Identification

Name
Sarilumab
Accession Number
DB11767
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Sarilumab is a fully human anti-IL-6R monoclonal IgG1 antibody that binds to both membrane bound and soluble interleukin 6 (IL-6) receptor forms, thus blocking the cis- and trans-inflammatory signalling cascades of IL-6 [1]. Sarilumab was developped by Sanofi and Regeneron Pharmaceuticals, Inc; it was US FDA-approved in May 2017 and followed by EU approval in June 2017 for the treatment of moderate to severe Rheumatoid Arthritis (RA) in combination with methotrexate [4]. RA is a chronic inflammatory disease characterized by polyarthritis and its treatment has been challenged by the different response in every patient [3]. Subcutaneous administration of Sarilumab has been shown to decrease acute-phase reactant levels and improve in clinical RA symptoms [2].

Protein structure
Db11767
Protein chemical formula
C6388H9918N1718O1998S44
Protein average weight
150000.0 Da (143900 Da in absence of N-glycosylation in heavy chains (Asn296) )
Sequences
> Heavy chain
EVQLVESGGGLVQPGRSLRLSCAASRFTFDDYAMHWVRQAPGKGLEWVSGISWNSGRIGY
ADSVKGRFTISRDNAENSLFLQMNGLRAEDTALYYCAKGRDSFDIWGQGTMVTVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK
>Light chain
DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYGASSLESGVPS
RFSGSGSGTDFTLTISSLQPEDFASYYCQQANSFPYTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • REGN88
  • SAR153191
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
KevzaraSolution150 mgSubcutaneousSanofi Aventis2017-03-29Not applicableCanada
KevzaraSolution200 mgSubcutaneousSanofi AventisNot applicableNot applicableCanada
KevzaraInjection, solution150 mg/1.14mLSubcutaneousSanofi Aventis2017-05-22Not applicableUs
KevzaraInjection, solution200 mg/1.14mLSubcutaneousSanofi Aventis2017-05-22Not applicableUs
KevzaraSolution150 mgSubcutaneousSanofi AventisNot applicableNot applicableCanada
KevzaraSolution200 mgSubcutaneousSanofi Aventis2017-02-08Not applicableCanada
KevzaraInjection, solution150 mg/1.14mLSubcutaneousSanofi Aventis2017-05-22Not applicableUs
KevzaraInjection, solution200 mg/1.14mLSubcutaneousSanofi Aventis2017-05-22Not applicableUs
Categories
UNII
NU90V55F8I
CAS number
1189541-98-7

Pharmacology

Indication

Indicated for modere to severe reactive RA in adult patients who are irresponsive, respond inadequately or present intolerance to disease-modifying anti-rheumatic drugs (DMARDs) or tumor necrosis factor (TNF) antagonists. It is indicated to be used in combination with methotrexate (MTX) or as a monotherapy when there is intolerance to MTX or MTX administration is inappropriate.

Associated Conditions
Pharmacodynamics

Single-dose subcutaneous administration of Sarilumab produced a rapid reduction of CRP levels, leading to normal levels after two weeks of treatment. Peak reduction in the absolute neutrophile count was observed after 3 to 4 days of treatment followed by a recovery to baseline levels. It is observed a decrease in fibrinogen and serum amyloid A as well as an increase in hemoglobin and serum albumin.

Mechanism of action

Sarilumab is a human recombinant IgG1 antibody that binds to both forms of interleukin 6 receptors (IL-6R), thus inhibiting the IL-6-mediated signaling. IL-6 is known to be a pleiotropic cytokine that activates immune cells (T and B cells), as well as hepatocytes for the release of acute phase proteins like CRP, serum amyloid A and fibrinogen which are biomarkers of RA activity. IL-6 is also found in synovial fluid and plays a major role in the pathological inflammation and joint destruction features of RA. Thus, it is used for the treatment of RA due to its ability to inhibit intra-articular and systemic IL-6 signaling [5, 6].

TargetActionsOrganism
AInterleukin-6 receptor subunit alpha
antagonist
antibody
Human
UHigh affinity immunoglobulin gamma Fc receptor I
unknown
Human
ULow affinity immunoglobulin gamma Fc region receptor II-a
unknown
Human
ULow affinity immunoglobulin gamma Fc region receptor II-b
unknown
Human
ULow affinity immunoglobulin gamma Fc region receptor III-A
unknown
Human
ULow affinity immunoglobulin gamma Fc region receptor III-B
unknown
Human
Absorption

Sarilumab is shown to be well absorbed in RA patients after single SC administration with a maximum of serum concentration presented after 2 to 4 days. For the 150 mg every two weeks dose regimen, the AUC, Cmin and Cmax of sarilumab were 202 ± 120 mg.day/L, 6.35 ± 7.54 mg/L, and 20.0 ± 9.20 mg/L, respectively. For the 200 mg every two weeks dose regimen, the AUC, Cmin and Cmax of sarilumab were 395 ± 207 mg.day/L, 16.5 ± 14.1 mg/L, and 35.6 ± 15.2 mg/L, respectively [6].

Volume of distribution

In patients with RA, the apparent volume of distribution at steady state was 7.3 L [6].

Protein binding

Sarilumab is a covalent heterotetramer composed by two disulfide linked heavy chains covelently linked to a kappa light chain. The heavy chain has a IgG1 constant region with a single N-linked glycosylation site in the Fc portion of the molecule. [6] The complimentarity-determining regions (CDRs) within variable domains of both light and heavy chains combine to form the binding site for IL-6R. As Sarilumab is an IgG1 molecule, it presents Fc-effector function and it is prompt to bind to FcγRI, FcγRIIa, FCγRIIb, FcγRIIIa and FcγRIIIB. However, it does not induce Antibody-Dependant Cell-mediated Cytotoxicity (ADCC) or Complement-Dependant Cytotoxicity (CDC) [5].

Metabolism

The metabolism of Sarilumab has not been characterized. As it is a monoclonal antibody, It is thought to be degraded into small peptides and amino acids [FDA file].

Route of elimination

At high concentrations, Sarilumab is thought to be eliminated predominantly through a non-saturated proteolytic pathway, while at lower concentrations, the elimination will be done by saturable target-mediated elimination [1].

Half life

The half life will depend on the administered concentration. At 200 mg every 2 weeks, half-life is up to 10 days in patients with RA at steady state. At 150 mg every 2 weeks, half-life is up to 8 days in patients with RA at steady state. After the last steady state dose of 150 mg and 200 mg, the time to reach nondetectable concentration is 28 and 43 days, respectively [5].

Clearance

Sarilumab is not eliminated via renal or hepatic pathways. RA patients have shown a trend toward higher clearance in presence of anti-sarilumab antibodies [FDA file].

Toxicity

Repeat dose exposure has been shown to produce a partially reversible decrease in neutophil count and a reversible decrease in fibrinogen [5].

