D(1B) dopamine receptor

Details

Name
D(1B) dopamine receptor
Synonyms
  • D(5) dopamine receptor
  • D1beta dopamine receptor
  • Dopamine D5 receptor
  • DRD1B
  • DRD1L2
Gene Name
DRD5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009965|D(1B) dopamine receptor
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Number of residues
477
Molecular Weight
52950.5
Theoretical pI
5.08
GO Classification
Functions
dopamine binding / dopamine neurotransmitter receptor activity / dopamine neurotransmitter receptor activity, coupled via Gs / G-protein coupled amine receptor activity
Processes
activation of adenylate cyclase activity / adenylate cyclase-activating dopamine receptor signaling pathway / adenylate cyclase-activating G-protein coupled receptor signaling pathway / associative learning / cellular calcium ion homeostasis / cellular response to catecholamine stimulus / learning / long term synaptic depression / negative regulation of blood pressure / negative regulation of NAD(P)H oxidase activity / norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure / phospholipase C-activating dopamine receptor signaling pathway / positive regulation of adenylate cyclase activity / positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway / reactive oxygen species metabolic process / regulation of female receptivity / regulation of systemic arterial blood pressure by vasopressin / response to amphetamine / response to cocaine / sensitization / sensory perception of chemical stimulus / synaptic transmission / synaptic transmission, dopaminergic / transmission of nerve impulse / wound healing
Components
brush border membrane / ciliary membrane / integral component of plasma membrane / nonmotile primary cilium / plasma membrane
General Function
G-protein coupled amine receptor activity
Specific Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Pfam Domain Function
Transmembrane Regions
40-66 78-104 115-136 159-180 224-246 297-320 341-360
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0009966|D(1B) dopamine receptor (DRD5)
ATGCTGCCGCCAGGCAGCAACGGCACCGCGTACCCGGGGCAGTTCGCTCTATACCAGCAG
CTGGCGCAGGGGAACGCCGTGGGGGGCTCGGCGGGGGCACCGCCACTGGGGCCCTCACAG
GTGGTCACCGCCTGCCTGCTGACCCTACTCATCATCTGGACCCTGCTGGGCAACGTGCTG
GTGTGCGCAGCCATCGTGCGGAGCCGCCACCTGCGCGCCAACATGACCAACGTCTTCATC
GTGTCTCTGGCCGTGTCAGACCTTTTCGTGGCGCTGCTGGTCATGCCCTGGAAGGCAGTC
GCCGAGGTGGCCGGTTACTGGCCCTTTGGAGCGTTCTGCGACGTCTGGGTGGCCTTCGAC
ATCATGTGCTCCACTGCCTCCATCCTGAACCTGTGCGTCATCAGCGTGGACCGCTACTGG
GCCATCTCCAGGCCCTTCCGCTACAAGCGCAAGATGACTCAGCGCATGGCCTTGGTCATG
GTCGGCCTGGCATGGACCTTGTCCATCCTCATCTCCTTCATTCCGGTCCAGCTCAACTGG
CACAGGGACCAGGCGGCCTCTTGGGGCGGGCTGGACCTGCCAAACAACCTGGCCAACTGG
ACGCCCTGGGAGGAGGACTTTTGGGAGCCCGACGTGAATGCAGAGAACTGTGACTCCAGC
CTGAATCGAACCTACGCCATCTCTTCCTCGCTCATCAGCTTCTACATCCCCGTTGCCATC
ATGATCGTGACCTACACGCGCATCTACCGCATCGCCCAGGTGCAGATCCGCAGGATTTCC
TCCCTGGAGAGGGCCGCAGAGCACGCGCAGAGCTGCCGGAGCAGCGCAGCCTGCGCGCCC
GACACCAGCCTGCGCGCTTCCATCAAGAAGGAGACCAAGGTTCTCAAGACCCTGTCGGTG
ATCATGGGGGTCTTCGTGTGTTGCTGGCTGCCCTTCTTCATCCTTAACTGCATGGTCCCT
TTCTGCAGTGGACACCCCGAAGGCCCTCCGGCCGGCTTCCCCTGCGTCAGTGAGACCACC
TTCGACGTCTTCGTCTGGTTCGGCTGGGCTAACTCCTCACTCAACCCCGTCATCTATGCC
TTCAACGCCGACTTTCAGAAGGTGTTTGCCCAGCTGCTGGGGTGCAGCCACTTCTGCTCC
CGCACGCCGGTGGAGACGGTGAACATCAGCAATGAGCTCATCTCCTACAACCAAGACATC
GTCTTCCACAAGGAAATCGCAGCTGCCTACATCCACATGATGCCCAACGCCGTTACCCCC
GGCAACCGGGAGGTGGACAACGACGAGGAGGAGGGTCCTTTCGATCGCATGTTCCAGATC
TATCAGACGTCCCCAGATGGTGACCCTGTTGCTGAGTCTGTCTGGGAGCTGGACTGCGAG
GGGGAGATTTCTTTAGACAAAATAACACCTTTCACCCCGAATGGATTCCATTAA
Chromosome Location
4
Locus
4p16.1
External Identifiers
ResourceLink
UniProtKB IDP21918
UniProtKB Entry NameDRD5_HUMAN
GenBank Protein ID32049
GenBank Gene IDX58454
GenAtlas IDDRD5
HGNC IDHGNC:3026
General References
