Identification

Name
Insulin Glulisine
Accession Number
DB01309
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones / Insulins
Description

Insulin glulisine is a biosynthetic, rapid-acting human insulin analogue produced in a non-pathogenic laboratory strain of Escherichia coli (K12). This recombinant hormone differs from native human insulin in that the amino acid arginine at position B3 is replaced by lysine and the lysine at position B29 is replaced by glutamic acid. These structural modifications decrease hexamer formation, stabilize insulin glulisine monomers and increase the rate of absorption and onset of action compared to human insulin.

Protein chemical formula
C258H384N64O78S6
Protein average weight
5823.0 Da
Sequences
>A chain
GIVEQCCTSICSLYQLENYCN
>B chain
FVKQHLCGSHLVEALYLVCGERGFFYTPET
Download FASTA Format
Synonyms
  • Insulin Glulisine (recombinant DNA origin)
  • Insulin glulisine recombinant
  • Insulina glulisina
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ApidraInjection, solution100 Units/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2004-09-27Not applicableEu
ApidraInjection, solution100 Units/mlSubcutaneousSanofi Aventis Deutschland Gmb H2004-09-27Not applicableEu
ApidraInjection, solution100 Units/mlSubcutaneousSanofi Aventis Deutschland Gmb H2004-09-27Not applicableEu
ApidraInjection, solution100 Units/mlIntravenous; SubcutaneousSanofi Aventis Deutschland Gmb H2004-09-27Not applicableEu
ApidraInjection, solution100 Units/mlSubcutaneousSanofi Aventis Deutschland Gmb H2004-09-27Not applicableEu
ApidraInjection, solution100 Units/mlSubcutaneousSanofi Aventis Deutschland Gmb H2004-09-27Not applicableEu
ApidraSolution100 unitSubcutaneousSanofi AventisNot applicableNot applicableCanada
ApidraSolution100 unitSubcutaneousSanofi Aventis2009-10-01Not applicableCanada
ApidraInjection, solution100 Units/mlSubcutaneousSanofi Aventis Deutschland Gmb H2004-09-27Not applicableEu
ApidraInjection, solution100 Units/mlSubcutaneousSanofi Aventis Deutschland Gmb H2004-09-27Not applicableEu
Categories
UNII
7XIY785AZD
CAS number
207748-29-6

Pharmacology

Indication

For the treatment of Type 1 and 2 diabetes mellitus. Should be used in regimens including a long-acting or basal insulin analogue unless it is used in a continuous infusion pump. May be used with oral antidiabetic agents.

Associated Conditions
Pharmacodynamics

Insulin is a natural hormone produced by beta cells of the pancreas. In non-diabetic individuals, a basal level of insulin is supplemented with insulin spikes following meals. Postprandial insulin spikes are responsible for the metabolic changes that occur as the body transitions from a postabsorptive to absorptive state. Insulin promotes cellular uptake of glucose, particularly in muscle and adipose tissues, promotes energy storage via glycogenesis, opposes catabolism of energy stores, increases DNA replication and protein synthesis by stimulating amino acid uptake by liver, muscle and adipose tissue, and modifies the activity of numerous enzymes involved in glycogen synthesis and glycolysis. Insulin also promotes growth and is required for the actions of growth hormone (e.g. protein synthesis, cell division, DNA synthesis). Insulin glulisine is a rapid-acting insulin analogue used to mimic postprandial insulin spikes in diabetic individuals. The onset of action of insulin glulisine is approximately 15 minutes. Its activity peaks 60 minutes following subcutaneous injection and its duration of action is 2-4 hours.

Mechanism of action

Insulin glulisine binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor autophosphorylates and phosphorylates numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. Activation of these proteins leads to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC), both of which play critical roles in metabolism and catabolism. In humans, insulin is stored in the form of hexamers; however, only insulin monomers are able to interact with IR. Substitution of the arginine at position B3 for lysine and replacement of the B29 lysine with glutamic acid decreases the propensity to form hexamers, stabilizes the hormone in monomeric form and results in a rapid rate of absorption and short duration of action.

TargetActionsOrganism
AInsulin receptor
agonist
Human
Absorption

Compared to regular human insulin, insulin glulisine is faster absorbed. When 0.15 units/kg was subcutaneously administered to type 1 diabetes patients, the pharmacokinetic parameters are as follows: Tmax = 60 minutes (range of 40 - 120 minutes); Cmax = 83 microUnits/mL (range of 40 - 131 microUnits/mL). Absolute bioavailability following subcutaneous administration is approximately 70%, regardless of site of injection.