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AbataceptSarilumab may increase the immunosuppressive activities of Abatacept.Approved
AbemaciclibThe therapeutic efficacy of Abemaciclib can be decreased when used in combination with Sarilumab.Approved, Investigational
AbirateroneThe therapeutic efficacy of Abiraterone can be decreased when used in combination with Sarilumab.Approved
AceclofenacSarilumab may increase the immunosuppressive activities of Aceclofenac.Approved, Investigational
AcemetacinSarilumab may increase the immunosuppressive activities of Acemetacin.Approved, Experimental, Investigational
AcenocoumarolThe therapeutic efficacy of Acenocoumarol can be decreased when used in combination with Sarilumab.Approved, Investigational
AcetaminophenThe therapeutic efficacy of Acetaminophen can be decreased when used in combination with Sarilumab.Approved
Acetylsalicylic acidSarilumab may increase the immunosuppressive activities of Acetylsalicylic acid.Approved, Vet Approved
AdalimumabSarilumab may increase the immunosuppressive activities of Adalimumab.Approved
AdapaleneSarilumab may increase the immunosuppressive activities of Adapalene.Approved
AdinazolamThe therapeutic efficacy of Adinazolam can be decreased when used in combination with Sarilumab.Approved
AlbendazoleThe therapeutic efficacy of Albendazole can be decreased when used in combination with Sarilumab.Approved, Vet Approved
AlclofenacSarilumab may increase the immunosuppressive activities of Alclofenac.Approved, Withdrawn
AlclometasoneThe therapeutic efficacy of Alclometasone can be decreased when used in combination with Sarilumab.Approved
AlfentanilThe therapeutic efficacy of Alfentanil can be decreased when used in combination with Sarilumab.Approved, Illicit
AlfuzosinThe therapeutic efficacy of Alfuzosin can be decreased when used in combination with Sarilumab.Approved, Investigational
AliskirenThe therapeutic efficacy of Aliskiren can be decreased when used in combination with Sarilumab.Approved, Investigational
AllopurinolSarilumab may increase the immunosuppressive activities of Allopurinol.Approved
AllylestrenolThe therapeutic efficacy of Allylestrenol can be decreased when used in combination with Sarilumab.Approved
AlminoprofenSarilumab may increase the immunosuppressive activities of Alminoprofen.Experimental
AlmotriptanThe therapeutic efficacy of Almotriptan can be decreased when used in combination with Sarilumab.Approved, Investigational
AlogliptinThe therapeutic efficacy of Alogliptin can be decreased when used in combination with Sarilumab.Approved
AlosetronThe therapeutic efficacy of Alosetron can be decreased when used in combination with Sarilumab.Approved, Withdrawn
alpha-Tocopherol acetateThe therapeutic efficacy of alpha-Tocopherol acetate can be decreased when used in combination with Sarilumab.Approved
AlprazolamThe therapeutic efficacy of Alprazolam can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational
AmbrisentanThe therapeutic efficacy of Ambrisentan can be decreased when used in combination with Sarilumab.Approved, Investigational
AmbroxolThe therapeutic efficacy of Ambroxol can be decreased when used in combination with Sarilumab.Approved, Investigational
AminophenazoneThe therapeutic efficacy of Aminophenazone can be decreased when used in combination with Sarilumab.Approved, Withdrawn
AminophyllineThe therapeutic efficacy of Aminophylline can be decreased when used in combination with Sarilumab.Approved
AmiodaroneThe therapeutic efficacy of Amiodarone can be decreased when used in combination with Sarilumab.Approved, Investigational
AmitriptylineThe therapeutic efficacy of Amitriptyline can be decreased when used in combination with Sarilumab.Approved
AmlodipineThe therapeutic efficacy of Amlodipine can be decreased when used in combination with Sarilumab.Approved
AmprenavirThe therapeutic efficacy of Amprenavir can be decreased when used in combination with Sarilumab.Approved, Investigational
AnakinraSarilumab may increase the immunosuppressive activities of Anakinra.Approved
AndrographolideSarilumab may increase the immunosuppressive activities of Andrographolide.Investigational
AnisodamineSarilumab may increase the immunosuppressive activities of Anisodamine.Investigational
Anthrax immune globulin humanThe risk or severity of infection can be increased when Sarilumab is combined with Anthrax immune globulin human.Approved
AntipyrineSarilumab may increase the immunosuppressive activities of Antipyrine.Approved, Investigational
ApalutamideThe therapeutic efficacy of Apalutamide can be decreased when used in combination with Sarilumab.Approved, Investigational
ApixabanThe therapeutic efficacy of Apixaban can be decreased when used in combination with Sarilumab.Approved
ApocyninSarilumab may increase the immunosuppressive activities of Apocynin.Investigational
ApremilastSarilumab may increase the immunosuppressive activities of Apremilast.Approved, Investigational
AprepitantThe therapeutic efficacy of Aprepitant can be decreased when used in combination with Sarilumab.Approved, Investigational
ArgatrobanThe therapeutic efficacy of Argatroban can be decreased when used in combination with Sarilumab.Approved, Investigational
AripiprazoleThe therapeutic efficacy of Aripiprazole can be decreased when used in combination with Sarilumab.Approved, Investigational
ArtemetherThe therapeutic efficacy of Artemether can be decreased when used in combination with Sarilumab.Approved
AsenapineThe therapeutic efficacy of Asenapine can be decreased when used in combination with Sarilumab.Approved
AstemizoleThe therapeutic efficacy of Astemizole can be decreased when used in combination with Sarilumab.Approved, Withdrawn
AsunaprevirThe serum concentration of Asunaprevir can be increased when it is combined with Sarilumab.Approved, Investigational, Withdrawn
AtazanavirThe therapeutic efficacy of Atazanavir can be decreased when used in combination with Sarilumab.Approved, Investigational
AtorvastatinThe risk or severity of adverse effects can be increased when Sarilumab is combined with Atorvastatin.Approved
AuranofinSarilumab may increase the immunosuppressive activities of Auranofin.Approved, Investigational
AurothioglucoseSarilumab may increase the immunosuppressive activities of Aurothioglucose.Approved, Withdrawn
AurotioprolSarilumab may increase the immunosuppressive activities of Aurotioprol.Experimental
AvanafilThe therapeutic efficacy of Avanafil can be decreased when used in combination with Sarilumab.Approved
AvatrombopagThe therapeutic efficacy of Avatrombopag can be decreased when used in combination with Sarilumab.Approved, Investigational
AxitinibThe therapeutic efficacy of Axitinib can be decreased when used in combination with Sarilumab.Approved, Investigational
AzapropazoneSarilumab may increase the immunosuppressive activities of Azapropazone.Withdrawn
AzathioprineSarilumab may increase the immunosuppressive activities of Azathioprine.Approved
AzelastineThe therapeutic efficacy of Azelastine can be decreased when used in combination with Sarilumab.Approved
AzithromycinThe therapeutic efficacy of Azithromycin can be decreased when used in combination with Sarilumab.Approved
Bacillus calmette-guerin substrain connaught live antigenThe risk or severity of infection can be increased when Sarilumab is combined with Bacillus calmette-guerin substrain connaught live antigen.Approved, Investigational
Bacillus calmette-guerin substrain tice live antigenThe risk or severity of infection can be increased when Sarilumab is combined with Bacillus calmette-guerin substrain tice live antigen.Approved
BalsalazideSarilumab may increase the immunosuppressive activities of Balsalazide.Approved, Investigational
BanoxantroneThe therapeutic efficacy of Banoxantrone can be decreased when used in combination with Sarilumab.Investigational
BaricitinibThe therapeutic efficacy of Baricitinib can be decreased when used in combination with Sarilumab.Approved, Investigational
BCG vaccineThe risk or severity of infection can be increased when Sarilumab is combined with BCG vaccine.Investigational
BedaquilineThe therapeutic efficacy of Bedaquiline can be decreased when used in combination with Sarilumab.Approved
BelataceptSarilumab may increase the immunosuppressive activities of Belatacept.Approved, Investigational
BelimumabThe risk or severity of adverse effects can be increased when Sarilumab is combined with Belimumab.Approved
BendazacSarilumab may increase the immunosuppressive activities of Bendazac.Experimental
BenidipineThe therapeutic efficacy of Benidipine can be decreased when used in combination with Sarilumab.Approved, Investigational
BenorilateSarilumab may increase the immunosuppressive activities of Benorilate.Experimental
BenoxaprofenSarilumab may increase the immunosuppressive activities of Benoxaprofen.Withdrawn
BenzbromaroneSarilumab may increase the immunosuppressive activities of Benzbromarone.Investigational, Withdrawn
BenziodaroneSarilumab may increase the immunosuppressive activities of Benziodarone.Experimental
BenzphetamineThe therapeutic efficacy of Benzphetamine can be decreased when used in combination with Sarilumab.Approved, Illicit
Benzyl alcoholThe therapeutic efficacy of Benzyl alcohol can be decreased when used in combination with Sarilumab.Approved
BevoniumSarilumab may increase the immunosuppressive activities of Bevonium.Experimental
BexaroteneThe therapeutic efficacy of Bexarotene can be decreased when used in combination with Sarilumab.Approved, Investigational
BezafibrateThe therapeutic efficacy of Bezafibrate can be decreased when used in combination with Sarilumab.Approved, Investigational
BicalutamideThe therapeutic efficacy of Bicalutamide can be decreased when used in combination with Sarilumab.Approved
BictegravirThe therapeutic efficacy of Bictegravir can be decreased when used in combination with Sarilumab.Approved, Investigational
BinetrakinSarilumab may increase the immunosuppressive activities of Binetrakin.Investigational
BioallethrinThe therapeutic efficacy of Bioallethrin can be decreased when used in combination with Sarilumab.Approved, Experimental
BisoprololThe therapeutic efficacy of Bisoprolol can be decreased when used in combination with Sarilumab.Approved
BlonanserinThe therapeutic efficacy of Blonanserin can be decreased when used in combination with Sarilumab.Approved, Investigational
BoceprevirThe therapeutic efficacy of Boceprevir can be decreased when used in combination with Sarilumab.Approved, Withdrawn
Borage oilSarilumab may increase the immunosuppressive activities of Borage oil.Approved, Investigational
BortezomibThe therapeutic efficacy of Bortezomib can be decreased when used in combination with Sarilumab.Approved, Investigational
BosentanThe therapeutic efficacy of Bosentan can be decreased when used in combination with Sarilumab.Approved, Investigational
BosutinibThe serum concentration of Bosutinib can be increased when it is combined with Sarilumab.Approved
Brentuximab vedotinThe therapeutic efficacy of Brentuximab vedotin can be decreased when used in combination with Sarilumab.Approved, Investigational
BrexpiprazoleThe therapeutic efficacy of Brexpiprazole can be decreased when used in combination with Sarilumab.Approved, Investigational
BrigatinibThe therapeutic efficacy of Brigatinib can be decreased when used in combination with Sarilumab.Approved, Investigational
BrinzolamideThe therapeutic efficacy of Brinzolamide can be decreased when used in combination with Sarilumab.Approved
BrivaracetamThe therapeutic efficacy of Brivaracetam can be decreased when used in combination with Sarilumab.Approved, Investigational
BromazepamThe therapeutic efficacy of Bromazepam can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational
BromfenacSarilumab may increase the immunosuppressive activities of Bromfenac.Approved
BromocriptineThe therapeutic efficacy of Bromocriptine can be decreased when used in combination with Sarilumab.Approved, Investigational
BrompheniramineThe therapeutic efficacy of Brompheniramine can be decreased when used in combination with Sarilumab.Approved
BucillamineSarilumab may increase the immunosuppressive activities of Bucillamine.Investigational
BudesonideThe therapeutic efficacy of Budesonide can be decreased when used in combination with Sarilumab.Approved
BufexamacSarilumab may increase the immunosuppressive activities of Bufexamac.Approved, Experimental
BumadizoneSarilumab may increase the immunosuppressive activities of Bumadizone.Experimental
BupivacaineThe therapeutic efficacy of Bupivacaine can be decreased when used in combination with Sarilumab.Approved, Investigational
BuprenorphineThe therapeutic efficacy of Buprenorphine can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational, Vet Approved
BupropionThe therapeutic efficacy of Bupropion can be decreased when used in combination with Sarilumab.Approved
BuspironeThe therapeutic efficacy of Buspirone can be decreased when used in combination with Sarilumab.Approved, Investigational
BusulfanThe therapeutic efficacy of Busulfan can be decreased when used in combination with Sarilumab.Approved, Investigational
CabazitaxelThe therapeutic efficacy of Cabazitaxel can be decreased when used in combination with Sarilumab.Approved
CabergolineThe therapeutic efficacy of Cabergoline can be decreased when used in combination with Sarilumab.Approved
CabozantinibThe therapeutic efficacy of Cabozantinib can be decreased when used in combination with Sarilumab.Approved, Investigational
CaffeineThe therapeutic efficacy of Caffeine can be decreased when used in combination with Sarilumab.Approved
CalcitriolThe therapeutic efficacy of Calcitriol can be decreased when used in combination with Sarilumab.Approved, Nutraceutical
CanagliflozinThe therapeutic efficacy of Canagliflozin can be decreased when used in combination with Sarilumab.Approved
CannabidiolThe therapeutic efficacy of Cannabidiol can be decreased when used in combination with Sarilumab.Approved, Investigational
CarbamazepineThe therapeutic efficacy of Carbamazepine can be decreased when used in combination with Sarilumab.Approved, Investigational
Carbaspirin calciumSarilumab may increase the immunosuppressive activities of Carbaspirin calcium.Experimental, Investigational
CarbinoxamineThe therapeutic efficacy of Carbinoxamine can be decreased when used in combination with Sarilumab.Approved
CariprazineThe therapeutic efficacy of Cariprazine can be decreased when used in combination with Sarilumab.Approved, Investigational
CarprofenSarilumab may increase the immunosuppressive activities of Carprofen.Approved, Vet Approved, Withdrawn
CarvedilolThe therapeutic efficacy of Carvedilol can be decreased when used in combination with Sarilumab.Approved, Investigational
CastanospermineSarilumab may increase the immunosuppressive activities of Castanospermine.Experimental
CelecoxibSarilumab may increase the immunosuppressive activities of Celecoxib.Approved, Investigational
