Voltage-dependent T-type calcium channel subunit alpha-1I

Details

Name
Voltage-dependent T-type calcium channel subunit alpha-1I
Synonyms
  • Ca(v)3.3
  • KIAA1120
  • Voltage-gated calcium channel subunit alpha Cav3.3
Gene Name
CACNA1I
Organism
Human
Amino acid sequence
>lcl|BSEQ0000024|Voltage-dependent T-type calcium channel subunit alpha-1I
MAESASPPSSSAAAPAAEPGVTTEQPGPRSPPSSPPGLEEPLDGADPHVPHPDLAPIAFF
CLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCF
LEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDV
YDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWV
EIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPH
AKEPRHYHGKTKGQGDEGRHLGSRHCQTLHGPASPGNDHSGRELCPQHSPLDATPHTLVQ
PIPATLASDPASCPCCQHEDGRRPSGLGSTDSGQEGSGSGSSAGGEDEADGDGARSSEDG
ASSELGKEEEEEEQADGAVWLCGDVWRETRAKLRGIVDSKYFNRGIMMAILVNTVSMGIE
HHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIV
GQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILG
MHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNIEEFDKLQEGLDSSGD
PKLCPIPMTPNGHLDPSLPLGGHLGPAGAAGPAPRLSLQPDPMLVALGSRKSSVMSLGRM
SYDQRSLSSSRSSYYGPWGRSAAWASRRSSWNSLKHKPPSAEHESLLSAERGGGARVCEV
AADEGPPRAAPLHTPHAHHIHHGPHLAHRHRHHRRTLSLDNRDSVDLAELVPAVGAHPRA
AWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRGDRGEDEEEIDYTLCFRVRKMIDVYKPD
WCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTE
RIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSLA
SAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIF
GILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKD
GWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQH
QEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCHTRLLIHSMCTSHYLDIFITFIICLN
VVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVL
LSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVG
NLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNW
NGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEA
QEDAEMDAELELEMAHGLGPGPRLPTGSPGAPGRGPGGAGGGGDTEGGLCRRCYSPAQEN
LWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCKKCHHDKQEVQLAETEAFSLNS
DRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPEN
FLCEMEEIPFNPVRSWLKHDSSQAPPSPFSPDASSPLLPMPAEFFHPAVSASQKGPEKGT
GTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDASPSSSAGSLQTTLEDSLTLSD
SPRRALGPPAPAPGPRAGLSPAARRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTHH
DSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPAPGLTPARKFSSTSSLA
APGRPHAAALAHGLARSPSWAADRSKDPPGRAPLPMGLGPLAPPPQPLPGELEPGDAASK
RKR
Number of residues
2223
Molecular Weight
245100.8
Theoretical pI
6.52
GO Classification
Functions
voltage-gated calcium channel activity / low voltage-gated calcium channel activity
Processes
transport / signal transduction / axon guidance / sleep / membrane depolarization during action potential / neuronal action potential / calcium ion import
Components
voltage-gated calcium channel complex / plasma membrane
General Function
Voltage-gated calcium channel activity
Specific Function
Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Isoform alpha-1I gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. T-type channels serve pacemaking functions in both central neurons and cardiac nodal cells and support calcium signaling in secretory cells and vascular smooth muscle. They may also be involved in the modulation of firing patterns of neurons which is important for information processing as well as in cell growth processes. Gates in voltage ranges similar to, but higher than alpha 1G or alpha 1H (By similarity).
