can be decreased when used in combination with Ziprasidone.Approved
Food InteractionsNot Available
References
Synthesis Reference

Ronald E. Zimmerman, David John Stokell, Michael Patrick Akers, “ASPART PROINSULIN COMPOSITIONS AND METHODS OF PRODUCING ASPART INSULIN ANALOGS THEREFROM.” U.S. Patent US20120214963, issued August 23, 2012.

US20120214963
General References
  1. Heller S, Kurtzhals P, Verge D, Lindholm A: Insulin aspart: promising early results borne out in clinical practice. Expert Opin Pharmacother. 2002 Feb;3(2):183-95. [PubMed:11829732 ]
  2. Sciacca L, Cassarino MF, Genua M, Pandini G, Le Moli R, Squatrito S, Vigneri R: Insulin analogues differently activate insulin receptor isoforms and post-receptor signalling. Diabetologia. 2010 Aug;53(8):1743-53. doi: 10.1007/s00125-010-1760-6. Epub 2010 Apr 28. [PubMed:20424816 ]
External Links
ATC CodesA10AD06A10AB05A10AD05
AHFS Codes
  • 68:20.08
PDB EntriesNot Available
FDA labelDownload (909 KB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous; Subcutaneous100 [iU]/mL
Injection, suspensionSubcutaneous100 [iU]/mL
Injection, suspensionSubcutaneous100 U/ml
Injection, solutionIntravenous; Subcutaneous100 U/ml
SolutionSubcutaneous100 unit
Prices
Unit descriptionCostUnit
Novolog 100 unit/ml cartridge14.81USD ml
Novolog mix 70-30 cartridge10.45USD ml
Novorapid 100 unit/ml Cartridge3.89USD cartridge
Novorapid 100 unit/ml2.92USD cartridge
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5618913 No1994-06-072014-06-07Us
US5866538 Yes1997-12-202017-12-20Us
US6004297 Yes1999-07-282019-07-28Us
US6899699 No2002-01-022022-01-02Us
US7615532 No2005-05-252025-05-25Us
US7686786 No2006-08-032026-08-03Us
US8672898 No2002-01-022022-01-02Us
US8684969 No2005-10-202025-10-20Us
US8920383 No2006-07-172026-07-17Us
US9108002 No2006-01-202026-01-20Us
US9132239 No2012-02-012032-02-01Us
US9265893 No2012-09-232032-09-23Us
USRE41956 Yes2001-07-212021-07-21Us
USRE43834 No1999-01-282019-01-28Us
Properties
StateLiquid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor signaling protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 ...
Gene Name:
INSR
Uniprot ID:
P06213
Molecular Weight:
156331.465 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Zib I, Raskin P: Novel insulin analogues and its mitogenic potential. Diabetes Obes Metab. 2006 Nov;8(6):611-20. [PubMed:17026485 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inducer
General Function:
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function:
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N...
Gene Name:
CYP1A2
Uniprot ID:
P05177
Molecular Weight:
58293.76 Da
References
  1. Drug Interactions: Cytochrome P450 Drug Interaction Table [Link]
Comments
comments powered by Disqus
Drug created on June 30, 2007 08:44 / Updated on December 04, 2016 04:00