CeliprololThe therapeutic efficacy of Celiprolol can be decreased when used in combination with Sarilumab.Approved, Investigational
CephalexinThe therapeutic efficacy of Cephalexin can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
CerivastatinThe therapeutic efficacy of Cerivastatin can be decreased when used in combination with Sarilumab.Approved, Withdrawn
Certolizumab pegolSarilumab may increase the immunosuppressive activities of Certolizumab pegol.Approved
CevimelineThe therapeutic efficacy of Cevimeline can be decreased when used in combination with Sarilumab.Approved
Chenodeoxycholic acidThe therapeutic efficacy of Chenodeoxycholic acid can be decreased when used in combination with Sarilumab.Approved
ChlordiazepoxideThe therapeutic efficacy of Chlordiazepoxide can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational
ChloroquineSarilumab may increase the immunosuppressive activities of Chloroquine.Approved, Investigational, Vet Approved
ChlorphenamineThe therapeutic efficacy of Chlorphenamine can be decreased when used in combination with Sarilumab.Approved
ChlorpromazineThe therapeutic efficacy of Chlorpromazine can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
ChlorzoxazoneThe therapeutic efficacy of Chlorzoxazone can be decreased when used in combination with Sarilumab.Approved
CholecalciferolThe therapeutic efficacy of Cholecalciferol can be decreased when used in combination with Sarilumab.Approved, Nutraceutical
Choline magnesium trisalicylateSarilumab may increase the immunosuppressive activities of Choline magnesium trisalicylate.Approved
CiclesonideThe therapeutic efficacy of Ciclesonide can be decreased when used in combination with Sarilumab.Approved, Investigational
CilostazolThe therapeutic efficacy of Cilostazol can be decreased when used in combination with Sarilumab.Approved, Investigational
CinacalcetThe therapeutic efficacy of Cinacalcet can be decreased when used in combination with Sarilumab.Approved
CisaprideThe therapeutic efficacy of Cisapride can be decreased when used in combination with Sarilumab.Approved, Investigational, Withdrawn
CitalopramThe therapeutic efficacy of Citalopram can be decreased when used in combination with Sarilumab.Approved
ClarithromycinThe therapeutic efficacy of Clarithromycin can be decreased when used in combination with Sarilumab.Approved
ClindamycinThe therapeutic efficacy of Clindamycin can be decreased when used in combination with Sarilumab.Approved, Vet Approved
ClobazamThe therapeutic efficacy of Clobazam can be decreased when used in combination with Sarilumab.Approved, Illicit
ClofazimineThe therapeutic efficacy of Clofazimine can be decreased when used in combination with Sarilumab.Approved, Investigational
ClofibrateThe therapeutic efficacy of Clofibrate can be decreased when used in combination with Sarilumab.Approved, Investigational
clomethiazoleThe therapeutic efficacy of clomethiazole can be decreased when used in combination with Sarilumab.Investigational
ClomipramineThe therapeutic efficacy of Clomipramine can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
ClonazepamThe therapeutic efficacy of Clonazepam can be decreased when used in combination with Sarilumab.Approved, Illicit
ClonidineThe therapeutic efficacy of Clonidine can be decreased when used in combination with Sarilumab.Approved
ClonixinSarilumab may increase the immunosuppressive activities of Clonixin.Approved
ClopidogrelThe therapeutic efficacy of Clopidogrel can be decreased when used in combination with Sarilumab.Approved
ClorazepateThe therapeutic efficacy of Clorazepate can be decreased when used in combination with Sarilumab.Approved, Illicit
Clostridium tetani toxoid antigen (formaldehyde inactivated)The risk or severity of infection can be increased when Sarilumab is combined with Clostridium tetani toxoid antigen (formaldehyde inactivated).Approved
ClotiazepamThe therapeutic efficacy of Clotiazepam can be decreased when used in combination with Sarilumab.Approved, Illicit
ClozapineThe therapeutic efficacy of Clozapine can be decreased when used in combination with Sarilumab.Approved
CocaineThe therapeutic efficacy of Cocaine can be decreased when used in combination with Sarilumab.Approved, Illicit
CodeineThe therapeutic efficacy of Codeine can be decreased when used in combination with Sarilumab.Approved, Illicit
ColchicineSarilumab may increase the immunosuppressive activities of Colchicine.Approved
ConivaptanThe therapeutic efficacy of Conivaptan can be decreased when used in combination with Sarilumab.Approved, Investigational
Conjugated estrogensThe therapeutic efficacy of Conjugated estrogens can be decreased when used in combination with Sarilumab.Approved
CopanlisibThe therapeutic efficacy of Copanlisib can be decreased when used in combination with Sarilumab.Approved, Investigational
Cortisone acetateThe therapeutic efficacy of Cortisone acetate can be decreased when used in combination with Sarilumab.Approved, Investigational
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The risk or severity of infection can be increased when Sarilumab is combined with Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated).Approved
CrizotinibThe therapeutic efficacy of Crizotinib can be decreased when used in combination with Sarilumab.Approved
CurcuminSarilumab may increase the immunosuppressive activities of Curcumin.Approved, Investigational
CyclobenzaprineThe therapeutic efficacy of Cyclobenzaprine can be decreased when used in combination with Sarilumab.Approved
CyclophosphamideSarilumab may increase the immunosuppressive activities of Cyclophosphamide.Approved, Investigational
CyclosporineSarilumab may increase the immunosuppressive activities of Cyclosporine.Approved, Investigational, Vet Approved
CytarabineThe therapeutic efficacy of Cytarabine can be decreased when used in combination with Sarilumab.Approved, Investigational
DabrafenibThe therapeutic efficacy of Dabrafenib can be decreased when used in combination with Sarilumab.Approved, Investigational
DaclatasvirThe therapeutic efficacy of Daclatasvir can be decreased when used in combination with Sarilumab.Approved, Investigational
DantroleneThe therapeutic efficacy of Dantrolene can be decreased when used in combination with Sarilumab.Approved, Investigational
DapagliflozinThe therapeutic efficacy of Dapagliflozin can be decreased when used in combination with Sarilumab.Approved
DapsoneThe therapeutic efficacy of Dapsone can be decreased when used in combination with Sarilumab.Approved, Investigational
DarifenacinThe therapeutic efficacy of Darifenacin can be decreased when used in combination with Sarilumab.Approved, Investigational
DarunavirThe therapeutic efficacy of Darunavir can be decreased when used in combination with Sarilumab.Approved
DasabuvirThe therapeutic efficacy of Dasabuvir can be decreased when used in combination with Sarilumab.Approved
DasatinibThe therapeutic efficacy of Dasatinib can be decreased when used in combination with Sarilumab.Approved, Investigational
DaunorubicinThe therapeutic efficacy of Daunorubicin can be decreased when used in combination with Sarilumab.Approved
DeflazacortThe therapeutic efficacy of Deflazacort can be decreased when used in combination with Sarilumab.Approved, Investigational
DelamanidThe therapeutic efficacy of Delamanid can be decreased when used in combination with Sarilumab.Approved, Investigational
DelavirdineThe therapeutic efficacy of Delavirdine can be decreased when used in combination with Sarilumab.Approved
DesvenlafaxineThe therapeutic efficacy of Desvenlafaxine can be decreased when used in combination with Sarilumab.Approved, Investigational
DeutetrabenazineThe therapeutic efficacy of Deutetrabenazine can be decreased when used in combination with Sarilumab.Approved, Investigational
DexamethasoneThe therapeutic efficacy of Dexamethasone can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
Dexchlorpheniramine maleateThe therapeutic efficacy of Dexchlorpheniramine maleate can be decreased when used in combination with Sarilumab.Approved
DexlansoprazoleThe therapeutic efficacy of Dexlansoprazole can be decreased when used in combination with Sarilumab.Approved, Investigational
DextromethorphanThe therapeutic efficacy of Dextromethorphan can be decreased when used in combination with Sarilumab.Approved
DextropropoxypheneThe therapeutic efficacy of Dextropropoxyphene can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational, Withdrawn
DiazepamThe therapeutic efficacy of Diazepam can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational, Vet Approved
DiclofenacSarilumab may increase the immunosuppressive activities of Diclofenac.Approved, Vet Approved
DienogestThe therapeutic efficacy of Dienogest can be decreased when used in combination with Sarilumab.Approved
DifenpiramideSarilumab may increase the immunosuppressive activities of Difenpiramide.Experimental
DiflunisalSarilumab may increase the immunosuppressive activities of Diflunisal.Approved, Investigational
DigitoxinThe therapeutic efficacy of Digitoxin can be decreased when used in combination with Sarilumab.Approved, Investigational
DigoxinThe therapeutic efficacy of Digoxin can be decreased when used in combination with Sarilumab.Approved
Dihydro-alpha-ergocryptineThe therapeutic efficacy of Dihydro-alpha-ergocryptine can be decreased when used in combination with Sarilumab.Approved
DihydrocodeineThe therapeutic efficacy of Dihydrocodeine can be decreased when used in combination with Sarilumab.Approved, Illicit
DihydroergocornineThe risk or severity of adverse effects can be increased when Dihydroergocornine is combined with Sarilumab.Approved
DihydroergocristineThe risk or severity of adverse effects can be increased when Dihydroergocristine is combined with Sarilumab.Approved, Experimental
DihydroergocryptineThe risk or severity of adverse effects can be increased when Dihydroergocryptine is combined with Sarilumab.Experimental
DihydroergotamineThe therapeutic efficacy of Dihydroergotamine can be decreased when used in combination with Sarilumab.Approved, Investigational
DiltiazemThe therapeutic efficacy of Diltiazem can be decreased when used in combination with Sarilumab.Approved, Investigational
DisopyramideThe therapeutic efficacy of Disopyramide can be decreased when used in combination with Sarilumab.Approved
DisulfiramThe therapeutic efficacy of Disulfiram can be decreased when used in combination with Sarilumab.Approved
DocetaxelThe therapeutic efficacy of Docetaxel can be decreased when used in combination with Sarilumab.Approved, Investigational
DofetilideThe therapeutic efficacy of Dofetilide can be decreased when used in combination with Sarilumab.Approved, Investigational
DolasetronThe therapeutic efficacy of Dolasetron can be decreased when used in combination with Sarilumab.Approved, Investigational
DomperidoneThe therapeutic efficacy of Domperidone can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
DonepezilThe therapeutic efficacy of Donepezil can be decreased when used in combination with Sarilumab.Approved
DorzolamideThe therapeutic efficacy of Dorzolamide can be decreased when used in combination with Sarilumab.Approved
DoxepinThe therapeutic efficacy of Doxepin can be decreased when used in combination with Sarilumab.Approved, Investigational
DoxorubicinThe therapeutic efficacy of Doxorubicin can be decreased when used in combination with Sarilumab.Approved, Investigational
DronabinolThe therapeutic efficacy of Dronabinol can be decreased when used in combination with Sarilumab.Approved, Illicit
DronedaroneThe therapeutic efficacy of Dronedarone can be decreased when used in combination with Sarilumab.Approved
DroxicamSarilumab may increase the immunosuppressive activities of Droxicam.Withdrawn
DutasterideThe therapeutic efficacy of Dutasteride can be decreased when used in combination with Sarilumab.Approved, Investigational
EfavirenzThe therapeutic efficacy of Efavirenz can be decreased when used in combination with Sarilumab.Approved, Investigational
ElbasvirThe therapeutic efficacy of Elbasvir can be decreased when used in combination with Sarilumab.Approved
EletriptanThe therapeutic efficacy of Eletriptan can be decreased when used in combination with Sarilumab.Approved, Investigational
EliglustatThe therapeutic efficacy of Eliglustat can be decreased when used in combination with Sarilumab.Approved
ElvitegravirThe therapeutic efficacy of Elvitegravir can be decreased when used in combination with Sarilumab.Approved
EnalaprilThe therapeutic efficacy of Enalapril can be decreased when used in combination with Sarilumab.Approved, Vet Approved
EnasidenibThe therapeutic efficacy of Enasidenib can be decreased when used in combination with Sarilumab.Approved, Investigational
EnzalutamideThe therapeutic efficacy of Enzalutamide can be decreased when used in combination with Sarilumab.Approved
EpinastineThe therapeutic efficacy of Epinastine can be decreased when used in combination with Sarilumab.Approved, Investigational
EpirizoleSarilumab may increase the immunosuppressive activities of Epirizole.Approved
EplerenoneThe therapeutic efficacy of Eplerenone can be decreased when used in combination with Sarilumab.Approved
ErgocalciferolThe therapeutic efficacy of Ergocalciferol can be decreased when used in combination with Sarilumab.Approved, Nutraceutical
Ergoloid mesylateThe therapeutic efficacy of Ergoloid mesylate can be decreased when used in combination with Sarilumab.Approved
ErgonovineThe therapeutic efficacy of Ergonovine can be decreased when used in combination with Sarilumab.Approved
ErgotamineThe therapeutic efficacy of Ergotamine can be decreased when used in combination with Sarilumab.Approved
ErlotinibThe therapeutic efficacy of Erlotinib can be decreased when used in combination with Sarilumab.Approved, Investigational
ErythromycinThe therapeutic efficacy of Erythromycin can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
EscitalopramThe therapeutic efficacy of Escitalopram can be decreased when used in combination with Sarilumab.Approved, Investigational
EsomeprazoleThe therapeutic efficacy of Esomeprazole can be decreased when used in combination with Sarilumab.Approved, Investigational
EstazolamThe therapeutic efficacy of Estazolam can be decreased when used in combination with Sarilumab.Approved, Illicit
EstradiolThe therapeutic efficacy of Estradiol can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
Estradiol acetateThe therapeutic efficacy of Estradiol acetate can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
Estradiol benzoateThe therapeutic efficacy of Estradiol benzoate can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
Estradiol cypionateThe therapeutic efficacy of Estradiol cypionate can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
Estradiol dienanthateThe therapeutic efficacy of Estradiol dienanthate can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
Estradiol valerateThe therapeutic efficacy of Estradiol valerate can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
