Identification

Name
Protein S human
Accession Number
DB13149
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Blood factors
Description

Protein S human is a vitamin K-dependent plasma glycoprotein which has antcoagulant properties [1]. It serves as a negative feedback mechanism in the coagulation cascade.

Protein structure
Db13149
Protein chemical formula
Not Available
Protein average weight
75123.0 Da
Sequences
>sp|P07225|PROS_HUMAN Vitamin K-dependent protein S OS=Homo sapiens GN=PROS1 PE=1 SV=1
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIE
ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQ
CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG
SYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS
CEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIE
VQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE
KGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLV
DSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL
QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHND
IRAHSCPSVWKKTKNS
Download FASTA Format
Synonyms
  • Protein S
  • Protein S (human)
  • Vitamin K-dependent protein S
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Beriplex P/n 1000Protein S human (1360 unit) + Coagulation Factor IX Human (1240 unit) + Coagulation factor VII human (1000 unit) + Coagulation factor X human (2040 unit) + Protein C (1640 unit) + Prothrombin (1600 unit)Powder, for solutionIntravenousCsl Behring2013-11-21Not applicableCanada
Beriplex P/n 500Protein S human (680 unit) + Coagulation Factor IX Human (620 unit) + Coagulation factor VII human (500 unit) + Coagulation factor X human (1020 unit) + Protein C (820 unit) + Prothrombin (800 unit)Powder, for solutionIntravenousCsl Behring2011-07-28Not applicableCanada
KcentraProtein S human + Coagulation Factor IX Human + Coagulation factor VII human + Coagulation factor X human + Protein C + Prothrombin + WaterKitCsl Behring2013-12-13Not applicableUs
KcentraProtein S human + Coagulation Factor IX Human + Coagulation factor VII human + Coagulation factor X human + Protein C + Prothrombin + WaterKitCsl Behring2013-04-29Not applicableUs
OctaplexProtein S human (1280 unit) + Coagulation Factor IX Human (1000 unit) + Coagulation factor VII human (960 unit) + Coagulation factor X human (1200 unit) + Protein C (1240 unit) + Prothrombin (1520 unit)Kit; Powder, for solutionIntravenousOctapharma Pharmazeutika Produktionsges M B H2015-08-11Not applicableCanada
OctaplexProtein S human (640 unit) + Coagulation Factor IX Human (500 unit) + Coagulation factor VII human (480 unit) + Coagulation factor X human (600 unit) + Protein C (620 unit) + Prothrombin (760 unit)Kit; Powder, for solutionIntravenousOctapharma Pharmazeutika Produktionsges M B H2008-07-08Not applicableCanada
Categories
UNII
90J3F6N5FN
CAS number
Not Available

Pharmacology

Indication

For use in the emergency reversal of coagulation factor deficiency in patients recieving vitamin K antagonist therapy [FDA Label]. Protein S is administered as part of a cocktail containing several other coagulation factors.

Structured Indications
Pharmacodynamics

Protein S acts as an anticoagulant serves as a negative feedback mechanism in the coagulation cascade [1].

Mechanism of action

Thrombin converts protein C to activated protein C (APC) [1]. Protein S functions as a cofactor for APC and together they proteolytically cleave factor Va and VIIIa [1] [2]. This inhibits the activities of the prothrombinase and tenase complexes respectively and leads to a reduction in thrombin generation. The reduction in thrombin generation suppresses the coagulation cascade preventing additional clotting from occuring. Protein S is suggested to inhibit factors Va and Xa through protein-protein interactions [4] [1]. Protein S is also suggested to inhibit production of factor Xa by the tenase complex by competing for binding to phospholipids via its gamma-carboxyglutamic acid domain.

Protein S is thought to exert an anti-inflammatory effect in addition to its anticoagulant properties. The protein S-C4b-binding protein complex is believed to bind to phosphotidylserines on the cell membranes of apoptotic cells and interact with macrophages, signalling them to phagocytose the cell before it can rupture [3].

TargetActionsOrganism
ACoagulation factor V
antagonist
Human
ACoagulation factor X
antagonist
Human
AVitamin K-dependent protein C
cofactor
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding

Approximately 60% of protein S is bound to C4b-binding protein in systemic circulation [1].

Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
(4R)-limonene(4R)-limonene may increase the anticoagulant activities of Protein S human.Investigational
AbciximabAbciximab may increase the anticoagulant activities of Protein S human.Approved
AceclofenacAceclofenac may increase the anticoagulant activities of Protein S human.Approved, Investigational
AcemetacinThe risk or severity of bleeding can be increased when Protein S human is combined with Acemetacin.Approved, Experimental, Investigational
AcenocoumarolAcenocoumarol may increase the anticoagulant activities of Protein S human.Approved, Investigational
Acetylsalicylic acidAcetylsalicylic acid may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
AdapaleneAdapalene may increase the anticoagulant activities of Protein S human.Approved
AlclofenacAlclofenac may increase the anticoagulant activities of Protein S human.Approved, Withdrawn
AllylestrenolThe therapeutic efficacy of Protein S human can be decreased when used in combination with Allylestrenol.Approved
AlminoprofenAlminoprofen may increase the anticoagulant activities of Protein S human.Experimental
AloxiprinAloxiprin may increase the anticoagulant activities of Protein S human.Experimental
AlprostadilAlprostadil may increase the anticoagulant activities of Protein S human.Approved, Investigational
AlteplaseAlteplase may increase the anticoagulant activities of Protein S human.Approved
AltrenogestThe therapeutic efficacy of Protein S human can be decreased when used in combination with Altrenogest.Vet Approved
Aminosalicylic AcidAminosalicylic Acid may increase the anticoagulant activities of Protein S human.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Protein S human.Approved
AncrodAncrod may increase the anticoagulant activities of Protein S human.Approved, Investigational
AndrographolideAndrographolide may increase the anticoagulant activities of Protein S human.Investigational
AnisodamineAnisodamine may increase the anticoagulant activities of Protein S human.Investigational
AnistreplaseAnistreplase may increase the anticoagulant activities of Protein S human.Approved
AntipyrineAntipyrine may increase the anticoagulant activities of Protein S human.Approved, Investigational
Antithrombin III humanAntithrombin III human may increase the anticoagulant activities of Protein S human.Approved
ApixabanApixaban may increase the anticoagulant activities of Protein S human.Approved
ApocyninApocynin may increase the anticoagulant activities of Protein S human.Investigational
ApremilastApremilast may increase the anticoagulant activities of Protein S human.Approved, Investigational
ArdeparinArdeparin may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
ArgatrobanArgatroban may increase the anticoagulant activities of Protein S human.Approved, Investigational
AstaxanthinAstaxanthin may increase the anticoagulant activities of Protein S human.Investigational
AzapropazoneAzapropazone may increase the anticoagulant activities of Protein S human.Withdrawn
AzelastineAzelastine may increase the anticoagulant activities of Protein S human.Approved
Azficel-TThe risk or severity of adverse effects can be increased when Protein S human is combined with Azficel-T.Approved, Investigational
BalsalazideBalsalazide may increase the anticoagulant activities of Protein S human.Approved, Investigational
BatroxobinBatroxobin may increase the anticoagulant activities of Protein S human.Experimental
BecaplerminBecaplermin may increase the anticoagulant activities of Protein S human.Approved, Investigational
BemiparinBemiparin may increase the anticoagulant activities of Protein S human.Approved, Investigational
BendazacBendazac may increase the anticoagulant activities of Protein S human.Experimental
BenorilateBenorilate may increase the anticoagulant activities of Protein S human.Experimental
BenoxaprofenBenoxaprofen may increase the anticoagulant activities of Protein S human.Withdrawn
BenzydamineBenzydamine may increase the anticoagulant activities of Protein S human.Approved
BeraprostBeraprost may increase the anticoagulant activities of Protein S human.Investigational
BevoniumBevonium may increase the anticoagulant activities of Protein S human.Experimental
BivalirudinBivalirudin may increase the anticoagulant activities of Protein S human.Approved, Investigational
BrinaseBrinase may increase the anticoagulant activities of Protein S human.Experimental
BromfenacBromfenac may increase the anticoagulant activities of Protein S human.Approved
BucillamineBucillamine may increase the anticoagulant activities of Protein S human.Investigational
BufexamacBufexamac may increase the anticoagulant activities of Protein S human.Approved, Experimental
BuflomedilBuflomedil may increase the anticoagulant activities of Protein S human.Experimental
BumadizoneBumadizone may increase the anticoagulant activities of Protein S human.Experimental
ButylphthalideButylphthalide may increase the anticoagulant activities of Protein S human.Investigational
CangrelorCangrelor may increase the anticoagulant activities of Protein S human.Approved
CaplacizumabCaplacizumab may increase the anticoagulant activities of Protein S human.Investigational
Carbaspirin calciumCarbaspirin calcium may increase the anticoagulant activities of Protein S human.Experimental, Investigational
CarprofenCarprofen may increase the anticoagulant activities of Protein S human.Approved, Vet Approved, Withdrawn
CastanospermineCastanospermine may increase the anticoagulant activities of Protein S human.Experimental
