| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-02-19 16:04:57 |
| Primary Accession Number |
DB00951 |
| Secondary Accession Number |
|
| Name |
Isoniazid |
| Drug Type |
|
| Description |
Antibacterial agent used primarily as a tuberculostatic. It remains the treatment of choice for tuberculosis. [PubChem] |
| Synonyms |
- HIA
- Hydrazid
- Hydrazide
- INH
- Isohydrazide
- Isonicotinhydrazid
- Isonicotinic acid hydrazide
- Isonicotinic hydrazide
- Isonicotinohydrazide
- Isonicotinoyl hydrazide
- Isonicotinyl hydrazide
- Isonicotinyl hydrazine
- Isonicotinylhydrazine
|
| Brand Names |
- Andrazide
- Antimicina
- Antituberkulosum
- Armacide
- Armazid
- Armazide
- Atcotibine
- Azuren
- Bacillin
- Cedin
- Cemidon
- Chemiazid
- Chemidon
- Cortinazine
- Cotinazin
- Cotinizin
- Defonin
- Dibutin
- Diforin
- Dinacrin
- Ditubin
- Ebidene
- Eralon
- Ertuban
- Eutizon
- Evalon
- FSR 3
- Fimalene
- GINK
- Hidranizil
- Hidrasonil
- Hidrulta
- Hidrun
- Hycozid
- Hyozid
- Hyzyd
- Ido-tebin
- Idrazil
- Inah
- Inizid
- Iscotin
- Isidrina
- Ismazide
- Isobicina
- Isocid
- Isocidene
- Isocotin
- Isolyn
- Isonerit
- Isonex
- Isoniacid
- Isoniazid SA
- Isoniazide
- Isonicazide
- Isonicid
- Isonico
- Isonicotan
- Isonicotil
- Isonide
- Isonidrin
- Isonikazid
- Isonilex
- Isonin
- Isonindon
- Isonirit
- Isoniton
- Isonizide
- Isopyrin
- Isotamine
- Isotebe
- Isotebezid
- Isotinyl
- Isozide
- Isozyd
- Laniazid
- Laniozid
- Mybasan
- Neo-Tizide
- Neoteben
- Neoxin
- Neumandin
- Nevin
- Niadrin
- Nicazide
- Nicetal
- Nicizina
- Niconyl
- Nicotibina
- Nicotibine
- Nicotisan
- Nicozide
- Nidaton
- Nidrazid
- Nikozid
- Niplen
- Nitadon
- Nydrazid
- Nyscozid
- Pelazid
- Percin
- Phthisen
- Pycazide
- Pyreazid
- Pyricidin
- Pyridicin
- Pyrizidin
- Raumanon
- Razide
- Retozide
- Rifamate
- Rimicid
- Rimifon
- Rimiphone
- Rimitsid
- Robiselin
- Robisellin
- Roxifen
- Sanohidrazina
- Sauterazid
- Sauterzid
- Stanozide
- TB-Phlogin
- TB-Razide
- TB-Vis
- Tebecid
- Tebenic
- Tebexin
- Tebilon
- Tebos
- Teebaconin
- Tekazin
- Tibazide
- Tibemid
- Tibison
- Tibivis
- Tibusan
- Tubazid
- Tubazide
- Tubeco
- Tubecotubercid
- Tuberian
- Tubicon
- Tubilysin
- Tubomel
- Tyvid
- Unicocyde
- Unicozyde
- Vazadrine
- Vederon
- Zidafimia
- Zinadon
- Zonazide
|
| Brand Mixtures |
- Isotamine B 300 (Isoniazid + Pyridoxine Hydrochloride)
- Rifater (Isoniazid + Pyrazinamide + Rifampin)
|
| Chemical IUPAC Name |
pyridine-4-carbohydrazide |
| Chemical Formula |
C6H7N3O |
| Chemical Structure |
 |
| CAS Registry Number |
54-85-3 |
| InChI Identifier |
InChI=1/C6H7N3O/c7-9-6(10)5-1-3-8-4-2-5/h1-4H,7H2,(H,9,10)/f/h9H |
| InChI Key |
QRXWMOHMRWLFEY-BGGKNDAXCZ |
| KEGG Drug |
D00346  |
| KEGG Compound |
C07054  |
| PubChem Compound |
3767  |
| PubChem Substance |
9266  |
| ChEBI ID |
6030  |
| PharmGKB ID |
PA450112  |
| HET ID |
ISZ  |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
00577782  |
| RxList Link |
http://www.rxlist.com/cgi/generic2/isoniaz.htm  |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Isoniazid  |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
137.1393 |
| Monoisotopic Molecular Weight |
137.0589 |
| State |
Solid |
| Melting Point |
171.4 oC |
| Experimental Water Solubility |
140 mg/mL
Source: PhysProp
|
| Predicted Water Solubility |
3.49e+01 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
-0.8
Source: PhysProp
|
| Predicted LogP |
-0.71
Calculated using ALOGPS
|
| Experimental LogS |
0.01 [ADME Research, USCD] |
| Predicted LogS |
-0.59
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
1.82 |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
NNC(=O)C1=CC=NC=C1 |
| Canonical SMILES |
NNC(=O)C1=CC=NC=C1 |
| Drug Category |
- Antitubercular Agents
- Fatty Acid Synthesis Inhibitors
|
| ATC Codes |
|
| AHFS Codes |
|
| Indication |
For the treatment of all forms of tuberculosis in which organisms are susceptible. |