EstramustineThe therapeutic efficacy of Estramustine can be decreased when used in combination with Sarilumab.Approved, Investigational
Estrogens, esterifiedThe therapeutic efficacy of Estrogens, esterified can be decreased when used in combination with Sarilumab.Approved
EstroneThe therapeutic efficacy of Estrone can be decreased when used in combination with Sarilumab.Approved
Estrone sulfateThe therapeutic efficacy of Estrone sulfate can be decreased when used in combination with Sarilumab.Approved
EszopicloneThe therapeutic efficacy of Eszopiclone can be decreased when used in combination with Sarilumab.Approved, Investigational
EtanerceptSarilumab may increase the immunosuppressive activities of Etanercept.Approved, Investigational
EthanolThe therapeutic efficacy of Ethanol can be decreased when used in combination with Sarilumab.Approved
EthenzamideSarilumab may increase the immunosuppressive activities of Ethenzamide.Experimental
Ethinyl EstradiolThe therapeutic efficacy of Ethinyl Estradiol can be decreased when used in combination with Sarilumab.Approved
EthosuximideThe therapeutic efficacy of Ethosuximide can be decreased when used in combination with Sarilumab.Approved
EthylmorphineThe therapeutic efficacy of Ethylmorphine can be decreased when used in combination with Sarilumab.Approved, Illicit
EtizolamThe therapeutic efficacy of Etizolam can be decreased when used in combination with Sarilumab.Approved
EtodolacSarilumab may increase the immunosuppressive activities of Etodolac.Approved, Investigational, Vet Approved
EtofenamateSarilumab may increase the immunosuppressive activities of Etofenamate.Approved, Investigational
EtonogestrelThe therapeutic efficacy of Etonogestrel can be decreased when used in combination with Sarilumab.Approved, Investigational
EtoposideThe therapeutic efficacy of Etoposide can be decreased when used in combination with Sarilumab.Approved
EtoricoxibSarilumab may increase the immunosuppressive activities of Etoricoxib.Approved, Investigational
EtravirineThe therapeutic efficacy of Etravirine can be decreased when used in combination with Sarilumab.Approved
Evening primrose oilSarilumab may increase the immunosuppressive activities of Evening primrose oil.Investigational, Nutraceutical
EverolimusThe therapeutic efficacy of Everolimus can be decreased when used in combination with Sarilumab.Approved
ExemestaneThe therapeutic efficacy of Exemestane can be decreased when used in combination with Sarilumab.Approved, Investigational
ExisulindSarilumab may increase the immunosuppressive activities of Exisulind.Investigational
FamciclovirThe therapeutic efficacy of Famciclovir can be decreased when used in combination with Sarilumab.Approved, Investigational
FebuxostatSarilumab may increase the immunosuppressive activities of Febuxostat.Approved
FelbamateThe therapeutic efficacy of Felbamate can be decreased when used in combination with Sarilumab.Approved
FelbinacSarilumab may increase the immunosuppressive activities of Felbinac.Experimental
FelodipineThe therapeutic efficacy of Felodipine can be decreased when used in combination with Sarilumab.Approved, Investigational
FenbufenSarilumab may increase the immunosuppressive activities of Fenbufen.Approved
FenofibrateThe therapeutic efficacy of Fenofibrate can be decreased when used in combination with Sarilumab.Approved
FenoprofenSarilumab may increase the immunosuppressive activities of Fenoprofen.Approved
FentanylThe therapeutic efficacy of Fentanyl can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational, Vet Approved
FentiazacSarilumab may increase the immunosuppressive activities of Fentiazac.Experimental
FeprazoneSarilumab may increase the immunosuppressive activities of Feprazone.Experimental
Ferulic acidSarilumab may increase the immunosuppressive activities of Ferulic acid.Experimental
FesoterodineThe therapeutic efficacy of Fesoterodine can be decreased when used in combination with Sarilumab.Approved
FinasterideThe therapeutic efficacy of Finasteride can be decreased when used in combination with Sarilumab.Approved
FingolimodThe therapeutic efficacy of Fingolimod can be decreased when used in combination with Sarilumab.Approved, Investigational
FlibanserinThe therapeutic efficacy of Flibanserin can be decreased when used in combination with Sarilumab.Approved, Investigational
FloctafenineSarilumab may increase the immunosuppressive activities of Floctafenine.Approved, Withdrawn
FlunisolideThe therapeutic efficacy of Flunisolide can be decreased when used in combination with Sarilumab.Approved, Investigational
FlunitrazepamThe therapeutic efficacy of Flunitrazepam can be decreased when used in combination with Sarilumab.Approved, Illicit
FlunixinSarilumab may increase the immunosuppressive activities of Flunixin.Vet Approved
FlunoxaprofenSarilumab may increase the immunosuppressive activities of Flunoxaprofen.Experimental
FluorometholoneThe therapeutic efficacy of Fluorometholone can be decreased when used in combination with Sarilumab.Approved, Investigational
FluoxetineThe therapeutic efficacy of Fluoxetine can be decreased when used in combination with Sarilumab.Approved, Vet Approved
FlurazepamThe therapeutic efficacy of Flurazepam can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational
FlurbiprofenSarilumab may increase the immunosuppressive activities of Flurbiprofen.Approved, Investigational
FlutamideThe therapeutic efficacy of Flutamide can be decreased when used in combination with Sarilumab.Approved, Investigational
Fluticasone furoateThe therapeutic efficacy of Fluticasone furoate can be decreased when used in combination with Sarilumab.Approved
Fluticasone propionateThe therapeutic efficacy of Fluticasone propionate can be decreased when used in combination with Sarilumab.Approved
FluvastatinThe therapeutic efficacy of Fluvastatin can be decreased when used in combination with Sarilumab.Approved
FosamprenavirThe therapeutic efficacy of Fosamprenavir can be decreased when used in combination with Sarilumab.Approved
FosnetupitantThe therapeutic efficacy of Fosnetupitant can be decreased when used in combination with Sarilumab.Approved
FostamatinibThe therapeutic efficacy of Fostamatinib can be decreased when used in combination with Sarilumab.Approved, Investigational
FulvestrantThe therapeutic efficacy of Fulvestrant can be decreased when used in combination with Sarilumab.Approved, Investigational
G17DTThe risk or severity of infection can be increased when Sarilumab is combined with G17DT.Investigational
GalantamineThe therapeutic efficacy of Galantamine can be decreased when used in combination with Sarilumab.Approved
GefitinibThe therapeutic efficacy of Gefitinib can be decreased when used in combination with Sarilumab.Approved, Investigational
GemfibrozilThe therapeutic efficacy of Gemfibrozil can be decreased when used in combination with Sarilumab.Approved
GI-5005The risk or severity of infection can be increased when Sarilumab is combined with GI-5005.Investigational
GlatiramerSarilumab may increase the immunosuppressive activities of Glatiramer Acetate.Approved, Investigational
GlipizideThe therapeutic efficacy of Glipizide can be decreased when used in combination with Sarilumab.Approved, Investigational
GlyburideThe therapeutic efficacy of Glyburide can be decreased when used in combination with Sarilumab.Approved
GranisetronThe therapeutic efficacy of Granisetron can be decreased when used in combination with Sarilumab.Approved, Investigational
GrazoprevirThe therapeutic efficacy of Grazoprevir can be decreased when used in combination with Sarilumab.Approved
GrepafloxacinThe therapeutic efficacy of Grepafloxacin can be decreased when used in combination with Sarilumab.Approved, Investigational, Withdrawn
GuacetisalSarilumab may increase the immunosuppressive activities of Guacetisal.Experimental
GuanfacineThe therapeutic efficacy of Guanfacine can be decreased when used in combination with Sarilumab.Approved, Investigational
HalofantrineThe therapeutic efficacy of Halofantrine can be decreased when used in combination with Sarilumab.Approved
HaloperidolThe therapeutic efficacy of Haloperidol can be decreased when used in combination with Sarilumab.Approved
HalothaneThe therapeutic efficacy of Halothane can be decreased when used in combination with Sarilumab.Approved, Vet Approved
Hepatitis A VaccineThe risk or severity of infection can be increased when Sarilumab is combined with Hepatitis A Vaccine.Approved
Hepatitis B Vaccine (Recombinant)The risk or severity of infection can be increased when Sarilumab is combined with Hepatitis B Vaccine (Recombinant).Approved, Withdrawn
HexobarbitalThe therapeutic efficacy of Hexobarbital can be decreased when used in combination with Sarilumab.Approved
HigenamineSarilumab may increase the immunosuppressive activities of Higenamine.Investigational
HistamineThe therapeutic efficacy of Histamine can be decreased when used in combination with Sarilumab.Approved, Investigational
Human rabies virus immune globulinThe risk or severity of infection can be increased when Sarilumab is combined with Human rabies virus immune globulin.Approved
HydrocodoneThe therapeutic efficacy of Hydrocodone can be decreased when used in combination with Sarilumab.Approved, Illicit
HydrocortisoneThe therapeutic efficacy of Hydrocortisone can be decreased when used in combination with Sarilumab.Approved, Vet Approved
HydromorphoneThe therapeutic efficacy of Hydromorphone can be decreased when used in combination with Sarilumab.Approved, Illicit
HydroxychloroquineSarilumab may increase the immunosuppressive activities of Hydroxychloroquine.Approved
Hydroxyprogesterone caproateThe therapeutic efficacy of Hydroxyprogesterone caproate can be decreased when used in combination with Sarilumab.Approved, Investigational
IbrutinibThe serum concentration of Ibrutinib can be increased when it is combined with Sarilumab.Approved
IbuprofenSarilumab may increase the immunosuppressive activities of Ibuprofen.Approved
IbuproxamSarilumab may increase the immunosuppressive activities of Ibuproxam.Withdrawn
IcatibantSarilumab may increase the immunosuppressive activities of Icatibant.Approved, Investigational
IcotinibThe therapeutic efficacy of Icotinib can be decreased when used in combination with Sarilumab.Approved, Investigational
IfosfamideThe therapeutic efficacy of Ifosfamide can be decreased when used in combination with Sarilumab.Approved
IloperidoneThe therapeutic efficacy of Iloperidone can be decreased when used in combination with Sarilumab.Approved
ImatinibThe therapeutic efficacy of Imatinib can be decreased when used in combination with Sarilumab.Approved
ImidafenacinThe therapeutic efficacy of Imidafenacin can be decreased when used in combination with Sarilumab.Approved, Investigational
Imidazole salicylateSarilumab may increase the immunosuppressive activities of Imidazole salicylate.Experimental
ImipramineThe therapeutic efficacy of Imipramine can be decreased when used in combination with Sarilumab.Approved
ImiquimodThe therapeutic efficacy of Imiquimod can be decreased when used in combination with Sarilumab.Approved, Investigational
IndacaterolThe therapeutic efficacy of Indacaterol can be decreased when used in combination with Sarilumab.Approved
IndapamideThe therapeutic efficacy of Indapamide can be decreased when used in combination with Sarilumab.Approved
IndinavirThe therapeutic efficacy of Indinavir can be decreased when used in combination with Sarilumab.Approved
IndobufenSarilumab may increase the immunosuppressive activities of Indobufen.Investigational
IndomethacinSarilumab may increase the immunosuppressive activities of Indomethacin.Approved, Investigational
IndoprofenSarilumab may increase the immunosuppressive activities of Indoprofen.Withdrawn
InfliximabSarilumab may increase the immunosuppressive activities of Infliximab.Approved
INGN 201The risk or severity of infection can be increased when Sarilumab is combined with INGN 201.Investigational
INGN 225The risk or severity of infection can be increased when Sarilumab is combined with INGN 225.Investigational
IpecacThe therapeutic efficacy of Ipecac can be decreased when used in combination with Sarilumab.Approved, Withdrawn
IpratropiumThe therapeutic efficacy of Ipratropium bromide can be decreased when used in combination with Sarilumab.Approved
IrinotecanThe therapeutic efficacy of Irinotecan can be decreased when used in combination with Sarilumab.Approved, Investigational
IsavuconazoleThe therapeutic efficacy of Isavuconazole can be decreased when used in combination with Sarilumab.Approved, Investigational
IsavuconazoniumThe therapeutic efficacy of Isavuconazonium can be decreased when used in combination with Sarilumab.Approved, Investigational
Isosorbide DinitrateThe therapeutic efficacy of Isosorbide Dinitrate can be decreased when used in combination with Sarilumab.Approved, Investigational
Isosorbide MononitrateThe therapeutic efficacy of Isosorbide Mononitrate can be decreased when used in combination with Sarilumab.Approved
IsoxicamSarilumab may increase the immunosuppressive activities of Isoxicam.Withdrawn
IsradipineThe therapeutic efficacy of Isradipine can be decreased when used in combination with Sarilumab.Approved, Investigational
ItraconazoleThe therapeutic efficacy of Itraconazole can be decreased when used in combination with Sarilumab.Approved, Investigational
IvabradineThe therapeutic efficacy of Ivabradine can be decreased when used in combination with Sarilumab.Approved
IvacaftorThe therapeutic efficacy of Ivacaftor can be decreased when used in combination with Sarilumab.Approved
IvermectinThe therapeutic efficacy of Ivermectin can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
IxabepiloneThe therapeutic efficacy of Ixabepilone can be decreased when used in combination with Sarilumab.Approved, Investigational
IxazomibThe therapeutic efficacy of Ixazomib can be decreased when used in combination with Sarilumab.Approved, Investigational
Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated)The risk or severity of infection can be increased when Sarilumab is combined with Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated).Approved
KebuzoneSarilumab may increase the immunosuppressive activities of Kebuzone.Experimental
KetamineThe therapeutic efficacy of Ketamine can be decreased when used in combination with Sarilumab.Approved, Vet Approved
KetazolamThe therapeutic efficacy of Ketazolam can be decreased when used in combination with Sarilumab.Approved
KetobemidoneThe therapeutic efficacy of Ketobemidone can be decreased when used in combination with Sarilumab.Approved, Investigational
KetoconazoleThe therapeutic efficacy of Ketoconazole can be decreased when used in combination with Sarilumab.Approved, Investigational
KetoprofenSarilumab may increase the immunosuppressive activities of Ketoprofen.Approved, Vet Approved
KetorolacSarilumab may increase the immunosuppressive activities of Ketorolac.Approved
LacidipineThe therapeutic efficacy of Lacidipine can be decreased when used in combination with Sarilumab.Approved, Investigational