CelecoxibCelecoxib may increase the anticoagulant activities of Protein S human.Approved, Investigational
CertoparinCertoparin may increase the anticoagulant activities of Protein S human.Approved, Investigational
ChloroquineChloroquine may increase the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Protein S human.Investigational, Withdrawn
Choline magnesium trisalicylateCholine magnesium trisalicylate may increase the anticoagulant activities of Protein S human.Approved
CilostazolCilostazol may increase the anticoagulant activities of Protein S human.Approved, Investigational
Citric AcidCitric Acid may increase the anticoagulant activities of Protein S human.Approved, Nutraceutical, Vet Approved
ClonixinClonixin may increase the anticoagulant activities of Protein S human.Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Protein S human.Approved
CloricromenCloricromen may increase the anticoagulant activities of Protein S human.Experimental
ClorindioneClorindione may increase the anticoagulant activities of Protein S human.Experimental
Collagenase clostridium histolyticumThe risk or severity of adverse effects can be increased when Protein S human is combined with Collagenase clostridium histolyticum.Approved, Investigational
Conjugated estrogensConjugated estrogens may decrease the anticoagulant activities of Protein S human.Approved
CurcuminCurcumin may increase the anticoagulant activities of Protein S human.Approved, Investigational
Dabigatran etexilateDabigatran etexilate may increase the anticoagulant activities of Protein S human.Approved
DaidzeinDaidzein may decrease the anticoagulant activities of Protein S human.Experimental
DalteparinDalteparin may increase the anticoagulant activities of Protein S human.Approved
DanaparoidDanaparoid may increase the anticoagulant activities of Protein S human.Approved, Withdrawn
DarexabanDarexaban may increase the anticoagulant activities of Protein S human.Investigational
DasatinibDasatinib may increase the anticoagulant activities of Protein S human.Approved, Investigational
DeferasiroxThe risk or severity of adverse effects can be increased when Protein S human is combined with Deferasirox.Approved, Investigational
DefibrotideDefibrotide may increase the anticoagulant activities of Protein S human.Approved, Investigational
DemegestoneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Demegestone.Experimental
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Protein S human is combined with Deoxycholic Acid.Approved
DersalazineDersalazine may increase the anticoagulant activities of Protein S human.Investigational
DesirudinDesirudin may increase the anticoagulant activities of Protein S human.Approved
DesmoteplaseDesmoteplase may increase the anticoagulant activities of Protein S human.Investigational
DesogestrelThe therapeutic efficacy of Protein S human can be decreased when used in combination with Desogestrel.Approved
DextranDextran may increase the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
DiclofenacDiclofenac may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
DicoumarolDicoumarol may increase the anticoagulant activities of Protein S human.Approved
DienestrolDienestrol may decrease the anticoagulant activities of Protein S human.Approved, Investigational
DienogestThe therapeutic efficacy of Protein S human can be decreased when used in combination with Dienogest.Approved
DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Protein S human.Approved, Investigational
DifenpiramideDifenpiramide may increase the anticoagulant activities of Protein S human.Experimental
DiflunisalDiflunisal may increase the anticoagulant activities of Protein S human.Approved, Investigational
DiphenadioneDiphenadione may increase the anticoagulant activities of Protein S human.Experimental
DipyridamoleDipyridamole may increase the anticoagulant activities of Protein S human.Approved
DitazoleDitazole may increase the anticoagulant activities of Protein S human.Approved, Withdrawn
Drotrecogin alfaDrotrecogin alfa may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
DroxicamDroxicam may increase the anticoagulant activities of Protein S human.Withdrawn
DuvelisibDuvelisib may increase the anticoagulant activities of Protein S human.Investigational
DydrogesteroneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Dydrogesterone.Approved, Investigational, Withdrawn
E-6201E-6201 may increase the anticoagulant activities of Protein S human.Investigational
Edetic AcidEdetic Acid may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
EdoxabanEdoxaban may increase the anticoagulant activities of Protein S human.Approved
EnoxaparinEnoxaparin may increase the anticoagulant activities of Protein S human.Approved
EpimestrolEpimestrol may decrease the anticoagulant activities of Protein S human.Experimental
EpinastineEpinastine may increase the anticoagulant activities of Protein S human.Approved, Investigational
EpirizoleEpirizole may increase the anticoagulant activities of Protein S human.Approved
EplivanserinEplivanserin may increase the anticoagulant activities of Protein S human.Investigational
eplivanserineeplivanserine may increase the anticoagulant activities of Protein S human.Investigational
EpoprostenolEpoprostenol may increase the anticoagulant activities of Protein S human.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Protein S human.Approved, Investigational
EquolEquol may decrease the anticoagulant activities of Protein S human.Investigational
EstradiolEstradiol may decrease the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