Volume of distribution

13 L

Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

Elimination half life= 42 minutes (following subcutaneous injection)

Clearance
Not Available
Toxicity

Inappropriately high dosages relative to food intake and/or energy expenditure may result in severe and sometimes prolonged and life-threatening hypoglycemia. Neurogenic (autonomic) signs and symptoms of hypoglycemia include trembling, palpitations, sweating, anxiety, hunger, nausea and tingling. Neuroglycopenic signs and symptoms of hypoglycemia include difficulty concentrating, lethargy/weakness, confusion, drowsiness, vision changes, difficulty speaking, headache, and dizziness. Mild hypoglycemia is characterized by the presence of autonomic symptoms. Moderate hypoglycemia is characterized by the presence of autonomic and neuroglycopenic symptoms. Individuals may become unconscious in severe cases of hypoglycemia.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
2,4-thiazolidinedioneThe risk or severity of hypoglycemia can be increased when Insulin Glulisine is combined with 2,4-thiazolidinedione.
5-(2-methylpiperazine-1-sulfonyl)isoquinolineThe therapeutic efficacy of Insulin Glulisine can be increased when used in combination with 5-(2-methylpiperazine-1-sulfonyl)isoquinoline.
AcarboseThe risk or severity of hypoglycemia can be increased when Acarbose is combined with Insulin Glulisine.
AcebutololAcebutolol may increase the hypoglycemic activities of Insulin Glulisine.
AcetazolamideThe therapeutic efficacy of Insulin Glulisine can be increased when used in combination with Acetazolamide.
AcetohexamideThe risk or severity of hypoglycemia can be increased when Acetohexamide is combined with Insulin Glulisine.
Acetyl sulfisoxazoleThe therapeutic efficacy of Insulin Glulisine can be increased when used in combination with Acetyl sulfisoxazole.
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Insulin Glulisine.
AgmatineThe risk or severity of hypoglycemia can be increased when Agmatine is combined with Insulin Glulisine.
AICA ribonucleotideThe risk or severity of hypoglycemia can be increased when Insulin Glulisine is combined with AICA ribonucleotide.
Food Interactions
Not Available