| Pharmacology |
Isoniazid is a bactericidal agent active against organisms of the genus Mycobacterium, specifically M. tuberculosis, M. bovis and M. kansasii. It is a highly specific agent, ineffective against other microorganisms. Isoniazid is bactericidal to rapidly-dividing mycobacteria, but is bacteriostatic if the mycobacterium is slow-growing. |
| Mechanism of Action |
Isoniazid is a prodrug and must be activated by bacterial catalase. Specficially, activation is associated with reduction of the mycobacterial ferric KatG catalase-peroxidase by hydrazine and reaction with oxygen to form an oxyferrous enzyme complex. Once activated, isoniazid inhibits the synthesis of mycoloic acids, an essential component of the bacterial cell wall. At therapeutic levels isoniazid is bacteriocidal against actively growing intracellular and extracellular Mycobacterium tuberculosis organisms. Specifically isoniazid inhibits InhA, the enoyl reductase from Mycobacterium tuberculosis, by forming a covalent adduct with the NAD cofactor. It is the INH-NAD adduct that acts as a slow, tight-binding competitive inhibitor of InhA. |
| Absorption |
Readily absorbed following oral administration; however, may undergo significant first pass metabolism. Absorption and bioavailability are reduced when isoniazid is administered with food. |
| Toxicity |
LD50 100 mg/kg (Human, oral). Adverse reactions include rash, abnormal liver function tests, hepatitis, peripheral neuropathy, mild central nervous system (CNS) effects. In vivo, Isoniazid reacts with pyridoxal to form a hydrazone, and thus inhibits generation of pyridoxal phosphate. Isoniazid also combines with pyridoxal phosphate; high doses interfere with the coenzyme function of the latter. |
| Protein Binding |
Very low (0-10%) |
| Biotransformation |
Primarily hepatic. Isoniazid is acetylated by N -acetyl transferase to N -acetylisoniazid; it is then biotransformed to isonicotinic acid and monoacetylhydrazine. Monoacetylhydrazine is associated with hepatotoxicity via formation of a reactive intermediate metabolite when N-hydroxylated by the cytochrome P450 mixed oxidase system. The rate of acetylation is genetically determined. Slow acetylators are characterized by a relative lack of hepatic N -acetyltransferase. |
| Half Life |
Fast acetylators: 0.5 to 1.6 hours. Slow acetylators: 2 to 5 hours. |
| Dosage Forms |
| Form |
Route |
| Powder |
Oral |
| Syrup |
Oral |
| Tablet |
Oral |
|
| Patient Information |
Not Available |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
| Drug |
Interaction |
| Acenocoumarol |
The agent increases the effect of anticoagulant |
| Acetaminophen |
Risk of hepatotoxicity |
| Aminophylline |
Increases the effect and toxicity of theophylline |
| Anisindione |
The agent increases the effect of anticoagulant |
| Carbamazepine |
Carbamazepine effect is increased as is isoniazid toxicity |
| Dicumarol |
The agent increases the effect of anticoagulant |
| Disulfiram |
Increased risk of CNS adverse effects |
| Dyphylline |
Increases the effect and toxicity of theophylline |
| Ethotoin |
Isoniazid increases the effect of phenytoin in 20% of patients |
| Fosphenytoin |
Isoniazid increases the effect of phenytoin in 20% of patients |
| Ketoconazole |
Isoniazid decreases the effect of ketoconazole |
| Meperidine |
Possible episodes of hypotension |
| Mephenytoin |
Isoniazid increases the effect of phenytoin in 20% of patients |
| Oxtriphylline |
Increases the effect and toxicity of theophylline |
| Phenytoin |
Isoniazid increases the effect of phenytoin in 20% of patients |
| Theophylline |
Increases the effect and toxicity of theophylline |
| Warfarin |
The agent increases the effect of anticoagulant |
|
| Food Interactions |
- Avoid aged foods (cheese, red wine), pickled foods, cured foods (bacon/ham), chocolate, fava beans, beer, unless approved by your physician.