Estradiol acetateEstradiol acetate may decrease the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
Estradiol cypionateEstradiol cypionate may decrease the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
Estradiol valerateEstradiol valerate may decrease the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
EstriolEstriol may decrease the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
Estrogens, esterifiedEstrogens, esterified may decrease the anticoagulant activities of Protein S human.Approved
EstroneEstrone may decrease the anticoagulant activities of Protein S human.Approved
EtanerceptEtanercept may increase the anticoagulant activities of Protein S human.Approved, Investigational
EthenzamideEthenzamide may increase the anticoagulant activities of Protein S human.Experimental
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Protein S human.Approved
Ethyl biscoumacetateEthyl biscoumacetate may increase the anticoagulant activities of Protein S human.Withdrawn
EthynodiolThe therapeutic efficacy of Protein S human can be decreased when used in combination with Ethynodiol.Experimental
EtodolacEtodolac may increase the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
EtofenamateEtofenamate may increase the anticoagulant activities of Protein S human.Approved, Investigational
EtonogestrelThe therapeutic efficacy of Protein S human can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoricoxibEtoricoxib may increase the anticoagulant activities of Protein S human.Approved, Investigational
Evening primrose oilEvening primrose oil may increase the anticoagulant activities of Protein S human.Approved, Investigational
ExisulindExisulind may increase the anticoagulant activities of Protein S human.Investigational
FelbinacFelbinac may increase the anticoagulant activities of Protein S human.Experimental
FenbufenFenbufen may increase the anticoagulant activities of Protein S human.Approved
FenoprofenFenoprofen may increase the anticoagulant activities of Protein S human.Approved
FentiazacFentiazac may increase the anticoagulant activities of Protein S human.Experimental
FeprazoneFeprazone may increase the anticoagulant activities of Protein S human.Experimental
Ferulic acidFerulic acid may increase the anticoagulant activities of Protein S human.Experimental
FibrinolysinFibrinolysin may increase the anticoagulant activities of Protein S human.Investigational
FloctafenineFloctafenine may increase the anticoagulant activities of Protein S human.Approved, Withdrawn
FluindioneFluindione may increase the anticoagulant activities of Protein S human.Approved, Investigational
FlunixinFlunixin may increase the anticoagulant activities of Protein S human.Vet Approved
FlunoxaprofenFlunoxaprofen may increase the anticoagulant activities of Protein S human.Experimental
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Protein S human.Approved, Investigational
FondaparinuxFondaparinux may increase the anticoagulant activities of Protein S human.Approved, Investigational
Fondaparinux sodiumFondaparinux sodium may increase the anticoagulant activities of Protein S human.Approved, Investigational
GabexateGabexate may increase the anticoagulant activities of Protein S human.Investigational
GenisteinGenistein may decrease the anticoagulant activities of Protein S human.Investigational
GestodeneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Gestodene.Approved, Investigational
GestonoroneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Gestonorone.Experimental
GestrinoneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Gestrinone.Approved
GuacetisalGuacetisal may increase the anticoagulant activities of Protein S human.Experimental
HeminHemin may increase the anticoagulant activities of Protein S human.Approved, Investigational
Hemoglobin crosfumarilHemoglobin crosfumaril may increase the anticoagulant activities of Protein S human.Experimental
HeparinHeparin may increase the anticoagulant activities of Protein S human.Approved, Investigational
HexestrolHexestrol may decrease the anticoagulant activities of Protein S human.Withdrawn
HigenamineHigenamine may increase the anticoagulant activities of Protein S human.Investigational
Hydroxyprogesterone caproateThe therapeutic efficacy of Protein S human can be decreased when used in combination with Hydroxyprogesterone caproate.Approved, Investigational
HydroxytyrosolHydroxytyrosol may increase the anticoagulant activities of Protein S human.Investigational
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Protein S human is combined with Ibritumomab tiuxetan.Approved, Investigational
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Protein S human.Approved
IbudilastIbudilast may increase the anticoagulant activities of Protein S human.Approved, Investigational
IbuprofenIbuprofen may increase the anticoagulant activities of Protein S human.Approved
IbuproxamIbuproxam may increase the anticoagulant activities of Protein S human.Withdrawn
IcatibantIcatibant may increase the anticoagulant activities of Protein S human.Approved, Investigational
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Protein S human.Approved, Investigational, Nutraceutical
IdraparinuxIdraparinux may increase the anticoagulant activities of Protein S human.Investigational
IfenprodilIfenprodil may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
IfetrobanIfetroban may increase the anticoagulant activities of Protein S human.Investigational
IloprostIloprost may increase the anticoagulant activities of Protein S human.Approved, Investigational