References

General References
  1. Arnolds S, Rave K, Hovelmann U, Fischer A, Sert-Langeron C, Heise T: Insulin glulisine has a faster onset of action compared with insulin aspart in healthy volunteers. Exp Clin Endocrinol Diabetes. 2010 Oct;118(9):662-4. doi: 10.1055/s-0030-1252067. Epub 2010 Apr 28. [PubMed:20429049]
  2. Becker RH: Insulin glulisine complementing basal insulins: a review of structure and activity. Diabetes Technol Ther. 2007 Feb;9(1):109-21. [PubMed:17316105]
  3. Becker RH, Frick AD: Clinical pharmacokinetics and pharmacodynamics of insulin glulisine. Clin Pharmacokinet. 2008;47(1):7-20. [PubMed:18076215]
  4. Cox SL: Insulin glulisine. Drugs Today (Barc). 2005 Jul;41(7):433-40. [PubMed:16193096]
  5. Garnock-Jones KP, Plosker GL: Insulin glulisine: a review of its use in the management of diabetes mellitus. Drugs. 2009 May 29;69(8):1035-57. doi: 10.2165/00003495-200969080-00006. [PubMed:19496630]
  6. Horvath K, Bock G, Regittnig W, Bodenlenz M, Wutte A, Plank J, Magnes C, Sinner F, Furst-Recktenwald S, Theobald K, Pieber TR: Insulin glulisine, insulin lispro and regular human insulin show comparable end-organ metabolic effects: an exploratory study. Diabetes Obes Metab. 2008 Jun;10(6):484-91. Epub 2007 Aug 30. [PubMed:17764465]
  7. Authors unspecified: Insuline glusine (Apidra): a new rapid-acting insulin. Med Lett Drugs Ther. 2006 Apr 24;48(1233):33-4. [PubMed:16625142]
  8. Robinson DM, Wellington K: Insulin glulisine. Drugs. 2006;66(6):861-9. [PubMed:16706558]
  9. Ulrich H, Snyder B, Garg SK: Combining insulins for optimal blood glucose control in type I and 2 diabetes: focus on insulin glulisine. Vasc Health Risk Manag. 2007;3(3):245-54. [PubMed:17703632]
External Links
KEGG Drug
D04540
PubChem Substance
46504450
ChEMBL
CHEMBL1201613
Therapeutic Targets Database
DAP001093
PharmGKB
PA164760859
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
PDRhealth
PDRhealth Drug Page
ATC Codes
A10AB06 — Insulin glulisine
AHFS Codes
  • 68:20.08 — Insulins
FDA label
Download (1.67 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedNot AvailableHealthy Volunteers1
1CompletedBasic ScienceDiabetes Mellitus (DM)1
1CompletedTreatmentDiabetes Mellitus (DM)1
1CompletedTreatmentDiabetes Mellitus (DM) / Type 2 Diabetes Mellitus1
1CompletedTreatmentDiabetes, Diabetes Mellitus Type 13
1CompletedTreatmentType 2 Diabetes Mellitus2
1RecruitingTreatmentDown Syndrome (DS)1
1RecruitingTreatmentType1 Diabetes Mellitus1
2Active Not RecruitingTreatmentAlzheimer's Disease (AD) / Mild Cognitive Impairment (MCI)1
2CompletedTreatmentAlzheimer's Disease (AD)1
2CompletedTreatmentDiabetes During Pregnancy1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
2CompletedTreatmentType 2 Diabetes Mellitus1
3CompletedTreatmentCardiovascular Disease (CVD) / Hyperglycemias / Myocardial Infarction1
3CompletedTreatmentDiabetes Mellitus (DM)3
3CompletedTreatmentDiabetes Mellitus, Insulin-Dependent1
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
3CompletedTreatmentPoor Glycemic Control1
3CompletedTreatmentType 2 Diabetes Mellitus9
3CompletedTreatmentType I Diabetes1
3RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
3RecruitingTreatmentType 2 Diabetes Mellitus1
3TerminatedTreatmentAMI1
4Active Not RecruitingTreatmentType2 Diabetes1
4CompletedTreatmentDiabetes Mellitus (DM)1
4CompletedTreatmentDiabetes Mellitus (DM) / Diabetic Kidney Disease / Diabetic Nephropathies / Glucagon-Like Peptide 11
4CompletedTreatmentDiabetes Mellitus (DM) / Hyperglycemias1
4CompletedTreatmentDiabetes, Diabetes Mellitus Type 19
4CompletedTreatmentHyperglycemias / Type 2 Diabetes Mellitus1
4CompletedTreatmentImpaired Renal Function / Type 2 Diabetes Mellitus1
4CompletedTreatmentInpatient Hyperglycemia / Type 2 Diabetes Mellitus1
4CompletedTreatmentType 2 Diabetes Mellitus10
4Enrolling by InvitationTreatmentDiabetes, Diabetes Mellitus Type 1 / Lipoatrophy1
4RecruitingTreatmentDiabetes type11
4RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
4RecruitingTreatmentPatient With Type 2 Diabetes Treated With Insulin Using a Baseline/Bolus Strategy1
4RecruitingTreatmentType 2 Diabetes Mellitus2
4TerminatedTreatmentType 2 Diabetes Mellitus3
4Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
4Unknown StatusTreatmentInsulin-requiring Type 2 Diabetes Mellitus1
4Unknown StatusTreatmentLiver Cirrhosis / Type 2 Diabetes Mellitus1
4Unknown StatusTreatmentType 2 Diabetes Mellitus1
Not AvailableCompletedSupportive CareDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedTreatmentType 2 Diabetes Mellitus1
Not AvailableTerminatedTreatmentChronic Obstructive Pulmonary Disease (COPD) / Hyperglycemias1
Not AvailableUnknown StatusTreatmentDiabetes Mellitus (DM)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Sanofi-Aventis Inc.
Dosage forms
FormRouteStrength
Injection, solutionIntravenous; Subcutaneous100 Units/ml
Injection, solutionSubcutaneous100 [iU]/1mL
Injection, solutionSubcutaneous100 Units/ml
SolutionSubcutaneous100 unit
Prices
Unit descriptionCostUnit
Apidra 100 unit/ml cartridge13.3USD ml
Apidra 100 unit/ml Cartridge3.56USD cartridge
Apidra 100 unit/ml Syringe3.56USD syringe
Apidra 100 unit/ml2.67USD cartridge
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US9011391No2004-03-262024-03-26Us
US9233211No2004-03-022024-03-02Us
US8603044No2004-03-022024-03-02Us
US8512297No2004-09-152024-09-15Us
US8679069No2005-04-122025-04-12Us
US8992486No2004-06-052024-06-05Us
US8556864No2004-03-032024-03-03Us
US7918833Yes2008-03-232028-03-23Us
US6221633No1998-06-182018-06-18Us
US6960561No2003-01-252023-01-25Us
US7696162No2002-03-222022-03-22Us
US7452860No2002-03-222022-03-22Us
US9561331No2004-08-282024-08-28Us
US9623189No2004-08-192024-08-19Us
US9610409No2004-03-022024-03-02Us
US9526844No2004-03-022024-03-02Us
US9604008No2004-03-022024-03-02Us
US9533105No2004-08-172024-08-17Us
US9408979No2004-03-022024-03-02Us
US9604009No2004-08-162024-08-16Us
US9775954No2004-03-022024-03-02Us
US9827379No2004-03-022024-03-02Us
US9717852No2013-04-082033-04-08Us

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Receptor signaling protein tyrosine kinase activity
Specific Function
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (...
Gene Name
INSR
Uniprot ID
P06213
Uniprot Name
Insulin receptor
Molecular Weight
156331.465 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  2. Sciacca L, Cassarino MF, Genua M, Pandini G, Le Moli R, Squatrito S, Vigneri R: Insulin analogues differently activate insulin receptor isoforms and post-receptor signalling. Diabetologia. 2010 Aug;53(8):1743-53. doi: 10.1007/s00125-010-1760-6. Epub 2010 Apr 28. [PubMed:20424816]

Drug created on June 30, 2007 08:46 / Updated on November 13, 2018 07:57