LansoprazoleThe therapeutic efficacy of Lansoprazole can be decreased when used in combination with Sarilumab.Approved, Investigational
LapatinibThe therapeutic efficacy of Lapatinib can be decreased when used in combination with Sarilumab.Approved, Investigational
LaquinimodThe therapeutic efficacy of Laquinimod can be decreased when used in combination with Sarilumab.Investigational
LeflunomideSarilumab may increase the immunosuppressive activities of Leflunomide.Approved, Investigational
LenvatinibThe therapeutic efficacy of Lenvatinib can be decreased when used in combination with Sarilumab.Approved, Investigational
LercanidipineThe therapeutic efficacy of Lercanidipine can be decreased when used in combination with Sarilumab.Approved, Investigational
LesinuradSarilumab may increase the immunosuppressive activities of Lesinurad.Approved, Investigational
LetrozoleThe therapeutic efficacy of Letrozole can be decreased when used in combination with Sarilumab.Approved, Investigational
LevamisoleSarilumab may increase the immunosuppressive activities of Levamisole.Approved, Investigational, Vet Approved, Withdrawn
LevobupivacaineThe therapeutic efficacy of Levobupivacaine can be decreased when used in combination with Sarilumab.Approved, Investigational
LevocetirizineThe therapeutic efficacy of Levocetirizine can be decreased when used in combination with Sarilumab.Approved
Levomethadyl AcetateThe therapeutic efficacy of Levomethadyl Acetate can be decreased when used in combination with Sarilumab.Approved, Investigational
LevomilnacipranThe therapeutic efficacy of Levomilnacipran can be decreased when used in combination with Sarilumab.Approved, Investigational
LevonorgestrelThe therapeutic efficacy of Levonorgestrel can be decreased when used in combination with Sarilumab.Approved, Investigational
LevothyroxineThe therapeutic efficacy of Levothyroxine can be decreased when used in combination with Sarilumab.Approved
LidocaineThe therapeutic efficacy of Lidocaine can be decreased when used in combination with Sarilumab.Approved, Vet Approved
LisofyllineSarilumab may increase the immunosuppressive activities of Lisofylline.Investigational
LisurideThe therapeutic efficacy of Lisuride can be decreased when used in combination with Sarilumab.Approved, Investigational
LomitapideThe therapeutic efficacy of Lomitapide can be decreased when used in combination with Sarilumab.Approved, Investigational
LonazolacSarilumab may increase the immunosuppressive activities of Lonazolac.Experimental
LoperamideThe therapeutic efficacy of Loperamide can be decreased when used in combination with Sarilumab.Approved
LopinavirThe therapeutic efficacy of Lopinavir can be decreased when used in combination with Sarilumab.Approved
LoratadineThe therapeutic efficacy of Loratadine can be decreased when used in combination with Sarilumab.Approved, Investigational
LorcaserinThe therapeutic efficacy of Lorcaserin can be decreased when used in combination with Sarilumab.Approved
LornoxicamSarilumab may increase the immunosuppressive activities of Lornoxicam.Approved, Investigational
LorpiprazoleThe therapeutic efficacy of Lorpiprazole can be decreased when used in combination with Sarilumab.Approved
LosartanThe therapeutic efficacy of Losartan can be decreased when used in combination with Sarilumab.Approved
LovastatinThe therapeutic efficacy of Lovastatin can be decreased when used in combination with Sarilumab.Approved, Investigational
LoxoprofenSarilumab may increase the immunosuppressive activities of Loxoprofen.Approved, Investigational
LumefantrineThe therapeutic efficacy of Lumefantrine can be decreased when used in combination with Sarilumab.Approved
LumiracoxibSarilumab may increase the immunosuppressive activities of Lumiracoxib.Approved, Investigational
LurasidoneThe therapeutic efficacy of Lurasidone can be decreased when used in combination with Sarilumab.Approved, Investigational
Lysergic Acid DiethylamideThe risk or severity of adverse effects can be increased when Lysergic Acid Diethylamide is combined with Sarilumab.Illicit, Investigational, Withdrawn
MacimorelinThe therapeutic efficacy of Macimorelin can be decreased when used in combination with Sarilumab.Approved, Investigational
MacitentanThe therapeutic efficacy of Macitentan can be decreased when used in combination with Sarilumab.Approved
Magnesium salicylateSarilumab may increase the immunosuppressive activities of Magnesium salicylate.Approved
MaravirocThe therapeutic efficacy of Maraviroc can be decreased when used in combination with Sarilumab.Approved, Investigational
MasoprocolSarilumab may increase the immunosuppressive activities of Masoprocol.Approved, Investigational
MebendazoleThe therapeutic efficacy of Mebendazole can be decreased when used in combination with Sarilumab.Approved, Vet Approved
Meclofenamic acidSarilumab may increase the immunosuppressive activities of Meclofenamic acid.Approved, Vet Approved
Medical CannabisThe therapeutic efficacy of Medical Cannabis can be decreased when used in combination with Sarilumab.Experimental, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Medroxyprogesterone acetate can be decreased when used in combination with Sarilumab.Approved, Investigational
Mefenamic acidSarilumab may increase the immunosuppressive activities of Mefenamic acid.Approved
MefloquineThe therapeutic efficacy of Mefloquine can be decreased when used in combination with Sarilumab.Approved, Investigational
MeloxicamSarilumab may increase the immunosuppressive activities of Meloxicam.Approved, Vet Approved
MesalazineSarilumab may increase the immunosuppressive activities of Mesalazine.Approved
MetamizoleSarilumab may increase the immunosuppressive activities of Metamizole.Approved, Investigational, Withdrawn
MetergolineThe risk or severity of adverse effects can be increased when Metergoline is combined with Sarilumab.Experimental
MethadoneThe therapeutic efficacy of Methadone can be decreased when used in combination with Sarilumab.Approved
MethaqualoneThe therapeutic efficacy of Methaqualone can be decreased when used in combination with Sarilumab.Illicit, Withdrawn
MethotrexateSarilumab may increase the immunosuppressive activities of Methotrexate.Approved
MethoxsalenThe therapeutic efficacy of Methoxsalen can be decreased when used in combination with Sarilumab.Approved
MethoxyfluraneThe therapeutic efficacy of Methoxyflurane can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
Methyl salicylateSarilumab may increase the immunosuppressive activities of Methyl salicylate.Approved, Vet Approved
MethylergometrineThe risk or severity of adverse effects can be increased when Methylergometrine is combined with Sarilumab.Approved
MethylprednisoloneThe therapeutic efficacy of Methylprednisolone can be decreased when used in combination with Sarilumab.Approved, Vet Approved
MethyltestosteroneThe therapeutic efficacy of Methyltestosterone can be decreased when used in combination with Sarilumab.Approved
MethysergideThe risk or severity of adverse effects can be increased when Methysergide is combined with Sarilumab.Approved
MetronidazoleThe therapeutic efficacy of Metronidazole can be decreased when used in combination with Sarilumab.Approved
MevastatinThe serum concentration of Mevastatin can be increased when it is combined with Sarilumab.Experimental
MexiletineThe therapeutic efficacy of Mexiletine can be decreased when used in combination with Sarilumab.Approved, Investigational
MianserinThe therapeutic efficacy of Mianserin can be decreased when used in combination with Sarilumab.Approved, Investigational
MibefradilThe therapeutic efficacy of Mibefradil can be decreased when used in combination with Sarilumab.Investigational, Withdrawn
MiconazoleThe therapeutic efficacy of Miconazole can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
MidazolamThe therapeutic efficacy of Midazolam can be decreased when used in combination with Sarilumab.Approved, Illicit
MidecamycinThe therapeutic efficacy of Midecamycin can be decreased when used in combination with Sarilumab.Approved
MidostaurinThe therapeutic efficacy of Midostaurin can be decreased when used in combination with Sarilumab.Approved, Investigational
MifepristoneThe therapeutic efficacy of Mifepristone can be decreased when used in combination with Sarilumab.Approved, Investigational
MirabegronThe therapeutic efficacy of Mirabegron can be decreased when used in combination with Sarilumab.Approved
MirtazapineThe therapeutic efficacy of Mirtazapine can be decreased when used in combination with Sarilumab.Approved
MizoribineSarilumab may increase the immunosuppressive activities of Mizoribine.Investigational
ModafinilThe therapeutic efficacy of Modafinil can be decreased when used in combination with Sarilumab.Approved, Investigational
MofebutazoneSarilumab may increase the immunosuppressive activities of Mofebutazone.Experimental
MontelukastThe therapeutic efficacy of Montelukast can be decreased when used in combination with Sarilumab.Approved
MorphineThe therapeutic efficacy of Morphine can be decreased when used in combination with Sarilumab.Approved, Investigational
Mycophenolate mofetilThe therapeutic efficacy of Mycophenolate mofetil can be decreased when used in combination with Sarilumab.Approved, Investigational
NabiximolsThe therapeutic efficacy of Nabiximols can be decreased when used in combination with Sarilumab.Approved, Investigational
NabumetoneSarilumab may increase the immunosuppressive activities of Nabumetone.Approved
NafamostatSarilumab may increase the immunosuppressive activities of Nafamostat.Approved, Investigational
NaloxegolThe therapeutic efficacy of Naloxegol can be decreased when used in combination with Sarilumab.Approved
NaloxoneThe therapeutic efficacy of Naloxone can be decreased when used in combination with Sarilumab.Approved, Vet Approved
NaproxenSarilumab may increase the immunosuppressive activities of Naproxen.Approved, Vet Approved
NateglinideThe therapeutic efficacy of Nateglinide can be decreased when used in combination with Sarilumab.Approved, Investigational
NefazodoneThe therapeutic efficacy of Nefazodone can be decreased when used in combination with Sarilumab.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Nelfinavir can be decreased when used in combination with Sarilumab.Approved
NepafenacSarilumab may increase the immunosuppressive activities of Nepafenac.Approved, Investigational
NeratinibThe therapeutic efficacy of Neratinib can be decreased when used in combination with Sarilumab.Approved, Investigational
NevirapineThe therapeutic efficacy of Nevirapine can be decreased when used in combination with Sarilumab.Approved
NicardipineThe therapeutic efficacy of Nicardipine can be decreased when used in combination with Sarilumab.Approved, Investigational
NicergolineThe risk or severity of adverse effects can be increased when Nicergoline is combined with Sarilumab.Approved, Investigational
NicotineThe therapeutic efficacy of Nicotine can be decreased when used in combination with Sarilumab.Approved
NifedipineThe therapeutic efficacy of Nifedipine can be decreased when used in combination with Sarilumab.Approved
NifenazoneSarilumab may increase the immunosuppressive activities of Nifenazone.Experimental
Niflumic AcidSarilumab may increase the immunosuppressive activities of Niflumic Acid.Approved
NilotinibThe therapeutic efficacy of Nilotinib can be decreased when used in combination with Sarilumab.Approved, Investigational
NilvadipineThe therapeutic efficacy of Nilvadipine can be decreased when used in combination with Sarilumab.Approved, Investigational
NimesulideSarilumab may increase the immunosuppressive activities of Nimesulide.Approved, Investigational, Withdrawn
NimodipineThe therapeutic efficacy of Nimodipine can be decreased when used in combination with Sarilumab.Approved, Investigational
NisoldipineThe therapeutic efficacy of Nisoldipine can be decreased when used in combination with Sarilumab.Approved
NitrazepamThe therapeutic efficacy of Nitrazepam can be decreased when used in combination with Sarilumab.Approved
NitrendipineThe therapeutic efficacy of Nitrendipine can be decreased when used in combination with Sarilumab.Approved, Investigational
NitroaspirinSarilumab may increase the immunosuppressive activities of Nitroaspirin.Investigational
NorethisteroneThe therapeutic efficacy of Norethisterone can be decreased when used in combination with Sarilumab.Approved
NorgestrelThe therapeutic efficacy of Norgestrel can be decreased when used in combination with Sarilumab.Approved
NortriptylineThe therapeutic efficacy of Nortriptyline can be decreased when used in combination with Sarilumab.Approved
OdanacatibThe therapeutic efficacy of Odanacatib can be decreased when used in combination with Sarilumab.Investigational
OlaparibThe therapeutic efficacy of Olaparib can be decreased when used in combination with Sarilumab.Approved
OlopatadineSarilumab may increase the immunosuppressive activities of Olopatadine.Approved
OlsalazineSarilumab may increase the immunosuppressive activities of Olsalazine.Approved
OmeprazoleThe therapeutic efficacy of Omeprazole can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
OndansetronThe therapeutic efficacy of Ondansetron can be decreased when used in combination with Sarilumab.Approved
OpiumThe therapeutic efficacy of Opium can be decreased when used in combination with Sarilumab.Approved, Illicit
OrgoteinSarilumab may increase the immunosuppressive activities of Orgotein.Vet Approved
OrphenadrineThe therapeutic efficacy of Orphenadrine can be decreased when used in combination with Sarilumab.Approved
OspemifeneThe therapeutic efficacy of Ospemifene can be decreased when used in combination with Sarilumab.Approved, Investigational
OxaprozinSarilumab may increase the immunosuppressive activities of Oxaprozin.Approved
OxazepamThe therapeutic efficacy of Oxazepam can be decreased when used in combination with Sarilumab.Approved
OxybutyninThe therapeutic efficacy of Oxybutynin can be decreased when used in combination with Sarilumab.Approved, Investigational
OxycodoneThe therapeutic efficacy of Oxycodone can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational
OxymorphoneThe therapeutic efficacy of Oxymorphone can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
OxyphenbutazoneSarilumab may increase the immunosuppressive activities of Oxyphenbutazone.Approved, Withdrawn
PaclitaxelThe therapeutic efficacy of Paclitaxel can be decreased when used in combination with Sarilumab.Approved, Vet Approved
PalbociclibThe therapeutic efficacy of Palbociclib can be decreased when used in combination with Sarilumab.Approved, Investigational
PalmidrolSarilumab may increase the immunosuppressive activities of Palmidrol.Experimental, Nutraceutical
PalonosetronThe therapeutic efficacy of Palonosetron can be decreased when used in combination with Sarilumab.Approved, Investigational