Imidazole salicylateImidazole salicylate may increase the anticoagulant activities of Protein S human.Experimental
IndobufenIndobufen may increase the anticoagulant activities of Protein S human.Investigational
IndomethacinIndomethacin may increase the anticoagulant activities of Protein S human.Approved, Investigational
IndoprofenIndoprofen may increase the anticoagulant activities of Protein S human.Withdrawn
IsoxicamIsoxicam may increase the anticoagulant activities of Protein S human.Withdrawn
KebuzoneKebuzone may increase the anticoagulant activities of Protein S human.Experimental
KetanserinKetanserin may increase the anticoagulant activities of Protein S human.Investigational
KetoprofenKetoprofen may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
KetorolacKetorolac may increase the anticoagulant activities of Protein S human.Approved
LeflunomideLeflunomide may increase the anticoagulant activities of Protein S human.Approved, Investigational
LepirudinLepirudin may increase the anticoagulant activities of Protein S human.Approved
LetaxabanLetaxaban may increase the anticoagulant activities of Protein S human.Investigational
LevonorgestrelThe therapeutic efficacy of Protein S human can be decreased when used in combination with Levonorgestrel.Approved, Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Protein S human.Approved, Investigational
LinsidomineLinsidomine may increase the anticoagulant activities of Protein S human.Experimental
LisofyllineLisofylline may increase the anticoagulant activities of Protein S human.Investigational
LonazolacLonazolac may increase the anticoagulant activities of Protein S human.Experimental
LornoxicamLornoxicam may increase the anticoagulant activities of Protein S human.Approved, Investigational
LoxoprofenLoxoprofen may increase the anticoagulant activities of Protein S human.Approved, Investigational
LumiracoxibLumiracoxib may increase the anticoagulant activities of Protein S human.Approved, Investigational
Magnesium salicylateMagnesium salicylate may increase the anticoagulant activities of Protein S human.Approved
MasoprocolMasoprocol may increase the anticoagulant activities of Protein S human.Approved, Investigational
Meclofenamic acidMeclofenamic acid may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
MedrogestoneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Medrogestone.Approved
Medroxyprogesterone acetateThe therapeutic efficacy of Protein S human can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Protein S human.Approved
Megestrol acetateThe therapeutic efficacy of Protein S human can be decreased when used in combination with Megestrol acetate.Approved, Investigational, Vet Approved
MelagatranProtein S human may increase the anticoagulant activities of Melagatran.Experimental
MeloxicamMeloxicam may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
MesalazineMesalazine may increase the anticoagulant activities of Protein S human.Approved
MestranolMestranol may decrease the anticoagulant activities of Protein S human.Approved
MetamizoleMetamizole may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
MethallenestrilMethallenestril may decrease the anticoagulant activities of Protein S human.Experimental
Methyl salicylateMethyl salicylate may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
MethylestrenoloneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Methylestrenolone.Experimental
MilrinoneMilrinone may increase the anticoagulant activities of Protein S human.Approved
MizoribineMizoribine may increase the anticoagulant activities of Protein S human.Investigational
MofebutazoneMofebutazone may increase the anticoagulant activities of Protein S human.Experimental
MoxestrolMoxestrol may decrease the anticoagulant activities of Protein S human.Experimental
Mycophenolate mofetilMycophenolate mofetil may increase the anticoagulant activities of Protein S human.Approved, Investigational
Mycophenolic acidMycophenolic acid may increase the anticoagulant activities of Protein S human.Approved
NabumetoneNabumetone may increase the anticoagulant activities of Protein S human.Approved
NadroparinNadroparin may increase the anticoagulant activities of Protein S human.Approved, Investigational
NafamostatNafamostat may increase the anticoagulant activities of Protein S human.Approved, Investigational
NaftifineNaftifine may increase the anticoagulant activities of Protein S human.Approved
NaftopidilNaftopidil may increase the anticoagulant activities of Protein S human.Investigational
NaproxenNaproxen may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
NepafenacNepafenac may increase the anticoagulant activities of Protein S human.Approved, Investigational
NifenazoneNifenazone may increase the anticoagulant activities of Protein S human.Experimental
Niflumic AcidNiflumic Acid may increase the anticoagulant activities of Protein S human.Approved
NimesulideNimesulide may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
NintedanibThe risk or severity of adverse effects can be increased when Protein S human is combined with Nintedanib.Approved
NitroaspirinNitroaspirin may increase the anticoagulant activities of Protein S human.Investigational
NomegestrolThe therapeutic efficacy of Protein S human can be decreased when used in combination with Nomegestrol.Approved
NorethisteroneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Norethisterone.Approved
NorgestrienoneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Norgestrienone.Experimental
ObinutuzumabThe risk or severity of adverse effects can be increased when Protein S human is combined with Obinutuzumab.Approved, Investigational