Pfam Domain Function
Transmembrane Regions
79-99 121-141 149-168 174-191 212-232 378-398 641-661 677-697 703-721 730-753 765-785 842-862 1167-1187 1210-1230 1245-1265 1273-1294 1305-1325 1411-1431 1486-1506 1523-1543 1557-1577 1584-1607 1622-1642 1710-1730
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0015995|Voltage-dependent T-type calcium channel subunit alpha-1I (CACNA1I)
ATGGCTGAGAGCGCCTCCCCGCCCTCCTCATCTGCAGCAGCCCCAGCCGCTGAGCCAGGA
GTCACCACGGAGCAGCCCGGACCCCGGAGCCCCCCATCCTCCCCGCCAGGCCTGGAGGAG
CCTCTGGATGGAGCTGATCCTCATGTCCCACACCCAGACCTGGCGCCTATTGCCTTCTTC
TGCCTGCGACAGACCACCAGCCCCCGGAACTGGTGCATCAAGATGGTGTGCAACCCGTGG
TTTGAATGTGTCAGCATGCTGGTGATCCTGCTGAACTGCGTGACACTTGGCATGTACCAG
CCGTGCGACGACATGGACTGCCTGTCCGACCGCTGCAAGATCCTGCAGGTCTTTGATGAC
TTCATCTTTATCTTCTTTGCCATGGAGATGGTGCTCAAGATGGTGGCCCTGGGGATTTTT
GGCAAGAAGTGCTACCTCGGGGACACATGGAACCGCCTGGATTTCTTCATCGTCATGGCA
GGGATGGTCGAGTACTCCCTGGACCTTCAGAACATCAACCTGTCAGCCATCCGCACCGTG
CGCGTCCTGAGGCCCCTCAAAGCCATCAACCGCGTGCCCAGTATGCGGATCCTGGTGAAC
CTGCTCCTGGACACACTGCCCATGCTGGGGAATGTCCTGCTGCTCTGCTTCTTTGTCTTC
TTCATCTTTGGCATCATAGGTGTGCAGCTCTGGGCGGGCCTGCTGCGTAACCGCTGCTTC
CTGGAGGAGAACTTCACCATACAAGGGGATGTGGCCTTGCCCCCATACTACCAGCCGGAG
GAGGATGATGAGATGCCCTTCATCTGCTCCCTGTCGGGCGACAATGGGATAATGGGCTGC
CATGAGATCCCCCCGCTCAAGGAGCAGGGCCGTGAGTGCTGCCTGTCCAAGGACGACGTC
TACGACTTTGGGGCGGGGCGCCAGGACCTCAATGCCAGCGGCCTCTGTGTCAACTGGAAC
CGTTACTACAATGTGTGCCGCACGGGCAGCGCCAACCCCCACAAGGGTGCCATCAACTTT
GACAACATCGGTTATGCTTGGATTGTCATCTTCCAGGTGATCACTCTGGAAGGCTGGGTG
GAGATCATGTACTACGTGATGGATGCTCACTCCTTCTACAACTTCATCTACTTCATCCTG
CTTATCATAGTGGGCTCCTTCTTCATGATCAACCTGTGCCTCGTTGTCATAGCGACCCAG
TTCTCGGAGACCAAGCAACGGGAGCACCGGCTGATGCTGGAGCAGCGGCAGCGCTACCTG
TCCTCCAGCACGGTGGCCAGCTACGCCGAGCCTGGCGACTGCTACGAGGAGATCTTCCAG
TATGTCTGCCACATCCTGCGCAAGGCCAAGCGCCGCGCCCTGGGCCTCTACCAGGCCCTG
CAGAGCCGGCGCCAGGCCCTGGGCCCGGAGGCCCCGGCCCCCGCCAAACCTGGGCCCCAC
GCCAAGGAGCCCCGGCACTACCAGCTGTGCCCGCAACATAGCCCCCTGGATGCGACGCCC
CACACCCTGGTGCAGCCCATCCCCGCCACGCTGGCTTCCGATCCCGCCAGCTGCCCTTGC
TGCCAGCATGAGGACGGCCGGCGGCCCTCGGGCCTGGGCAGCACCGACTCGGGCCAGGAG
GGCTCGGGCTCCGGGAGCTCCGCTGGTGGCGAGGACGAGGCGGATGGGGACGGGGCCCGG