PanobinostatThe therapeutic efficacy of Panobinostat can be decreased when used in combination with Sarilumab.Approved, Investigational
PantoprazoleThe therapeutic efficacy of Pantoprazole can be decreased when used in combination with Sarilumab.Approved
ParamethadioneThe therapeutic efficacy of Paramethadione can be decreased when used in combination with Sarilumab.Approved
ParamethasoneThe therapeutic efficacy of Paramethasone can be decreased when used in combination with Sarilumab.Approved
ParecoxibSarilumab may increase the immunosuppressive activities of Parecoxib.Approved
ParicalcitolThe therapeutic efficacy of Paricalcitol can be decreased when used in combination with Sarilumab.Approved, Investigational
ParitaprevirThe therapeutic efficacy of Paritaprevir can be decreased when used in combination with Sarilumab.Approved, Investigational
ParthenolideSarilumab may increase the immunosuppressive activities of Parthenolide.Approved, Investigational
PazopanibThe therapeutic efficacy of Pazopanib can be decreased when used in combination with Sarilumab.Approved
PenicillamineSarilumab may increase the immunosuppressive activities of Penicillamine.Approved
PentamidineThe therapeutic efficacy of Pentamidine can be decreased when used in combination with Sarilumab.Approved, Investigational
PerampanelThe therapeutic efficacy of Perampanel can be decreased when used in combination with Sarilumab.Approved
PergolideThe therapeutic efficacy of Pergolide can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved, Withdrawn
PerhexilineThe therapeutic efficacy of Perhexiline can be decreased when used in combination with Sarilumab.Approved, Investigational
PermethrinThe therapeutic efficacy of Permethrin can be decreased when used in combination with Sarilumab.Approved, Investigational
PerospironeThe therapeutic efficacy of Perospirone can be decreased when used in combination with Sarilumab.Approved
PerphenazineThe therapeutic efficacy of Perphenazine can be decreased when used in combination with Sarilumab.Approved
PethidineThe therapeutic efficacy of Pethidine can be decreased when used in combination with Sarilumab.Approved
PhenacetinThe therapeutic efficacy of Phenacetin can be decreased when used in combination with Sarilumab.Withdrawn
PhenoxybenzamineThe therapeutic efficacy of Phenoxybenzamine can be decreased when used in combination with Sarilumab.Approved
PhenprocoumonThe therapeutic efficacy of Phenprocoumon can be decreased when used in combination with Sarilumab.Approved, Investigational
PhenylbutazoneSarilumab may increase the immunosuppressive activities of Phenylbutazone.Approved, Vet Approved
PhenytoinThe therapeutic efficacy of Phenytoin can be decreased when used in combination with Sarilumab.Approved, Vet Approved
PilocarpineThe therapeutic efficacy of Pilocarpine can be decreased when used in combination with Sarilumab.Approved, Investigational
PimecrolimusSarilumab may increase the immunosuppressive activities of Pimecrolimus.Approved, Investigational
PimozideThe therapeutic efficacy of Pimozide can be decreased when used in combination with Sarilumab.Approved
PinacidilThe therapeutic efficacy of Pinacidil can be decreased when used in combination with Sarilumab.Approved
PioglitazoneThe therapeutic efficacy of Pioglitazone can be decreased when used in combination with Sarilumab.Approved, Investigational
PiperaquineThe therapeutic efficacy of Piperaquine can be decreased when used in combination with Sarilumab.Approved, Investigational
PipotiazineThe therapeutic efficacy of Pipotiazine can be decreased when used in combination with Sarilumab.Approved, Investigational
PirfenidoneSarilumab may increase the immunosuppressive activities of Pirfenidone.Approved, Investigational
PiroxicamSarilumab may increase the immunosuppressive activities of Piroxicam.Approved, Investigational
PirprofenSarilumab may increase the immunosuppressive activities of Pirprofen.Experimental
PitavastatinThe serum concentration of Pitavastatin can be increased when it is combined with Sarilumab.Approved
PitolisantThe therapeutic efficacy of Pitolisant can be decreased when used in combination with Sarilumab.Approved, Investigational
PodofiloxThe therapeutic efficacy of Podofilox can be decreased when used in combination with Sarilumab.Approved
PomalidomideThe therapeutic efficacy of Pomalidomide can be decreased when used in combination with Sarilumab.Approved
PonatinibThe therapeutic efficacy of Ponatinib can be decreased when used in combination with Sarilumab.Approved, Investigational
PosaconazoleThe therapeutic efficacy of Posaconazole can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
PranoprofenSarilumab may increase the immunosuppressive activities of Pranoprofen.Experimental, Investigational
PrasteroneThe therapeutic efficacy of Prasterone can be decreased when used in combination with Sarilumab.Approved, Investigational, Nutraceutical
PrasugrelThe therapeutic efficacy of Prasugrel can be decreased when used in combination with Sarilumab.Approved
PravastatinThe therapeutic efficacy of Pravastatin can be decreased when used in combination with Sarilumab.Approved
PrazepamThe therapeutic efficacy of Prazepam can be decreased when used in combination with Sarilumab.Approved, Illicit
PraziquantelThe therapeutic efficacy of Praziquantel can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
PrednisoloneThe therapeutic efficacy of Prednisolone can be decreased when used in combination with Sarilumab.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Prednisone can be decreased when used in combination with Sarilumab.Approved, Vet Approved
PrimaquineThe therapeutic efficacy of Primaquine can be decreased when used in combination with Sarilumab.Approved
ProbenecidSarilumab may increase the immunosuppressive activities of Probenecid.Approved, Investigational
ProchlorperazineThe therapeutic efficacy of Prochlorperazine can be decreased when used in combination with Sarilumab.Approved, Vet Approved
ProgesteroneThe therapeutic efficacy of Progesterone can be decreased when used in combination with Sarilumab.Approved, Vet Approved
ProglumetacinSarilumab may increase the immunosuppressive activities of Proglumetacin.Experimental
ProguanilThe therapeutic efficacy of Proguanil can be decreased when used in combination with Sarilumab.Approved
PromazineThe therapeutic efficacy of Promazine can be decreased when used in combination with Sarilumab.Approved, Vet Approved
PropacetamolSarilumab may increase the immunosuppressive activities of Propacetamol.Approved, Investigational
PropafenoneThe therapeutic efficacy of Propafenone can be decreased when used in combination with Sarilumab.Approved
PropiverineThe therapeutic efficacy of Propiverine can be decreased when used in combination with Sarilumab.Approved, Investigational
PropofolThe therapeutic efficacy of Propofol can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
PropranololThe therapeutic efficacy of Propranolol can be decreased when used in combination with Sarilumab.Approved, Investigational
PropyphenazoneSarilumab may increase the immunosuppressive activities of Propyphenazone.Experimental
ProquazoneSarilumab may increase the immunosuppressive activities of Proquazone.Experimental
PTC299Sarilumab may increase the immunosuppressive activities of PTC299.Investigational
PyrazinamideThe therapeutic efficacy of Pyrazinamide can be decreased when used in combination with Sarilumab.Approved, Investigational
QuazepamThe therapeutic efficacy of Quazepam can be decreased when used in combination with Sarilumab.Approved, Illicit
QuetiapineThe therapeutic efficacy of Quetiapine can be decreased when used in combination with Sarilumab.Approved
QuinacrineThe therapeutic efficacy of Quinacrine can be decreased when used in combination with Sarilumab.Approved, Investigational
QuinidineThe therapeutic efficacy of Quinidine can be decreased when used in combination with Sarilumab.Approved, Investigational
QuinineThe therapeutic efficacy of Quinine can be decreased when used in combination with Sarilumab.Approved
RabeprazoleThe therapeutic efficacy of Rabeprazole can be decreased when used in combination with Sarilumab.Approved, Investigational
Rabies virus inactivated antigen, AThe risk or severity of infection can be increased when Sarilumab is combined with Rabies virus inactivated antigen, A.Approved, Investigational
RaloxifeneThe therapeutic efficacy of Raloxifene can be decreased when used in combination with Sarilumab.Approved, Investigational
RamelteonThe therapeutic efficacy of Ramelteon can be decreased when used in combination with Sarilumab.Approved, Investigational
RanolazineThe therapeutic efficacy of Ranolazine can be decreased when used in combination with Sarilumab.Approved, Investigational
RasburicaseSarilumab may increase the immunosuppressive activities of Rasburicase.Approved, Investigational
ReboxetineThe therapeutic efficacy of Reboxetine can be decreased when used in combination with Sarilumab.Approved, Investigational
RegorafenibThe therapeutic efficacy of Regorafenib can be decreased when used in combination with Sarilumab.Approved
RepaglinideThe therapeutic efficacy of Repaglinide can be decreased when used in combination with Sarilumab.Approved, Investigational
ResveratrolSarilumab may increase the immunosuppressive activities of Resveratrol.Approved, Experimental, Investigational
RetapamulinThe therapeutic efficacy of Retapamulin can be decreased when used in combination with Sarilumab.Approved
RifabutinThe therapeutic efficacy of Rifabutin can be decreased when used in combination with Sarilumab.Approved, Investigational
RifampicinThe therapeutic efficacy of Rifampicin can be decreased when used in combination with Sarilumab.Approved
RilpivirineThe therapeutic efficacy of Rilpivirine can be decreased when used in combination with Sarilumab.Approved
RimonabantThe therapeutic efficacy of Rimonabant can be decreased when used in combination with Sarilumab.Approved, Investigational
RindopepimutThe risk or severity of infection can be increased when Sarilumab is combined with Rindopepimut.Investigational
RiociguatThe therapeutic efficacy of Riociguat can be decreased when used in combination with Sarilumab.Approved
RisperidoneThe therapeutic efficacy of Risperidone can be decreased when used in combination with Sarilumab.Approved, Investigational
RitonavirThe therapeutic efficacy of Ritonavir can be decreased when used in combination with Sarilumab.Approved, Investigational
RituximabSarilumab may increase the immunosuppressive activities of Rituximab.Approved
RivaroxabanThe therapeutic efficacy of Rivaroxaban can be decreased when used in combination with Sarilumab.Approved
RofecoxibSarilumab may increase the immunosuppressive activities of Rofecoxib.Approved, Investigational, Withdrawn
RolapitantThe therapeutic efficacy of Rolapitant can be decreased when used in combination with Sarilumab.Approved, Investigational
RomidepsinThe therapeutic efficacy of Romidepsin can be decreased when used in combination with Sarilumab.Approved, Investigational
RopiniroleThe therapeutic efficacy of Ropinirole can be decreased when used in combination with Sarilumab.Approved, Investigational
RopivacaineThe therapeutic efficacy of Ropivacaine can be decreased when used in combination with Sarilumab.Approved
RosuvastatinThe therapeutic efficacy of Rosuvastatin can be decreased when used in combination with Sarilumab.Approved
Rotavirus VaccineThe risk or severity of infection can be increased when Sarilumab is combined with Rotavirus Vaccine.Approved
RotigotineThe therapeutic efficacy of Rotigotine can be decreased when used in combination with Sarilumab.Approved
RoxithromycinThe therapeutic efficacy of Roxithromycin can be decreased when used in combination with Sarilumab.Approved, Investigational, Withdrawn
Rubella virus vaccineThe risk or severity of infection can be increased when Sarilumab is combined with Rubella virus vaccine.Approved, Investigational
RucaparibThe therapeutic efficacy of Rucaparib can be decreased when used in combination with Sarilumab.Approved, Investigational
RupatadineThe therapeutic efficacy of Rupatadine can be decreased when used in combination with Sarilumab.Approved
RuxolitinibThe therapeutic efficacy of Ruxolitinib can be decreased when used in combination with Sarilumab.Approved
SafinamideThe therapeutic efficacy of Safinamide can be decreased when used in combination with Sarilumab.Approved, Investigational
SalicylamideSarilumab may increase the immunosuppressive activities of Salicylamide.Approved
Salicylic acidSarilumab may increase the immunosuppressive activities of Salicylic acid.Approved, Investigational, Vet Approved
SalmeterolThe therapeutic efficacy of Salmeterol can be decreased when used in combination with Sarilumab.Approved
Salmonella typhi ty2 vi polysaccharide antigenThe risk or severity of infection can be increased when Sarilumab is combined with Salmonella typhi ty2 vi polysaccharide antigen.Approved
Salmonella typhi ty21a live antigenThe risk or severity of infection can be increased when Sarilumab is combined with Salmonella typhi ty21a live antigen.Approved
SalsalateSarilumab may increase the immunosuppressive activities of Salsalate.Approved
SaquinavirThe therapeutic efficacy of Saquinavir can be decreased when used in combination with Sarilumab.Approved, Investigational
SaxagliptinThe therapeutic efficacy of Saxagliptin can be decreased when used in combination with Sarilumab.Approved
SelegilineThe therapeutic efficacy of Selegiline can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
SelexipagThe therapeutic efficacy of Selexipag can be decreased when used in combination with Sarilumab.Approved
SemapimodSarilumab may increase the immunosuppressive activities of Semapimod.Investigational
SeratrodastSarilumab may increase the immunosuppressive activities of Seratrodast.Approved
SerrapeptaseSarilumab may increase the immunosuppressive activities of Serrapeptase.Investigational
SertindoleThe therapeutic efficacy of Sertindole can be decreased when used in combination with Sarilumab.Approved, Investigational, Withdrawn
SertralineThe therapeutic efficacy of Sertraline can be decreased when used in combination with Sarilumab.Approved
SevofluraneThe therapeutic efficacy of Sevoflurane can be decreased when used in combination with Sarilumab.Approved, Vet Approved
SibutramineThe therapeutic efficacy of Sibutramine can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational, Withdrawn
SildenafilThe therapeutic efficacy of Sildenafil can be decreased when used in combination with Sarilumab.Approved, Investigational
SilodosinThe therapeutic efficacy of Silodosin can be decreased when used in combination with Sarilumab.Approved
SimvastatinThe therapeutic efficacy of Simvastatin can be decreased when used in combination with Sarilumab.Approved
SirolimusThe therapeutic efficacy of Sirolimus can be decreased when used in combination with Sarilumab.Approved, Investigational
SitagliptinThe therapeutic efficacy of Sitagliptin can be decreased when used in combination with Sarilumab.Approved, Investigational