OlopatadineOlopatadine may increase the anticoagulant activities of Protein S human.Approved
OlsalazineOlsalazine may increase the anticoagulant activities of Protein S human.Approved
Omacetaxine mepesuccinateThe risk or severity of bleeding can be increased when Protein S human is combined with Omacetaxine mepesuccinate.Approved, Investigational
Omega-3 fatty acidsOmega-3 fatty acids may increase the anticoagulant activities of Protein S human.Approved, Nutraceutical
Omega-3-carboxylic acidsThe therapeutic efficacy of Protein S human can be increased when used in combination with Omega-3-carboxylic acids.Approved, Investigational
OrgoteinOrgotein may increase the anticoagulant activities of Protein S human.Vet Approved
OtamixabanOtamixaban may increase the anticoagulant activities of Protein S human.Investigational
OxaprozinOxaprozin may increase the anticoagulant activities of Protein S human.Approved
OxyphenbutazoneOxyphenbutazone may increase the anticoagulant activities of Protein S human.Approved, Withdrawn
OzagrelOzagrel may increase the anticoagulant activities of Protein S human.Investigational
ParecoxibParecoxib may increase the anticoagulant activities of Protein S human.Approved
ParnaparinParnaparin may increase the anticoagulant activities of Protein S human.Approved, Investigational
ParthenolideParthenolide may increase the anticoagulant activities of Protein S human.Approved, Investigational
Pentaerythritol TetranitratePentaerythritol Tetranitrate may increase the anticoagulant activities of Protein S human.Approved
Pentosan PolysulfatePentosan Polysulfate may increase the anticoagulant activities of Protein S human.Approved
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Protein S human.Approved, Investigational
PhenindionePhenindione may increase the anticoagulant activities of Protein S human.Approved, Investigational
PhenprocoumonPhenprocoumon may increase the anticoagulant activities of Protein S human.Approved, Investigational
Phenyl aminosalicylatePhenyl aminosalicylate may increase the anticoagulant activities of Protein S human.Approved
PhenylbutazonePhenylbutazone may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
PicotamidePicotamide may increase the anticoagulant activities of Protein S human.Experimental
PimecrolimusPimecrolimus may increase the anticoagulant activities of Protein S human.Approved, Investigational
PirfenidonePirfenidone may increase the anticoagulant activities of Protein S human.Approved, Investigational
PiroxicamPiroxicam may increase the anticoagulant activities of Protein S human.Approved, Investigational
PirprofenPirprofen may increase the anticoagulant activities of Protein S human.Experimental
Polyestradiol phosphatePolyestradiol phosphate may decrease the anticoagulant activities of Protein S human.Approved
PranoprofenPranoprofen may increase the anticoagulant activities of Protein S human.Experimental, Investigational
PrasugrelPrasugrel may increase the anticoagulant activities of Protein S human.Approved
ProgesteroneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Progesterone.Approved, Vet Approved
ProglumetacinProglumetacin may increase the anticoagulant activities of Protein S human.Experimental
PromegestoneThe therapeutic efficacy of Protein S human can be decreased when used in combination with Promegestone.Experimental
PromestrienePromestriene may decrease the anticoagulant activities of Protein S human.Investigational
PropacetamolPropacetamol may increase the anticoagulant activities of Protein S human.Approved, Investigational
PropyphenazonePropyphenazone may increase the anticoagulant activities of Protein S human.Experimental
ProquazoneProquazone may increase the anticoagulant activities of Protein S human.Experimental
Protein CProtein C may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeProtocatechualdehyde may increase the anticoagulant activities of Protein S human.Approved
PTC299PTC299 may increase the anticoagulant activities of Protein S human.Investigational
QuinestrolQuinestrol may decrease the anticoagulant activities of Protein S human.Approved
RamatrobanRamatroban may increase the anticoagulant activities of Protein S human.Investigational
RelcovaptanRelcovaptan may increase the anticoagulant activities of Protein S human.Investigational
ResveratrolResveratrol may increase the anticoagulant activities of Protein S human.Approved, Experimental, Investigational
ReteplaseReteplase may increase the anticoagulant activities of Protein S human.Approved, Investigational
ReviparinReviparin may increase the anticoagulant activities of Protein S human.Approved, Investigational
RidogrelRidogrel may increase the anticoagulant activities of Protein S human.Approved
RivaroxabanProtein S human may increase the anticoagulant activities of Rivaroxaban.Approved
RofecoxibRofecoxib may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
RosiglitazoneRosiglitazone may increase the anticoagulant activities of Protein S human.Approved, Investigational
SalicylamideSalicylamide may increase the anticoagulant activities of Protein S human.Approved
Salicylic acidSalicylic acid may increase the anticoagulant activities of Protein S human.Approved, Investigational, Vet Approved
SalsalateSalsalate may increase the anticoagulant activities of Protein S human.Approved
SarpogrelateSarpogrelate may increase the anticoagulant activities of Protein S human.Investigational
SaruplaseSaruplase may increase the anticoagulant activities of Protein S human.Experimental