- Avoid alcohol.
- Do not take calcium, aluminum, magnesium or Iron supplements within 2 hours of taking this medication.
- Increase dietary intake of magnesium, folate, vitamin B6, B12, and/or consider taking a multivitamin.
- Take on empty stomach: 1 hour before or 2 hours after meals.
- Take with a full glass of water.
|
| Pathways |
Not Available
|
| General References |
- Drugs.com

- Wikipedia

- RxList

|
| Organisms Affected |
|
| Phase 1 Metabolizing Enzymes |
- Cytochrome P450 2E1 (CYP2E1)
|
| Targets |
- 4-aminobutyrate aminotransferase, mitochondrial
- Enoyl-[acyl-carrier-protein] reductase [NADH]
- Peroxidase/catalase T
- Arylamine N-acetyltransferase
|
|
Drug Target 1
[top]
|
| Target 1 ID |
280 |
| Target 1 Name |
4-aminobutyrate aminotransferase, mitochondrial |
| Target 1 Synonyms |
- (S)-3-amino-2-methylpropionate transaminase
- 4-aminobutyrate aminotransferase, mitochondrial precursor
- EC 2.6.1.19
- EC 2.6.1.22
- GABA aminotransferase
- GABA transaminase
- GABA-AT
- GABA-T
- Gamma-amino-N-butyrate transaminase
- L-AIBAT
|
| Target 1 Gene Name |
ABAT |
| Target 1 Protein Sequence |
>4-aminobutyrate aminotransferase, mitochondrial precursor
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ
NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR
SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
|
| Target 1 Number of Residues |
508 |
| Target 1 Molecular Weight |
56440 |
| Target 1 Theoretical pI |
8.04 |
| Target 1 GO Classification |
|
Function
|
4-aminobutyrate transaminase activity
binding
vitamin binding
pyridoxal phosphate binding
catalytic activity
transferase activity
transferase activity, transferring nitrogenous groups
transaminase activity |
|
Process
|
physiological process
metabolism
cellular metabolism
amino acid and derivative metabolism
amino acid derivative metabolism
gamma-aminobutyric acid metabolism |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Amino acid transport and metabolism |
| Target 1 Specific Function |
Catalyzes the conversion of gamma-aminobutyrate and L- beta-aminoisobutyrate to succinate semialdehyde and methylmalonate semialdehyde, respectively. Can also convert delta-aminovalerate and beta-alanine |
| Target 1 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Valine, leucine and isoleucine degradation |
SMP00032  |
map00280  |
|
| Target 1 Reactions |
- 4-aminobutanoate + 2-oxoglutarate = succinate semialdehyde + L-glutamate
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
602705  |
| Target 1 UniProtKB/Swiss-Prot ID |
P80404  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
GABT_HUMAN  |
| Target 1 PDB ID |
1OHY  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
- Mitochondrion
- mitochondrial matrix
|
| Target 1 Gene Sequence |
>1503 bp
ATGGCCTCCATGTTGCTCGCCCAGCGGCTGGCCTGCAGCTTCCAGCACACGTACCGCCTG
CTGGTGCCTGGATCCAGACACATTAGTCAAGCTGCAGCCAAAGTCGACGTTGAATTTGAT
TATGATGGGCCTCTGATGAAGACGGAAGTCCCAGGGCCTAGATCTCAGGAGTTAATGAAA
CAGCTGAATATAATTCAGAATGCAGAGGCTGTGCATTTTTTCTGCAATTACGAAGAGAGC
CGAGGCAATTACCTGGTTGATGTGGACGGCAACCGAATGCTGGATCTTTATTCCCAGATC
TCCTCTGTTCCCATAGGTTACAGCGACCCGGCCCTCGTGAAACTCATCCAACAGCCACAA
AATGCGAGCATGTTTGTCAACAGACCCGCCCTCGAAATCCTGCCTCCGGAGAACTTTGTG