Sodium aurothiomalateSarilumab may increase the immunosuppressive activities of Sodium aurothiomalate.Approved, Investigational
Sodium aurotiosulfateSarilumab may increase the immunosuppressive activities of Sodium aurotiosulfate.Experimental
SolifenacinThe therapeutic efficacy of Solifenacin can be decreased when used in combination with Sarilumab.Approved
SonidegibThe therapeutic efficacy of Sonidegib can be decreased when used in combination with Sarilumab.Approved, Investigational
SorafenibThe therapeutic efficacy of Sorafenib can be decreased when used in combination with Sarilumab.Approved, Investigational
SpiramycinThe therapeutic efficacy of Spiramycin can be decreased when used in combination with Sarilumab.Approved
SRP 299The risk or severity of infection can be increased when Sarilumab is combined with SRP 299.Investigational
SRT501Sarilumab may increase the immunosuppressive activities of SRT501.Investigational
SufentanilThe therapeutic efficacy of Sufentanil can be decreased when used in combination with Sarilumab.Approved, Investigational
SulfadiazineThe therapeutic efficacy of Sulfadiazine can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
SulfamethoxazoleThe therapeutic efficacy of Sulfamethoxazole can be decreased when used in combination with Sarilumab.Approved
SulfasalazineSarilumab may increase the immunosuppressive activities of Sulfasalazine.Approved
SulfinpyrazoneSarilumab may increase the immunosuppressive activities of Sulfinpyrazone.Approved
SulindacSarilumab may increase the immunosuppressive activities of Sulindac.Approved, Investigational
SunitinibThe therapeutic efficacy of Sunitinib can be decreased when used in combination with Sarilumab.Approved, Investigational
SuprofenSarilumab may increase the immunosuppressive activities of Suprofen.Approved, Withdrawn
SuxibuzoneSarilumab may increase the immunosuppressive activities of Suxibuzone.Experimental
Synthetic Conjugated Estrogens, AThe therapeutic efficacy of Synthetic Conjugated Estrogens, A can be decreased when used in combination with Sarilumab.Approved
Synthetic Conjugated Estrogens, BThe therapeutic efficacy of Synthetic Conjugated Estrogens, B can be decreased when used in combination with Sarilumab.Approved
TacrolimusThe therapeutic efficacy of Tacrolimus can be decreased when used in combination with Sarilumab.Approved, Investigational
TadalafilThe therapeutic efficacy of Tadalafil can be decreased when used in combination with Sarilumab.Approved, Investigational
TamoxifenThe therapeutic efficacy of Tamoxifen can be decreased when used in combination with Sarilumab.Approved
TamsulosinThe therapeutic efficacy of Tamsulosin can be decreased when used in combination with Sarilumab.Approved, Investigational
TarenflurbilSarilumab may increase the immunosuppressive activities of Tarenflurbil.Investigational
TasosartanThe therapeutic efficacy of Tasosartan can be decreased when used in combination with Sarilumab.Approved
Taurochenodeoxycholic acidThe therapeutic efficacy of Taurochenodeoxycholic acid can be decreased when used in combination with Sarilumab.Experimental
TecemotideThe risk or severity of infection can be increased when Sarilumab is combined with Tecemotide.Investigational
TelaprevirThe therapeutic efficacy of Telaprevir can be decreased when used in combination with Sarilumab.Approved, Withdrawn
TelithromycinThe therapeutic efficacy of Telithromycin can be decreased when used in combination with Sarilumab.Approved
TemazepamThe therapeutic efficacy of Temazepam can be decreased when used in combination with Sarilumab.Approved, Investigational
TemsirolimusThe therapeutic efficacy of Temsirolimus can be decreased when used in combination with Sarilumab.Approved
TenidapSarilumab may increase the immunosuppressive activities of Tenidap.Experimental
TeniposideThe therapeutic efficacy of Teniposide can be decreased when used in combination with Sarilumab.Approved
TenoxicamSarilumab may increase the immunosuppressive activities of Tenoxicam.Approved
TepoxalinSarilumab may increase the immunosuppressive activities of Tepoxalin.Vet Approved
TerbinafineThe therapeutic efficacy of Terbinafine can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
TerfenadineThe therapeutic efficacy of Terfenadine can be decreased when used in combination with Sarilumab.Approved, Withdrawn
TergurideThe risk or severity of adverse effects can be increased when Terguride is combined with Sarilumab.Experimental
TeriflunomideSarilumab may increase the immunosuppressive activities of Teriflunomide.Approved
TesmilifeneThe therapeutic efficacy of Tesmilifene can be decreased when used in combination with Sarilumab.Investigational
TestosteroneThe therapeutic efficacy of Testosterone can be decreased when used in combination with Sarilumab.Approved, Investigational
Testosterone cypionateThe therapeutic efficacy of Testosterone cypionate can be decreased when used in combination with Sarilumab.Approved
Testosterone enanthateThe therapeutic efficacy of Testosterone enanthate can be decreased when used in combination with Sarilumab.Approved
Testosterone propionateThe therapeutic efficacy of Testosterone propionate can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved, Withdrawn
Testosterone undecanoateThe therapeutic efficacy of Testosterone undecanoate can be decreased when used in combination with Sarilumab.Approved, Investigational
TetracyclineThe therapeutic efficacy of Tetracycline can be decreased when used in combination with Sarilumab.Approved, Vet Approved
TezacaftorThe therapeutic efficacy of Tezacaftor can be decreased when used in combination with Sarilumab.Approved, Investigational
TG4010The risk or severity of infection can be increased when Sarilumab is combined with TG4010.Investigational
TheophyllineThe therapeutic efficacy of Theophylline can be decreased when used in combination with Sarilumab.Approved
ThiotepaThe therapeutic efficacy of Thiotepa can be decreased when used in combination with Sarilumab.Approved, Investigational
TiagabineThe therapeutic efficacy of Tiagabine can be decreased when used in combination with Sarilumab.Approved, Investigational
Tiaprofenic acidSarilumab may increase the immunosuppressive activities of Tiaprofenic acid.Approved
TicagrelorThe therapeutic efficacy of Ticagrelor can be decreased when used in combination with Sarilumab.Approved
TiclopidineThe therapeutic efficacy of Ticlopidine can be decreased when used in combination with Sarilumab.Approved
TicrynafenSarilumab may increase the immunosuppressive activities of Ticrynafen.Withdrawn
TinidazoleThe therapeutic efficacy of Tinidazole can be decreased when used in combination with Sarilumab.Approved, Investigational
TinoridineSarilumab may increase the immunosuppressive activities of Tinoridine.Investigational
TiotropiumThe therapeutic efficacy of Tiotropium can be decreased when used in combination with Sarilumab.Approved
TipranavirThe therapeutic efficacy of Tipranavir can be decreased when used in combination with Sarilumab.Approved, Investigational
TisopurineSarilumab may increase the immunosuppressive activities of Tisopurine.Experimental
TocofersolanThe therapeutic efficacy of Tocofersolan can be decreased when used in combination with Sarilumab.Approved
TocopherolThe therapeutic efficacy of Tocopherol can be decreased when used in combination with Sarilumab.Approved, Investigational
TofacitinibThe therapeutic efficacy of Tofacitinib can be decreased when used in combination with Sarilumab.Approved, Investigational
Tolfenamic AcidSarilumab may increase the immunosuppressive activities of Tolfenamic Acid.Approved, Investigational
TolmetinSarilumab may increase the immunosuppressive activities of Tolmetin.Approved
TolterodineThe therapeutic efficacy of Tolterodine can be decreased when used in combination with Sarilumab.Approved, Investigational
TolvaptanThe serum concentration of Tolvaptan can be increased when it is combined with Sarilumab.Approved
ToremifeneThe therapeutic efficacy of Toremifene can be decreased when used in combination with Sarilumab.Approved, Investigational
TrabectedinThe therapeutic efficacy of Trabectedin can be decreased when used in combination with Sarilumab.Approved, Investigational
TramadolThe therapeutic efficacy of Tramadol can be decreased when used in combination with Sarilumab.Approved, Investigational
TranilastSarilumab may increase the immunosuppressive activities of Tranilast.Approved, Investigational
Trastuzumab emtansineThe therapeutic efficacy of Trastuzumab emtansine can be decreased when used in combination with Sarilumab.Approved, Investigational
TrazodoneThe therapeutic efficacy of Trazodone can be decreased when used in combination with Sarilumab.Approved, Investigational
TretinoinThe therapeutic efficacy of Tretinoin can be decreased when used in combination with Sarilumab.Approved, Investigational, Nutraceutical
TriamcinoloneThe therapeutic efficacy of Triamcinolone can be decreased when used in combination with Sarilumab.Approved, Vet Approved
TriazolamThe therapeutic efficacy of Triazolam can be decreased when used in combination with Sarilumab.Approved, Investigational
TribenosideSarilumab may increase the immunosuppressive activities of Tribenoside.Experimental
TrimethadioneThe therapeutic efficacy of Trimethadione can be decreased when used in combination with Sarilumab.Approved
TrimethoprimThe therapeutic efficacy of Trimethoprim can be decreased when used in combination with Sarilumab.Approved, Vet Approved
TrimipramineThe therapeutic efficacy of Trimipramine can be decreased when used in combination with Sarilumab.Approved
TroglitazoneThe therapeutic efficacy of Troglitazone can be decreased when used in combination with Sarilumab.Investigational, Withdrawn
TroleandomycinThe therapeutic efficacy of Troleandomycin can be decreased when used in combination with Sarilumab.Approved
Typhoid VaccineThe risk or severity of infection can be increased when Sarilumab is combined with Typhoid Vaccine.Approved
UdenafilThe therapeutic efficacy of Udenafil can be decreased when used in combination with Sarilumab.Approved, Investigational
UlipristalThe therapeutic efficacy of Ulipristal can be decreased when used in combination with Sarilumab.Approved
ValbenazineThe therapeutic efficacy of Valbenazine can be decreased when used in combination with Sarilumab.Approved, Investigational
ValdecoxibSarilumab may increase the immunosuppressive activities of Valdecoxib.Approved, Investigational, Withdrawn
VandetanibThe therapeutic efficacy of Vandetanib can be decreased when used in combination with Sarilumab.Approved
VanoxerineThe therapeutic efficacy of Vanoxerine can be decreased when used in combination with Sarilumab.Investigational
VardenafilThe therapeutic efficacy of Vardenafil can be decreased when used in combination with Sarilumab.Approved
Varicella Zoster Vaccine (Live/Attenuated)The risk or severity of infection can be increased when Sarilumab is combined with Varicella Zoster Vaccine (Live/Attenuated).Approved
VelpatasvirThe therapeutic efficacy of Velpatasvir can be decreased when used in combination with Sarilumab.Approved, Investigational
VemurafenibThe therapeutic efficacy of Vemurafenib can be decreased when used in combination with Sarilumab.Approved
VenetoclaxThe therapeutic efficacy of Venetoclax can be decreased when used in combination with Sarilumab.Approved, Investigational
VenlafaxineThe therapeutic efficacy of Venlafaxine can be decreased when used in combination with Sarilumab.Approved
VerapamilThe therapeutic efficacy of Verapamil can be decreased when used in combination with Sarilumab.Approved
VicrivirocThe therapeutic efficacy of Vicriviroc can be decreased when used in combination with Sarilumab.Investigational
VilanterolThe therapeutic efficacy of Vilanterol can be decreased when used in combination with Sarilumab.Approved
VilazodoneThe therapeutic efficacy of Vilazodone can be decreased when used in combination with Sarilumab.Approved
VinblastineThe therapeutic efficacy of Vinblastine can be decreased when used in combination with Sarilumab.Approved
VincristineThe therapeutic efficacy of Vincristine can be decreased when used in combination with Sarilumab.Approved, Investigational
VindesineThe therapeutic efficacy of Vindesine can be decreased when used in combination with Sarilumab.Approved, Investigational
VinflunineThe therapeutic efficacy of Vinflunine can be decreased when used in combination with Sarilumab.Approved, Investigational
VinorelbineThe therapeutic efficacy of Vinorelbine can be decreased when used in combination with Sarilumab.Approved, Investigational
VismodegibThe therapeutic efficacy of Vismodegib can be decreased when used in combination with Sarilumab.Approved, Investigational
VoriconazoleThe therapeutic efficacy of Voriconazole can be decreased when used in combination with Sarilumab.Approved, Investigational
VortioxetineThe therapeutic efficacy of Vortioxetine can be decreased when used in combination with Sarilumab.Approved, Investigational
VoxilaprevirThe therapeutic efficacy of Voxilaprevir can be decreased when used in combination with Sarilumab.Approved, Investigational
WarfarinThe therapeutic efficacy of Warfarin can be decreased when used in combination with Sarilumab.Approved
Yellow Fever VaccineThe risk or severity of infection can be increased when Sarilumab is combined with Yellow Fever Vaccine.Approved, Investigational
YohimbineThe therapeutic efficacy of Yohimbine can be decreased when used in combination with Sarilumab.Approved, Investigational, Vet Approved
ZafirlukastThe therapeutic efficacy of Zafirlukast can be decreased when used in combination with Sarilumab.Approved, Investigational
ZalcitabineThe therapeutic efficacy of Zalcitabine can be decreased when used in combination with Sarilumab.Approved, Investigational
ZaleplonThe therapeutic efficacy of Zaleplon can be decreased when used in combination with Sarilumab.Approved, Illicit, Investigational
ZaltoprofenSarilumab may increase the immunosuppressive activities of Zaltoprofen.Approved, Investigational
ZidovudineThe therapeutic efficacy of Zidovudine can be decreased when used in combination with Sarilumab.Approved
ZileutonSarilumab may increase the immunosuppressive activities of Zileuton.Approved, Investigational, Withdrawn
ZiprasidoneThe therapeutic efficacy of Ziprasidone can be decreased when used in combination with Sarilumab.Approved
ZolpidemThe therapeutic efficacy of Zolpidem can be decreased when used in combination with Sarilumab.Approved
ZomepiracSarilumab may increase the immunosuppressive activities of Zomepirac.Withdrawn
ZonisamideThe therapeutic efficacy of Zonisamide can be decreased when used in combination with Sarilumab.Approved, Investigational
ZopicloneThe therapeutic efficacy of Zopiclone can be decreased when used in combination with Sarilumab.Approved
ZotepineThe therapeutic efficacy of Zotepine can be decreased when used in combination with Sarilumab.Approved, Investigational, Withdrawn
Food Interactions
Not Available