SecoisolariciresinolSecoisolariciresinol may decrease the anticoagulant activities of Protein S human.Investigational
SelexipagSelexipag may increase the anticoagulant activities of Protein S human.Approved
SemapimodSemapimod may increase the anticoagulant activities of Protein S human.Investigational
SeratrodastSeratrodast may increase the anticoagulant activities of Protein S human.Approved
SerrapeptaseSerrapeptase may increase the anticoagulant activities of Protein S human.Investigational
SevofluraneSevoflurane may increase the anticoagulant activities of Protein S human.Approved, Vet Approved
SRT501SRT501 may increase the anticoagulant activities of Protein S human.Investigational
StreptokinaseStreptokinase may increase the anticoagulant activities of Protein S human.Approved, Investigational
SugammadexSugammadex may increase the anticoagulant activities of Protein S human.Approved
SulfasalazineSulfasalazine may increase the anticoagulant activities of Protein S human.Approved
SulindacSulindac may increase the anticoagulant activities of Protein S human.Approved, Investigational
SulodexideSulodexide may increase the anticoagulant activities of Protein S human.Approved, Investigational
SuprofenSuprofen may increase the anticoagulant activities of Protein S human.Approved, Withdrawn
SuxibuzoneSuxibuzone may increase the anticoagulant activities of Protein S human.Experimental
Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Protein S human.Approved
Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Protein S human.Approved
TarenflurbilTarenflurbil may increase the anticoagulant activities of Protein S human.Investigational
TenecteplaseTenecteplase may increase the anticoagulant activities of Protein S human.Approved
TenidapTenidap may increase the anticoagulant activities of Protein S human.Experimental
TenoxicamTenoxicam may increase the anticoagulant activities of Protein S human.Approved
TepoxalinTepoxalin may increase the anticoagulant activities of Protein S human.Vet Approved
TeriflunomideTeriflunomide may increase the anticoagulant activities of Protein S human.Approved
TesmilifeneTesmilifene may increase the anticoagulant activities of Protein S human.Investigational
Testosterone cypionateThe therapeutic efficacy of Protein S human can be increased when used in combination with Testosterone cypionate.Approved
Testosterone enanthateThe therapeutic efficacy of Protein S human can be increased when used in combination with Testosterone enanthate.Approved
Testosterone undecanoateThe therapeutic efficacy of Protein S human can be increased when used in combination with Testosterone undecanoate.Approved, Investigational
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Protein S human.Approved
TiboloneTibolone may increase the anticoagulant activities of Protein S human.Approved, Investigational
TicagrelorTicagrelor may increase the anticoagulant activities of Protein S human.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Protein S human.Approved
TinoridineTinoridine may increase the anticoagulant activities of Protein S human.Investigational
TinzaparinTinzaparin may increase the anticoagulant activities of Protein S human.Approved
TioclomarolTioclomarol may increase the anticoagulant activities of Protein S human.Experimental
TipranavirTipranavir may increase the anticoagulant activities of Protein S human.Approved, Investigational
TirofibanTirofiban may increase the anticoagulant activities of Protein S human.Approved
Tolfenamic AcidTolfenamic Acid may increase the anticoagulant activities of Protein S human.Approved, Investigational
TolmetinTolmetin may increase the anticoagulant activities of Protein S human.Approved
TositumomabThe risk or severity of adverse effects can be increased when Protein S human is combined with Tositumomab.Approved, Investigational
TranilastTranilast may increase the anticoagulant activities of Protein S human.Approved, Investigational
TrapidilTrapidil may increase the anticoagulant activities of Protein S human.Approved
TreprostinilTreprostinil may increase the anticoagulant activities of Protein S human.Approved, Investigational
TribenosideTribenoside may increase the anticoagulant activities of Protein S human.Experimental
TriflusalTriflusal may increase the anticoagulant activities of Protein S human.Approved, Investigational
TriptolideTriptolide may increase the anticoagulant activities of Protein S human.Investigational
Trolamine salicylateTrolamine salicylate may increase the anticoagulant activities of Protein S human.Approved
TroxerutinTroxerutin may increase the anticoagulant activities of Protein S human.Investigational
UrokinaseUrokinase may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
ValdecoxibValdecoxib may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
Vitamin EVitamin E may increase the anticoagulant activities of Protein S human.Approved, Nutraceutical, Vet Approved
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Protein S human.Approved
WarfarinWarfarin may increase the anticoagulant activities of Protein S human.Approved
XimelagatranXimelagatran may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
ZaltoprofenZaltoprofen may increase the anticoagulant activities of Protein S human.Approved, Investigational
ZeranolZeranol may decrease the anticoagulant activities of Protein S human.Vet Approved
ZileutonZileuton may increase the anticoagulant activities of Protein S human.Approved, Investigational, Withdrawn
ZomepiracZomepirac may increase the anticoagulant activities of Protein S human.Withdrawn
Food Interactions
Not Available