AGCAGCGAGGACGGAGCCTCCTCAGAACTGGGGAAGGAGGAGGAGGAGGAGGAGCAGGCG
GATGGGGCGGTCTGGCTGTGCGGGGATGTGTGGCGGGAGACGCGAGCCAAGCTGCGCGGC
ATCGTGGACAGCAAGTACTTCAACCGGGGCATCATGATGGCCATCCTGGTCAACACCGTC
AGCATGGGCATCGAGCACCACGAGCAGCCGGAGGAGCTGACCAACATCCTGGAGATCTGC
AATGTGGTCTTCACCAGCATGTTTGCCCTGGAGATGATCCTGAAGCTGGCTGCATTTGGG
CTCTTCGACTACCTGCGTAACCCCTACAACATCTTCGACAGCATCATTGTCATCATCAGC
ATCTGGGAGATTGTGGGGCAGGCGGACGGTGGGCTGTCGGTGCTGCGGACCTTCCGGCTG
CTGCGCGTGCTGAAACTGGTGCGCTTCATGCCTGCCCTGCGGCGCCAGCTCGTGGTGCTC
ATGAAGACCATGGACAACGTGGCCACCTTCTGCATGCTGCTCATGCTCTTCATCTTCATC
TTCAGCATCCTTGGGATGCATATTTTTGGCTGCAAGTTCAGCCTCCGCACGGACACTGGA
GACACGGTGCCCGACAGGAAGAACTTCGACTCCCTGCTGTGGGCCATCGTCACTGTGTTC
CAGATCCTCACCCAGGAGGACTGGAACGTCGTTCTCTACAATGGCATGGCCTCCACTTCT
CCCTGGGCCTCCCTCTACTTTGTCGCCCTCATGACCTTCGGCAACTATGTGCTCTTCAAC
CTGCTGGTGGCCATCCTGGTGGAGGGCTTCCAGGCGGAGGGTGACGCCAATCGCTCCTAC
TCGGACGAGGACCAGAGCTCATCCAACATAGAAGAGTTTGATAAGCTCCAGGAAGGCCTG
GACAGCAGCGGAGATCCCAAGCTCTGCCCAATCCCCATGACCCCCAATGGGCACCTGGAC
CCCAGTCTCCCACTGGGTGGGCACCTAGGTCCTGCTGGGGCTGCGGGACCTGCCCCCCGA
CTCTCACTGCAGCCGGACCCCATGCTGGTGGCCCTGGGCTCCCGAAAGAGCAGTGTCATG
TCTCTAGGGAGGATGAGCTATGACCAGCGCTCCCTGTCCAGCTCCCGGAGCTCCTACTAC
GGGCCATGGGGCCGCAGCGCGGCCTGGGCCAGCCGTCGCTCCAGCTGGAACAGCCTCAAG
CACAAGCCGCCGTCGGCGGAGCATGAGTCCCTGCTCTCTGCGGAGCGCGGCGGCGGCGCC
CGGGTCTGCGAGGTTGCCGCGGACGAGGGGCCGCCGCGGGCCGCACCCCTGCACACCCCA
CACGCCCACCACATTCATCACGGGCCCCATCTGGCGCACCGCCACCGCCACCACCGCCGG
ACGCTGTCCCTCGACAACAGGGACTCGGTGGACCTGGCCGAGCTGGTGCCCGCGGTGGGC
GCCCACCCCCGGGCCGCCTGGAGGGCGGCAGGCCCGGCCCCCGGGCATGAGGACTGCAAT
GGCAGGATGCCCAGCATCGCCAAAGACGTCTTCACCAAGATGGGCGACCGCGGGGATCGC
GGGGAGGATGAGGAGGAAATCGACTACACCCTGTGCTTCCGCGTCCGCAAGATGATCGAC
GTCTATAAGCCCGACTGGTGCGAGGTCCGCGAAGACTGGTCTGTCTACCTCTTCTCTCCC
GAGAACAGGTTCCGGGTCCTGTGTCAGACCATTATTGCCCACAAACTCTTCGACTACGTC
GTCCTGGCCTTCATCTTTCTCAACTGCATCACCATCGCCCTGGAGCGGCCTCAGATCGAG
GCCGGCAGCACCGAACGCATCTTTCTCACCGTGTCCAACTACATCTTCACGGCCATCTTC
GTGGGCGAGATGACATTGAAGGTAGTCTCGCTGGGCCTGTACTTCGGCGAGCAGGCGTAC
CTACGCAGCAGCTGGAACGTGCTGGATGGCTTTCTTGTCTTCGTGTCCATCATCGACATC
GTGGTGTCCCTGGCCTCAGCCGGGGGAGCCAAGATCTTGGGGGTCCTCCGAGTCTTGCGG
CTCCTGCGCACCCTACGCCCCCTGCGTGTCATCAGCCGGGCGCCGGGCCTGAAGCTGGTG