References

General References
  1. Huizinga TW, Fleischmann RM, Jasson M, Radin AR, van Adelsberg J, Fiore S, Huang X, Yancopoulos GD, Stahl N, Genovese MC: Sarilumab, a fully human monoclonal antibody against IL-6Ralpha in patients with rheumatoid arthritis and an inadequate response to methotrexate: efficacy and safety results from the randomised SARIL-RA-MOBILITY Part A trial. Ann Rheum Dis. 2014 Sep;73(9):1626-34. doi: 10.1136/annrheumdis-2013-204405. Epub 2013 Dec 2. [PubMed:24297381]
  2. Genovese MC, Fleischmann R, Kivitz AJ, Rell-Bakalarska M, Martincova R, Fiore S, Rohane P, van Hoogstraten H, Garg A, Fan C, van Adelsberg J, Weinstein SP, Graham NM, Stahl N, Yancopoulos GD, Huizinga TW, van der Heijde D: Sarilumab Plus Methotrexate in Patients With Active Rheumatoid Arthritis and Inadequate Response to Methotrexate: Results of a Phase III Study. Arthritis Rheumatol. 2015 Jun;67(6):1424-37. doi: 10.1002/art.39093. [PubMed:25733246]
  3. Cooper S: Sarilumab for the treatment of rheumatoid arthritis. Immunotherapy. 2016;8(3):249-50. doi: 10.2217/imt.15.127. Epub 2016 Feb 9. [PubMed:26860742]
  4. Kaufman MB: Pharmaceutical Approval Update. P T. 2017 Sep;42(9):562-580. [PubMed:28890641]
  5. ema.europa [Link]
  6. Kevzara product monograph [Link]
External Links
PubChem Substance
347911238
Wikipedia
Sarilumab
AHFS Codes
  • 92:36.00 — Disease-modifying Antirheumatic Agents
FDA label
Download (1.31 MB)
MSDS
Download (90.8 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedBasic ScienceRheumatoid Arthritis1
1CompletedHealth Services ResearchRheumatoid Arthritis1
1CompletedTreatmentRheumatoid Arthritis6
2CompletedTreatmentAnkylosing Spondylitis (AS)1
2RecruitingTreatmentJuvenile Idiopathic Arthritis (JIA)1
2SuspendedTreatmentJuvenile Idiopathic Arthritis (JIA)1
2TerminatedTreatmentAnkylosing Spondylitis (AS)1
2TerminatedTreatmentRheumatoid Arthritis1
2, 3CompletedTreatmentRheumatoid Arthritis1
3Active Not RecruitingTreatmentRheumatoid Arthritis2
3CompletedTreatmentRheumatoid Arthritis6
3RecruitingTreatmentRheumatoid Arthritis1
3TerminatedTreatmentRheumatoid Arthritis1
4RecruitingTreatmentRheumatoid Arthritis1
Not AvailableNot Yet RecruitingNot AvailableRheumatoid Arthritis -Exposure During Pregnancy1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous150 mg/1.14mL
Injection, solutionSubcutaneous200 mg/1.14mL
SolutionSubcutaneous150 mg
SolutionSubcutaneous200 mg
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
PropertyValueSource
melting point (°C)69 °C (midpoint transition), 80 °C (whole IgG1)Dashivets, et al. PLOS ONE. 10. e0143520. 10.1371/journal.pone.0143520. (2015).
isoelectric point6.6 - 7.2Jin, et al. Electrophoresis. Sep;23(19):3385-91. (2002).

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
Antibody
General Function
Protein homodimerization activity
Specific Function
Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulati...
Gene Name
IL6R
Uniprot ID
P08887
Uniprot Name
Interleukin-6 receptor subunit alpha
Molecular Weight
51547.015 Da
References
  1. Huizinga TW, Fleischmann RM, Jasson M, Radin AR, van Adelsberg J, Fiore S, Huang X, Yancopoulos GD, Stahl N, Genovese MC: Sarilumab, a fully human monoclonal antibody against IL-6Ralpha in patients with rheumatoid arthritis and an inadequate response to methotrexate: efficacy and safety results from the randomised SARIL-RA-MOBILITY Part A trial. Ann Rheum Dis. 2014 Sep;73(9):1626-34. doi: 10.1136/annrheumdis-2013-204405. Epub 2013 Dec 2. [PubMed:24297381]
  2. June RR, Olsen NJ: Room for more IL-6 blockade? Sarilumab for the treatment of rheumatoid arthritis. Expert Opin Biol Ther. 2016 Oct;16(10):1303-9. doi: 10.1080/14712598.2016.1217988. Epub 2016 Aug 8. [PubMed:27464017]
  3. Smolen JS, Landewe R, Bijlsma J, Burmester G, Chatzidionysiou K, Dougados M, Nam J, Ramiro S, Voshaar M, van Vollenhoven R, Aletaha D, Aringer M, Boers M, Buckley CD, Buttgereit F, Bykerk V, Cardiel M, Combe B, Cutolo M, van Eijk-Hustings Y, Emery P, Finckh A, Gabay C, Gomez-Reino J, Gossec L, Gottenberg JE, Hazes JMW, Huizinga T, Jani M, Karateev D, Kouloumas M, Kvien T, Li Z, Mariette X, McInnes I, Mysler E, Nash P, Pavelka K, Poor G, Richez C, van Riel P, Rubbert-Roth A, Saag K, da Silva J, Stamm T, Takeuchi T, Westhovens R, de Wit M, van der Heijde D: EULAR recommendations for the management of rheumatoid arthritis with synthetic and biological disease-modifying antirheumatic drugs: 2016 update. Ann Rheum Dis. 2017 Jun;76(6):960-977. doi: 10.1136/annrheumdis-2016-210715. Epub 2017 Mar 6. [PubMed:28264816]
  4. Kampan NC, Xiang SD, McNally OM, Stephens AN, Quinn MA, Plebanski M: Immunotherapeutic Interleukin-6 or Interleukin-6 receptor blockade in cancer: challenges and opportunities. Curr Med Chem. 2017 Jul 12. doi: 10.2174/0929867324666170712160621. [PubMed:28707587]
  5. Lin P: Targeting interleukin-6 for noninfectious uveitis. Clin Ophthalmol. 2015 Sep 11;9:1697-702. doi: 10.2147/OPTH.S68595. eCollection 2015. [PubMed:26392750]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. ema.europa [Link]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. ema.europa [Link]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. ema.europa [Link]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. ema.europa [Link]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. ema.europa [Link]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
No
Actions
Inducer
General Function
Pyridoxal phosphate binding
Specific Function
Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting wi...
Gene Name
GPT
Uniprot ID
P24298
Uniprot Name
Alanine aminotransferase 1
Molecular Weight
54636.415 Da
References
  1. Kevzara product monograph [Link]
Kind
Protein
Organism
Human
Pharmacological action
No
Actions
Inducer
General Function
Pyridoxal phosphate binding
Specific Function
Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate.
Gene Name
GPT2
Uniprot ID
Q8TD30
Uniprot Name
Alanine aminotransferase 2
Molecular Weight
57903.11 Da
References
  1. Kevzara product monograph [Link]
Kind
Protein
Organism
Human
Pharmacological action
No
Actions
Inducer
General Function
Pyridoxal phosphate binding
Specific Function
Not Available
Gene Name
GIG18
Uniprot ID
Q2TU84
Uniprot Name
Aspartate aminotransferase
Molecular Weight
46319.2 Da
References
  1. Kevzara product monograph [Link]
Kind
Protein
Organism
Human
Pharmacological action
No
Actions
Inhibitor
General Function
Vitamin d3 25-hydroxylase activity
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation react...
Gene Name
CYP3A4
Uniprot ID
P08684
Uniprot Name
Cytochrome P450 3A4
Molecular Weight
57342.67 Da
References
  1. ema.europa [Link]

Drug created on October 20, 2016 14:46 / Updated on July 13, 2018 01:14