References

General References
  1. Rigby AC, Grant MA: Protein S: a conduit between anticoagulation and inflammation. Crit Care Med. 2004 May;32(5 Suppl):S336-41. [PubMed:15118541]
  2. Somajo S, Koshiar RL, Norstrom E, Dahlback B: Protein S and factor V in regulation of coagulation on platelet microparticles by activated protein C. Thromb Res. 2014 Jul;134(1):144-52. doi: 10.1016/j.thromres.2014.04.031. Epub 2014 May 2. [PubMed:24835672]
  3. Webb JH, Blom AM, Dahlback B: Vitamin K-dependent protein S localizing complement regulator C4b-binding protein to the surface of apoptotic cells. J Immunol. 2002 Sep 1;169(5):2580-6. [PubMed:12193728]
  4. Hackeng TM, van 't Veer C, Meijers JC, Bouma BN: Human protein S inhibits prothrombinase complex activity on endothelial cells and platelets via direct interactions with factors Va and Xa. J Biol Chem. 1994 Aug 19;269(33):21051-8. [PubMed:8063724]
External Links
PubChem Substance
347911433
FDA label
Download (638 KB)
MSDS
Download (744 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3CompletedTreatmentReversal of Anticoagulant Treatment1
3RecruitingTreatmentSignificant Bleeding Risk1
4Unknown StatusTreatmentPostpartum Hemorrhage1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Powder, for solutionIntravenous
Kit
Kit; powder, for solutionIntravenous
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Copper ion binding
Specific Function
Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
Gene Name
F5
Uniprot ID
P12259
Uniprot Name
Coagulation factor V
Molecular Weight
251701.245 Da
References
  1. Hackeng TM, van 't Veer C, Meijers JC, Bouma BN: Human protein S inhibits prothrombinase complex activity on endothelial cells and platelets via direct interactions with factors Va and Xa. J Biol Chem. 1994 Aug 19;269(33):21051-8. [PubMed:8063724]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Serine-type endopeptidase activity
Specific Function
Factor Xa is a vitamin K-dependent glycoprotein that converts prothrombin to thrombin in the presence of factor Va, calcium and phospholipid during blood clotting.
Gene Name
F10
Uniprot ID
P00742
Uniprot Name
Coagulation factor X
Molecular Weight
54731.255 Da
References
  1. Hackeng TM, van 't Veer C, Meijers JC, Bouma BN: Human protein S inhibits prothrombinase complex activity on endothelial cells and platelets via direct interactions with factors Va and Xa. J Biol Chem. 1994 Aug 19;269(33):21051-8. [PubMed:8063724]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Cofactor
General Function
Serine-type endopeptidase activity
Specific Function
Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids (PubMed:25618265). Exerts ...
Gene Name
PROC
Uniprot ID
P04070
Uniprot Name
Vitamin K-dependent protein C
Molecular Weight
52070.82 Da
References
  1. Somajo S, Koshiar RL, Norstrom E, Dahlback B: Protein S and factor V in regulation of coagulation on platelet microparticles by activated protein C. Thromb Res. 2014 Jul;134(1):144-52. doi: 10.1016/j.thromres.2014.04.031. Epub 2014 May 2. [PubMed:24835672]

Drug created on November 18, 2016 13:51 / Updated on May 02, 2018 00:29