GTGGAGACACTCATCTCCTCCCTCAAGCCCATCGGCAACATCGTGCTCATCTGCTGTGCC
TTCTTCATCATCTTTGGCATCCTGGGAGTGCAGCTCTTCAAGGGCAAGTTCTACCACTGT
CTGGGCGTGGACACCCGCAACATCACCAACCGCTCGGACTGCATGGCCGCCAACTACCGC
TGGGTCCATCACAAATACAACTTCGACAACCTGGGCCAGGCTCTGATGTCCCTCTTTGTC
CTGGCATCCAAGGATGGTTGGGTGAACATCATGTACAATGGACTGGATGCTGTTGCTGTG
GACCAGCAGCCTGTGACCAACCACAACCCCTGGATGCTGCTGTACTTCATCTCCTTCCTG
CTCATCGTCAGCTTCTTTGTGCTCAACATGTTTGTGGGTGTCGTGGTGGAGAACTTCCAC
AAGTGCCGGCAGCACCAGGAGGCTGAAGAGGCACGGCGGCGTGAGGAGAAGCGGCTGCGG
CGCCTGGAGAAGAAGCGCCGGAAGGCCCAGCGGCTGCCCTACTATGCCACCTATTGTCAC
ACCCGGCTGCTCATCCACTCCATGTGCACCAGCCACTACCTGGACATCTTCATCACCTTC
ATCATCTGCCTCAACGTGGTCACCATGTCCCTGGAGCACTACAATCAGCCCACGTCCCTG
GAGACAGCCCTCAAGTACTGCAACTATATGTTCACCACTGTCTTTGTGCTGGAGGCTGTG
CTGAAGCTGGTGGCATTTGGTCTGAGGCGCTTCTTCAAGGACCGATGGAACCAGCTGGAC
CTGGCCATTGTGCTACTGTCAGTCATGGGCATCACCCTGGAGGAGATCGAGATCAATGCG
GCCCTGCCCATCAATCCCACCATCATCCGCATCATGAGGGTTCTGCGCATTGCCCGAGTG
CTGAAGCTGTTGAAGATGGCCACAGGAATGCGGGCCCTGCTGGACACGGTGGTGCAAGCT
TTGCCCCAGGTGGGCAACCTGGGCCTCCTCTTCATGCTGCTCTTCTTCATCTATGCTGCT
CTCGGGGTGGAGCTCTTTGGGAAGCTGGTCTGCAACGACGAGAACCCGTGCGAGGGCATG
AGCCGGCATGCCACCTTCGAGAACTTCGGCATGGCCTTCCTCACACTCTTCCAGGTCTCC
ACGGGTGACAACTGGAACGGGATCATGAAGGACACGCTGCGGGACTGCACCCACGACGAG
CGCAGCTGCCTGAGCAGCCTGCAGTTTGTGTCGCCGCTGTACTTCGTGAGCTTCGTGCTC
ACCGCGCAGTTCGTGCTCATCAACGTGGTGGTGGCTGTGCTCATGAAGCACCTGGACGAC
AGCAACAAGGAGGCGCAGGAGGACGCCGAGATGGATGCCGAGCTCGAGCTGGAGATGGCC
CATGGCCTGGGCCCTGGCCCGAGGCTGCCTACCGGCTCCCCGGGCGCCCCTGGCCGAGGG
CCGGGAGGGGCGGGCGGCGGGGGCGACACCGAGGGCGGCTTGTGCCGGCGCTGCTACTCG
CCTGCCCAGGAGAACCTGTGGCTGGACAGCGTCTCTTTAATCATCAAGGACTCCTTGGAG
GGGGAGCTGACCATCATCGACAACCTGTCGGGCTCCATCTTCCACCACTACTCCTCGCCT
GCCGGCTGCAAGAAGTGTCACCACGACAAGCAAGAGGTGCAGCTGGCTGAGACGGAGGCC
TTCTCCCTGAACTCAGACAGGTCCTCGTCCATCCTGCTGGGTGACGACCTGAGTCTCGAG
GACCCCACAGCCTGCCCACCTGGCCGCAAAGACAGCAAGGGTGAGCTGGACCCACCTGAG
CCCATGCGTGTGGGAGACCTGGGCGAATGCTTCTTCCCCTTGTCCTCTACGGCCGTCTCG
CCGGATCCAGAGAACTTCCTGTGTGAGATGGAGGAGATCCCATTCAACCCTGTCCGGTCC
TGGCTGAAACATGACAGCAGTCAAGCACCCCCAAGTCCCTTCTCCCCGGATGCCTCCAGC
CCTCTCCTGCCCATGCCAGCCGAGTTCTTCCACCCTGCAGTGTCTGCCAGCCAGAAAGGC
CCAGAAAAGGGCACTGGCACTGGAACCCTCCCCAAGATTGCGCTGCAGGGCTCCTGGGCA