GAGAAGCTCCGGCAGTCCTTGCTCTCGGTGGCTCCCAAAGGGATGTCCCAGCTCATCACC
ATGGCCTGCGGCTCCTGCTCCAATGAAAACGCCTTAAAGACCATCTTCATGTGGTACCGG
AGCAAGGAAAGAGGGCAGAGGGGATTCTCCAAAGAGGAGCTGGAGACGTGCATGATTAAC
CAGGCCCCCTGGTGCCCCGACTACAGCATCCTCTCCTTCATGGGTTCCTTCCATGGGAGG
ACCATGGGTTGCTTAGCGACCACGCACTCTAAAGCCATTCACAAGATCGATATCCCTTCC
TTTGACTGGCCCATCGCACCGTTCCCACGGCTGAAATACCCTCTGGAAGAGTTTGTGAAA
GAGAACCAACAGGAAGAGGCCGGCTGTCTGGAAGAGGTTGAGGATCTGATTGTGAAATAT
CGAAAAAAGAAGAAGACGGTGGCCGGGATCATCGTGGAGCCCATCCAGTCCGAGGGTGGA
GACAACCATGCATCCGATGACTTCTTTCGGAAGCTGAGAGACATCGCCAGGAAGCACTGC
TGCGCCTTCTTGGTGGACGAGGTCCAGACCGGAGGAGGCTGCACGGGCAAGTTCTGGGCC
CATGAGCACTGGGGCCTGGATGACCCAGCAGACGTGATGACCTTCAGCAAGAAGATGATG
ACTGGGGGCTTCTTCCTCAAGGAGGAGTTCAGGCCTAATGCTCCCTACCGGATCTTCAAC
ACGTGGCTGGGGGACCCGTCCAAGAACCTGTTGCTGGCTGAGGTCATCAACATCATCAAG
CGGGAGGACCTGCTAAATAATGCAGCCCATGCCGGGAAGGCCCTGCTCACAGGACTGCTG
GACCTCCAGGCCCGGTACCCCCAGTTCATCAGCAGGGTGAGAGGACGAGGCACCTTTTGC
TCCTTCGATACTCCCGATGATTCCATACGGAATAAGCTCATTTTAATTGCCAGAAACAAA
GGTGTGGTGTTGGGTGGCTGTGGTGACAAATCCATTCGTTTCCGTCCCACGCTGGTGTTC
AGGGATCACCACGCTCACCTGTTCCTCAATATTTTCAGTGACATCTTAGCAGACTTCAAG
TAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
ABAT  |
| Target 1 GenAtlas ID |
ABAT  |
| Target 1 HGNC ID |
HGNC:23  |
| Target 1 Chromosome Location |
16 |
| Target 1 Locus |
16p13.2 |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Medina-Kauwe LK, Tobin AJ, De Meirleir L, Jaeken J, Jakobs C, Nyhan WL, Gibson KM: 4-Aminobutyrate aminotransferase (GABA-transaminase) deficiency. J Inherit Metab Dis. 1999 Jun;22(4):414-27. [PubMed
]
- Osei YD, Churchich JE: Screening and sequence determination of a cDNA encoding the human brain 4-aminobutyrate aminotransferase. Gene. 1995 Apr 3;155(2):185-7. [PubMed
]
- De Biase D, Barra D, Simmaco M, John RA, Bossa F: Primary structure and tissue distribution of human 4-aminobutyrate aminotransferase. Eur J Biochem. 1995 Jan 15;227(1-2):476-80. [PubMed
]
|
| Target 1 Drug References |
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
368 |
| Target 2 Name |
Enoyl-[acyl-carrier-protein] reductase [NADH] |
| Target 2 Synonyms |
- EC 1.3.1.9
- NADH- dependent enoyl-ACP reductase
|
| Target 2 Gene Name |
inhA |
| Target 2 Protein Sequence |
>Enoyl-[acyl-carrier-protein] reductase [NADH]
MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI
HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG
KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK
TVCALLSDWLPATTGDIIYADGGAHTQLL
|
| Target 2 Number of Residues |
273 |
| Target 2 Molecular Weight |
28528 |
| Target 2 Theoretical pI |
6.02 |
| Target 2 GO Classification |
|
Function
|
catalytic activity
oxidoreductase activity |
|
Process
|
physiological process
metabolism |
|
Component
|
| Not Available |
|
| Target 2 General Function |
Lipid transport and metabolism |
| Target 2 Specific Function |
Involved in the resistance against the antituberculosis drugs isoniazid and ethionamide |
| Target 2 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Fatty acid biosynthesis (path 1) |
|
map00061  |
|
| Target 2 Reactions |
- acyl-[acyl-carrier-protein] + NAD+ = trans-2,3-dehydroacyl-[acyl-carrier-protein] + NADH + H+