  1. Sunahara RK, Guan HC, O'Dowd BF, Seeman P, Laurier LG, Ng G, George SR, Torchia J, Van Tol HH, Niznik HB: Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature. 1991 Apr 18;350(6319):614-9. [PubMed:1826762]
  2. Grandy DK, Zhang YA, Bouvier C, Zhou QY, Johnson RA, Allen L, Buck K, Bunzow JR, Salon J, Civelli O: Multiple human D5 dopamine receptor genes: a functional receptor and two pseudogenes. Proc Natl Acad Sci U S A. 1991 Oct 15;88(20):9175-9. [PubMed:1833775]
  3. Weinshank RL, Adham N, Macchi M, Olsen MA, Branchek TA, Hartig PR: Molecular cloning and characterization of a high affinity dopamine receptor (D1 beta) and its pseudogene. J Biol Chem. 1991 Nov 25;266(33):22427-35. [PubMed:1834671]
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Karpa KD, Lidow MS, Pickering MT, Levenson R, Bergson C: N-linked glycosylation is required for plasma membrane localization of D5, but not D1, dopamine receptors in transfected mammalian cells. Mol Pharmacol. 1999 Nov;56(5):1071-8. [PubMed:10531415]
  7. Misbahuddin A, Placzek MR, Chaudhuri KR, Wood NW, Bhatia KP, Warner TT: A polymorphism in the dopamine receptor DRD5 is associated with blepharospasm. Neurology. 2002 Jan 8;58(1):124-6. [PubMed:11781417]
  8. Sobell JL, Lind TJ, Sigurdson DC, Zald DH, Snitz BE, Grove WM, Heston LL, Sommer SS: The D5 dopamine receptor gene in schizophrenia: identification of a nonsense change and multiple missense changes but lack of association with disease. Hum Mol Genet. 1995 Apr;4(4):507-14. [PubMed:7633397]
  9. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00800FenoldopamapprovedyesagonistDetails
DB01624Zuclopenthixolapproved, investigationalyesantagonistDetails
DB00714Apomorphineapproved, investigationalunknownagonistDetails
DB01038CarphenazinewithdrawnyesantagonistDetails
DB01186Pergolideapproved, investigational, vet_approved, withdrawnunknownagonistDetails
DB01200Bromocriptineapproved, investigationalunknownagonistDetails
DB00589Lisurideapproved, investigationalunknownantagonistDetails
DB00248CabergolineapprovedunknownagonistDetails
DB05271RotigotineapprovedunknownagonistDetails
DB00246ZiprasidoneapprovedunknownantagonistDetails
DB01238Aripiprazoleapproved, investigationalunknownantagonistpartial agonistDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB01224QuetiapineapprovedunknownantagonistDetails
DB01403Methotrimeprazineapproved, investigationalunknownantagonistDetails
DB00988DopamineapprovedyesagonistDetails
DB01235LevodopaapprovedyesagonistDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00408LoxapineapprovedunknownbinderDetails
DB14185Aripiprazole lauroxilapproved, investigationalunknownDetails
DB00477Chlorpromazineapproved, investigational, vet_approvedunknowninhibitorDetails
DB00408LoxapineapprovedunknownbinderDetails
DB00458ImipramineapprovedunknownbinderDetails
DB00726TrimipramineapprovedunknownbinderDetails
DB00248CabergolineapprovedunknownagonistDetails
DB00988DopamineapprovedunknownagonistDetails
DB00696ErgotamineapprovedunknownagonistDetails
DB00568Cinnarizineapproved, investigationalunknownbinderDetails
DB00334Olanzapineapproved, investigationalunknownantagonistDetails
DB06148Mianserinapproved, investigationalunknownbinderDetails
DB09097Quinagolideapproved, investigationalunknownagonistDetails
DB00555Lamotrigineapproved, investigationalunknowninhibitorDetails
DB09225Zotepineapproved, investigational, withdrawnyesantagonistDetails
DB11584PipradrolapprovedunknownagonistDetails
DB11274Dihydro-alpha-ergocryptineapprovedyespartial agonistDetails
DB00715Paroxetineapproved, investigationalunknownother/unknownDetails
DB13345Dihydroergocristineapproved, experimentalyesantagonistagonistDetails
DB01049Ergoloid mesylateapprovedyesantagonistagonistDetails
DB11275EpicriptineapprovedyesagonistDetails