TCTCTGCGGTCACCAAGGGTCAACTGTACCCTCCTCCGGCAGGCCACCGGGAGCGACACG
TCGCTGGACGCCAGCCCCAGCAGCTCCGCGGGCAGCCTGCAGACCACGCTCGAGGACAGC
CTGACCCTGAGCGACAGCCCCCGGCGTGCCCTGGGGCCGCCCGCGCCTGCTCCAGGACCC
CGGGCCGGCCTGTCCCCCGCCGCTCGCCGCCGCCTGAGCCTGCGCGGCCGGGGCCTCTTC
AGCCTGCGGGGGCTGCGGGCGCATCAGCGCAGCCACAGCAGCGGGGGCTCCACCAGCCCG
GGCTGCACCCACCACGACTCCATGGACCCCTCGGACGAGGAGGGCCGCGGTGGCGCGGGC
GGCGGGGGCGCGGGCAGCGAGCACTCGGAGACCCTCAGCAGCCTCTCGCTCACCTCCCTC
TTCTGCCCGCCGCCCCCGCCGCCAGCCCCCGGCCTCACGCCCGCCAGGAAGTTCAGCAGC
ACCAGCAGCCTGGCCGCCCCCGGCCGCCCCCACGCCGCCGCCCTGGCCCACGGCCTGGCC
CGGAGCCCCTCGTGGGCCGCGGACCGCAGCAAGGACCCCCCCGGCCGGGCACCGCTGCCC
ATGGGCCTGGGCCCCTTGGCGCCCCCGCCGCAACCGCTCCCCGGAGAGCTGGAGCCGGGA
GACGCCGCCAGCAAGAGGAAGAGATGA
Chromosome Location
22
Locus
22q13.1
External Identifiers
ResourceLink
UniProtKB IDQ9P0X4
UniProtKB Entry NameCAC1I_HUMAN
GenBank Protein ID5565888
GenBank Gene IDAF129133
GenAtlas IDCACNA1I
HGNC IDHGNC:1396
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00617ParamethadioneapprovedyessuppressorDetails
DB04841FlunarizineapprovedyesinhibitorDetails
DB00661VerapamilapprovedunknowninhibitorDetails
DB00909Zonisamideapproved, investigationalyesinhibitorDetails
DB00568Cinnarizineapproved, investigationalyesinhibitorDetails
DB01388Mibefradilinvestigational, withdrawnyesinhibitorDetails
DB09498Strontium chloride Sr-89approved, investigationalnoinducerDetails
DB09061Cannabidiolapproved, investigationalunknownDetails
DB09235EfonidipineexperimentalunknownantagonistDetails
DB06152NylidrinapprovedunknownantagonistagonistDetails
DB14011NabiximolsinvestigationalunknownDetails
DB14009Medical Cannabisexperimental, investigationalunknownDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB11093Calcium Citrateapproved, investigationalunknownsubstrateDetails
DB11348Calcium PhosphateapprovedunknownsubstrateDetails
DB09089TrimebutineapprovedunknownactivatorDetails
DB09238Manidipineapproved, investigationalyesblockerDetails
DB09231BenidipineexperimentalyesantagonistDetails
DB13746Bioallethrinapproved, experimentalunknownblockerDetails
DB14481Calcium phosphate dihydrateapprovedunknownDetails