|
| Target 2 Pfam Domain Function |
Not Available |
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
|
| Target 2 Essentiality |
Essential |
| Target 2 GenBank ID Protein |
1524230  |
| Target 2 UniProtKB/Swiss-Prot ID |
P0A5Y6  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
INHA_MYCTU  |
| Target 2 PDB ID |
1P45  |
| Target 2 PDB File |
Show |
| Target 2 3D Structure |
|
| Target 2 Cellular Location |
Not Available |
| Target 2 Gene Sequence |
>810 bp
ATGACAGGACTGCTGGACGGCAAACGGATTCTGGTTAGCGGAATCATCACCGACTCGTCG
ATCGCGTTTCACATCGCACGGGTAGCCCAGGAGCAGGGCGCCCAGCTGGTGCTCACCGGG
TTCGACCGGCTGCGGCTGATTCAGCGCATCACCGACCGGCTGCCGGCAAAGGCCCCGCTG
CTCGAACTCGACGTGCAAAACGAGGAGCACCTGGCCAGCTTGGCCGGCCGGGTGACCGAG
GCGATCGGGGCGGGCAACAAGCTCGACGGGGTGGTGCATTCGATTGGGTTCATGCCGCAG
ACCGGGATGGGCATCAACCCGTTCTTCGACGCGCCCTACGCGGATGTGTCCAAGGGCATC
CACATCTCGGCGTATTCGTATGCTTCGATGGCCAAGGCGCTGCTGCCGATCATGAACCCC
GGAGGTTCCATCGTCGGCATGGACTTCGACCCGAGCCGGGCGATGCCGGCCTACAACTGG
ATGACGGTCGCCAAGAGCGCGTTGGAGTCGGTCAACAGGTTCGTGGCGCGCGAGGCCGGC
AAGTACGGTGTGCGTTCGAATCTCGTTGCCGCAGGCCCTATCCGGACGCTGGCGATGAGT
GCGATCGTCGGCGGTGCGCTCGGCGAGGAGGCCGGCGCCCAGATCCAGCTGCTCGAGGAG
GGCTGGGATCAGCGCGCTCCGATCGGCTGGAACATGAAGGATGCGACGCCGGTCGCCAAG
ACGGTGTGCGCGCTGCTGTCTGACTGGCTGCCGGCGACCACGGGTGACATCATCTACGCC
GACGGCGGCGCGCACACCCAATTGCTCTAG
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
Not Available |
| Target 2 GenAtlas ID |
Not Available |
| Target 2 HGNC ID |
Not Available |
| Target 2 Chromosome Location |
Not Available |
| Target 2 Locus |
Not Available |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Rozwarski DA, Vilcheze C, Sugantino M, Bittman R, Sacchettini JC: Crystal structure of the Mycobacterium tuberculosis enoyl-ACP reductase, InhA, in complex with NAD+ and a C16 fatty acyl substrate. J Biol Chem. 1999 May 28;274(22):15582-9. [PubMed
]
- Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, DeBoy R, Dodson R, Gwinn M, Haft D, Hickey E, Kolonay JF, Nelson WC, Umayam LA, Ermolaeva M, Salzberg SL, Delcher A, Utterback T, Weidman J, Khouri H, Gill J, Mikula A, Bishai W, Jacobs Jr WR Jr, Venter JC, Fraser CM: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains. J Bacteriol. 2002 Oct;184(19):5479-90. [PubMed
]
- Dessen A, Quemard A, Blanchard JS, Jacobs WR Jr, Sacchettini JC: Crystal structure and function of the isoniazid target of Mycobacterium tuberculosis. Science. 1995 Mar 17;267(5204):1638-41. [PubMed
]
- Banerjee A, Dubnau E, Quemard A, Balasubramanian V, Um KS, Wilson T, Collins D, de Lisle G, Jacobs WR Jr: inhA, a gene encoding a target for isoniazid and ethionamide in Mycobacterium tuberculosis. Science. 1994 Jan 14;263(5144):227-30. [PubMed
]
- Rozwarski DA, Grant GA, Barton DH, Jacobs WR Jr, Sacchettini JC: Modification of the NADH of the isoniazid target (InhA) from Mycobacterium tuberculosis. Science. 1998 Jan 2;279(5347):98-102. [PubMed
]
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [PubMed
]
|
| Target 2 Drug References |
- Broussy S, Coppel Y, Nguyen M, Bernadou J, Meunier B: 1H and 13C NMR characterization of hemiamidal isoniazid-NAD(H) adducts as possible inhibitors of InhA reductase of Mycobacterium tuberculosis. Chemistry. 2003 May 9;9(9):2034-8. [PubMed
]
- Schroeder EK, Basso LA, Santos DS, de Souza ON: Molecular dynamics simulation studies of the wild-type, I21V, and I16T mutants of isoniazid-resistant Mycobacterium tuberculosis enoyl reductase (InhA) in complex with NADH: toward the understanding of NADH-InhA different affinities. Biophys J. 2005 Aug;89(2):876-84. Epub 2005 May 20. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Wilson TM, de Lisle GW, Collins DM: Effect of inhA and katG on isoniazid resistance and virulence of Mycobacterium bovis. Mol Microbiol. 1995 Mar;15(6):1009-15. [PubMed
]
|
|
Drug Target 3
[top]
|
| Target 3 ID |
518 |
| Target 3 Name |
Peroxidase/catalase T |
| Target 3 Synonyms |
- Catalase-peroxidase T
- EC 1.11.1.6
|
| Target 3 Gene Name |
katG |
| Target 3 Protein Sequence |
>Peroxidase/catalase T
MPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGA
AFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGPLFIRMAWHAAGTYRIHDGRG
GAGGGMQRFAPLNSWPDNASLDKARRLLWPVKKKYGKKLSWADLIVFAGNCALESMGFKT
FGFGFGRVDQWEPDEVYWGKEATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPD
PMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQMGLGW
KSSYGTGTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGAWQYTAKDGAG
AGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEHPEELADEFAKAWYKLIHRDM
GPVARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQIRASGLTVSQLVSTAWAAA
SSFRGSDKRGGANGGRIRLQPQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSF
ADLVVLGGCAAIEKAAKAAGHNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGK
GNPLPAEYMLLDKANLLTLSAPEMTVLVGGLRVLGANYKRLPLGVFTEASESLTNDFFVN
LLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGSNSELRALVEVYGADDAQPKF
VQDFVAAWDKVMNLDRFDVR
|
| Target 3 Number of Residues |
752 |
| Target 3 Molecular Weight |
80605 |
| Target 3 Theoretical pI |
4.87 |
| Target 3 GO Classification |
|
Function
|
antioxidant activity
peroxidase activity
catalase activity |
|
Process
|
oxygen and reactive oxygen species metabolism
response to oxidative stress
physiological process
metabolism
cellular metabolism
generation of precursor metabolites and energy
electron transport |
|
Component
|
| Not Available |
|
| Target 3 General Function |
Inorganic ion transport and metabolism |
| Target 3 Specific Function |
Bifunctional, exhibiting both a catalase and broad- spectrum peroxidase activities. May play a role in the intracellular survival of mycobacteria |
| Target 3 Pathways |
|
| Target 3 Reactions |
|
| Target 3 Pfam Domain Function |
|
| Target 3 Signals |
|
| Target 3 Transmembrane Regions |
|
| Target 3 Essentiality |
Essential |
| Target 3 GenBank ID Protein |
581368  |
| Target 3 UniProtKB/Swiss-Prot ID |
Q08129  |
| Target 3 UniProtKB/Swiss-Prot Entry Name |
CATA_MYCTU  |
| Target 3 PDB ID |
1SJ2  |
| Target 3 PDB File |
Show |
| Target 3 3D Structure |
|
| Target 3 Cellular Location |
Not Available |
| Target 3 Gene Sequence |
>2223 bp
GTGCCCGAGCAACACCCACCCATTACAGAAACCACCACCGGAGCCGCTAGCAACGGCTGT
CCCGTCGTGGGTCATATGAAATACCCCGTCGAGGGCGGCGGAAACCAGGACTGGTGGCCC
AACCGGCTCAATCTGAAGGTACTGCACCAAAACCCGGCCGTCGCTGACCCGATGGGTGCG
GCGTTCGACTATGCCGCGGAGGTCGCGACCATCGACGTTGACGCCCTGACGCGGGACATC
GAGGAAGTGATGACCACCTCGCAGCCGTGGTGGCCCGCCGACTACGGCCACTACGGGCCG
CTGTTTATCCGGATGGCGTGGCACGCTGCCGGCACCTACCGCATCCACGACGGCCGCGGC
GGCGCCGGGGGCGGCATGCAGCGGTTCGCGCCGCTTAACAGCTGGCCCGACAACGCCAGC
TTGGACAAGGCGCGCCGGCTGCTGTGGCCGGTCAAGAAGAAGTACGGCAAGAAGCTCTCA
TGGGCGGACCTGATTGTTTTCGCCGGCAACTGCGCGCTGGAATCGATGGGCTTCAAGACG
TTCGGGTTCGGCTTCGGCCGGGTCGACCAGTGGGAGCCCGATGAGGTCTATTGGGGCAAG
GAAGCCACCTGGCTCGGCGATGAGCGTTACAGCGGTAAGCGGGATCTGGAGAACCCGCTG
GCCGCGGTGCAGATGGGGCTGATCTACGTGAACCCGGAGGCGCCGAACGGCAACCCGGAC
CCCATGGCCGCGGCGGTCGACATTCGCGAGACGTTTCGGCGCATGGCCATGAACGACGTC
GAAACAGCGGCGCTGATCGTCGGCGGTCACACTTTCGGTAAGACCCATGGCGCCGGCCCG
GCCGATCTGGTCGGCCCCGAACCCGAGGCTGCTCCGCTGGAGCAGATGGGCTTGGGCTGG
AAGAGCTCGTATGGCACCGGAACCGGTAAGGACGCGATCACCAGCGGCATCGAGGTCGTA
TGGACGAACACCCCGACGAAATGGGACAACAGTTTCCTCGAGATCCTGTACGGCTACGAG
TGGGAGCTGACGAAGAGCCCTGCTGGCGCTTGGCAATACACCGCCAAGGACGGCGCCGGT
GCCGGCACCATCCCGGACCCGTTCGGCGGGCCAGGGCGCTCCCCGACGATGCTGGCCACT
GACCTCTCGCTGCGGGTGGATCCGATCTATGAGCGGATCACGCGTCGCTGGCTGGAACAC
CCCGAGGAATTGGCCGACGAGTTCGCCAAGGCCTGGTACAAGCTGATCCACCGAGACATG
GGTCCCGTTGCGAGATACCTTGGGCCGCTGGTCCCCAAGCAGACCCTGCTGTGGCAGGAT
CCGGTCCCTGCGGTCAGCCACGACCTCGTCGGCGAAGCCGAGATTGCCAGCCTTAAGAGC
CAGATCCGGGCATCGGGATTGACTGTCTCACAGCTAGTTTCGACCGCATGGGCGGCGGCG
TCGTCGTTCCGTGGTAGCGACAAGCGCGGCGGCGCCAACGGTGGTCGCATCCGCCTGCAG
CCACAAGTCGGGTGGGAGGTCAACGACCCCGACGGGGATCTGCGCAAGGTCATTCGCACC
CTGGAAGAGATCCAGGAGTCATTCAACTCCGCGGCGCCGGGGAACATCAAAGTGTCCTTC
GCCGACCTCGTCGTGCTCGGTGGCTGTGCCGCCATAGAGAAAGCAGCAAAGGCGGCTGGC
CACAACATCACGGTGCCCTTCACCCCGGGCCGCACGGATGCGTCGCAGGAACAAACCGAC
GTGGAATCCTTTGCCGTGCTGGAGCCCAAGGCAGATGGCTTCCGAAACTACCTCGGAAAG
GGCAACCCGTTGCCGGCCGAGTACATGCTGCTCGACAAGGCGAACCTGCTTACGCTCAGT
GCCCCTGAGATGACGGTGCTGGTAGGTGGCCTGCGCGTCCTCGGCGCAAACTACAAGCGC
TTACCGCTGGGCGTGTTCACCGAGGCCTCCGAGTCACTGACCAACGACTTCTTCGTGAAC
CTGCTCGACATGGGTATCACCTGGGAGCCCTCGCCAGCAGATGACGGGACCTACCAGGGC
AAGGATGGCAGTGGCAAGGTGAAGTGGACCGGCAGCCGCGTGGACCTGGTCTTCGGGTCC
AACTCGGAGTTGCGGGCGCTTGTCGAGGTCTATGGCGCCGATGACGCGCAGCCGAAGTTC
GTGCAGGACTTCGTCGCTGCCTGGGACAAGGTGATGAACCTCGACAGGTTCGACGTGCGC
TGA
|
| Target 3 GenBank Gene ID |
|
| Target 3 GeneCard ID |
Not Available |
| Target 3 GenAtlas ID |
Not Available |
| Target 3 HGNC ID |
Not Available |
| Target 3 Chromosome Location |
Not Available |
| Target 3 Locus |
Not Available |
| Target 3 SNPs |
SNPJam Report  |
| Target 3 General References |
- Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, DeBoy R, Dodson R, Gwinn M, Haft D, Hickey E, Kolonay JF, Nelson WC, Umayam LA, Ermolaeva M, Salzberg SL, Delcher A, Utterback T, Weidman J, Khouri H, Gill J, Mikula A, Bishai W, Jacobs Jr WR Jr, Venter JC, Fraser CM: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains. J Bacteriol. 2002 Oct;184(19):5479-90. [PubMed
]
- Zhang Y, Heym B, Allen B, Young D, Cole S: The catalase-peroxidase gene and isoniazid resistance of Mycobacterium tuberculosis. Nature. 1992 Aug 13;358(6387):591-3. [PubMed
]
- Heym B, Zhang Y, Poulet S, Young D, Cole ST: Characterization of the katG gene encoding a catalase-peroxidase required for the isoniazid susceptibility of Mycobacterium tuberculosis. J Bacteriol. 1993 Jul;175(13):4255-9. [PubMed
]
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [PubMed
]
|
| Target 3 Drug References |
- Pym AS, Domenech P, Honore N, Song J, Deretic V, Cole ST: Regulation of catalase-peroxidase (KatG) expression, isoniazid sensitivity and virulence by furA of Mycobacterium tuberculosis. Mol Microbiol. 2001 May;40(4):879-89. [PubMed
]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
- Wilson TM, de Lisle GW, Collins DM: Effect of inhA and katG on isoniazid resistance and virulence of Mycobacterium bovis. Mol Microbiol. 1995 Mar;15(6):1009-15. [PubMed
]
- Heym B, Alzari PM, Honore N, Cole ST: Missense mutations in the catalase-peroxidase gene, katG, are associated with isoniazid resistance in Mycobacterium tuberculosis. Mol Microbiol. 1995 Jan;15(2):235-45. [PubMed
]
|
|
Drug Target 4
[top]
|
| Target 4 ID |
4834 |
| Target 4 Name |
Arylamine N-acetyltransferase |
| Target 4 Synonyms |
- EC 2.3.1.5
|
| Target 4 Gene Name |
nat |
| Target 4 Protein Sequence |
>Arylamine N-acetyltransferase
MAMDLGGYLTRIGLDGRPRPDLGTLHAIVAAHNRSIPFENLDPLLGIPVADLSAEALFAK
LVDRRRGGYCYEHNGLLGYVLEELGFEVERLSGRVVWMRADDAPLPAQTHNVLSVAVPGA
DGRYLVDVGFGGQTLTSPIRLEAGPVQQTRHEPYRLTRHGDDHTLAAQVRGEWQPLYTFT
TEPRPRIDLEVGSWYVSTHPGSHFVTGLTVAVVTDDARYNLRGRNLAVHRSGATEHIRFD
SAAQVLDAIVNRFGIDLGDLAGRDVQARVAEVLDT
|
| Target 4 Number of Residues |
279 |
| Target 4 Molecular Weight |
30174 |
| Target 4 Theoretical pI |
6.12 |
| Target 4 GO Classification |
|
Function
|
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
N-acetyltransferase activity
arylamine N-acetyltransferase activity |
|
Process
|
physiological process
metabolism |
|
Component
|
| Not Available |
|
| Target 4 General Function |
Involved in arylamine N-acetyltransferase activity |
| Target 4 Specific Function |
Could have a role in acetylating, and hence inactivating, the antitubercular drug isoniazid |
| Target 4 Pathways |
Not Available
|
| Target 4 Reactions |
Not Available |
| Target 4 Pfam Domain Function |
|
| Target 4 Signals |
|
| Target 4 Transmembrane Regions |
|
| Target 4 Essentiality |
Essential |
| Target 4 GenBank ID Protein |
Not Available |
| Target 4 UniProtKB/Swiss-Prot ID |
O86309  |
| Target 4 UniProtKB/Swiss-Prot Entry Name |
NAT_MYCSM  |
| Target 4 PDB ID |
1W6F  |
| Target 4 PDB File |
Show |
| Target 4 3D Structure |
|
| Target 4 Cellular Location |
|
| Target 4 Gene Sequence |
Not Available |
| Target 4 GenBank Gene ID |
|
| Target 4 GeneCard ID |
Not Available |
| Target 4 GenAtlas ID |
Not Available |
| Target 4 HGNC ID |
Not Available |
| Target 4 Chromosome Location |
Not Available |
| Target 4 Locus |
Not Available |
| Target 4 SNPs |
SNPJam Report  |
| Target 4 General References |
- Sandy J, Mushtaq A, Kawamura A, Sinclair J, Sim E, Noble M: The structure of arylamine N-acetyltransferase from Mycobacterium smegmatis--an enzyme which inactivates the anti-tubercular drug, isoniazid. J Mol Biol. 2002 May 10;318(4):1071-83. [PubMed
]
- Payton M, Auty R, Delgoda R, Everett M, Sim E: Cloning and characterization of arylamine N-acetyltransferase genes from Mycobacterium smegmatis and Mycobacterium tuberculosis: increased expression results in isoniazid resistance. J Bacteriol. 1999 Feb;181(4):1343-7. [PubMed
]
|
| Target 4 Drug References |
Not Available |