You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameRituximab
Accession NumberDB00073  (BIOD00014, BTD00014)
TypeBiotech
GroupsApproved
Description

Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids

Protein structureDb00073
Protein chemical formulaC6416H9874N1688O1987S44
Protein average weight143859.7000
Sequences
>Rituximab heavy chain chimeric
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY
NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS
AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Rituximab light chain chimeric
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
SynonymLanguageCode
AntiCD20Not AvailableNot Available
Ig gamma-1 chain C regionNot AvailableNot Available
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Rituxaninjection, solution10 mg/mLintravenousGenentech, Inc.1997-11-26Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Rituxaninjection, solution10 mg/mLintravenousGenentech, Inc.1997-11-26Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Rituxansolution10 mgintravenousHoffmann La Roche LimitedNot AvailableNot AvailableCanada 5f16b84899037e23705f146ff57e3794121879cb055f0954756d94bc690476b4
Generic Prescription ProductsNot Available
Over the Counter ProductsNot Available
International Brands
NameCompany
MabTheraRoche
Brand mixturesNot Available
SaltsNot Available
Categories
CAS number174722-31-7
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.
PharmacodynamicsRituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and on >90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.
Mechanism of actionThe Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.
AbsorptionNot Available
Volume of distribution
  • 3.1 L
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to B lymphocytes, or by human antimurine antibody production

Route of eliminationNot Available
Half life0.8 hours (mammalian reticulocytes, in vitro)
Clearance
  • 0.34 L/day [RA patients]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated Effects
Interacting Gene/EnzymeSNP RS IDAllele nameDefining changeEffectReference(s)
Low affinity immunoglobulin gamma Fc region receptor III-A
Gene symbol: FCGR3A
UniProt: P08637
rs396991 Not AvailableA > CBetter response to drug therapy (compared to allele A)16609067
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Roche
Packagers
Dosage forms
FormRouteStrength
Injection, solutionintravenous10 mg/mL
Solutionintravenous10 mg
Prices
Unit descriptionCostUnit
Rituxan 10 mg/ml Concentrate 10ml Vial708.17USD vial
Rituxan 10 mg/ml vial68.09USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
Canada13368261995-08-292012-08-29
Canada21493292008-07-152013-11-12
United States57361371998-04-072015-04-07
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.414Not Available
isoelectric point8.68Not Available
References
Synthesis ReferenceNot Available
General Reference
  1. McLaughlin P, Grillo-Lopez AJ, Link BK, Levy R, Czuczman MS, Williams ME, Heyman MR, Bence-Bruckler I, White CA, Cabanillas F, Jain V, Ho AD, Lister J, Wey K, Shen D, Dallaire BK: Rituximab chimeric anti-CD20 monoclonal antibody therapy for relapsed indolent lymphoma: half of patients respond to a four-dose treatment program. J Clin Oncol. 1998 Aug;16(8):2825-33. Pubmed
  2. Edwards JC, Szczepanski L, Szechinski J, Filipowicz-Sosnowska A, Emery P, Close DR, Stevens RM, Shaw T: Efficacy of B-cell-targeted therapy with rituximab in patients with rheumatoid arthritis. N Engl J Med. 2004 Jun 17;350(25):2572-81. Pubmed
  3. Braendstrup P, Bjerrum OW, Nielsen OJ, Jensen BA, Clausen NT, Hansen PB, Andersen I, Schmidt K, Andersen TM, Peterslund NA, Birgens HS, Plesner T, Pedersen BB, Hasselbalch HC: Rituximab chimeric anti-CD20 monoclonal antibody treatment for adult refractory idiopathic thrombocytopenic purpura. Am J Hematol. 2005 Apr;78(4):275-80. Pubmed
  4. Binder M, Otto F, Mertelsmann R, Veelken H, Trepel M: The epitope recognized by rituximab. Blood. 2006 Sep 15;108(6):1975-8. Epub 2006 May 16. Pubmed
  5. Burton C, Kaczmarski R, Jan-Mohamed R: Interstitial pneumonitis related to rituximab therapy. N Engl J Med. 2003 Jun 26;348(26):2690-1; discussion 2690-1. Pubmed
  6. http://www.google.com/patents/EP2231183A2?cl=en
  7. http://planetorbitrap.com/data/uploads/528fce2e395be.pdf
External Links
ATC CodesL01XC02
AHFS Codes
  • 10:00.00
PDB Entries
FDA labelDownload (401 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
AbataceptRiTUXimab may enhance the adverse/toxic effect of Abatacept.
AcebutololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
AliskirenAntihypertensives may enhance the hypotensive effect of RiTUXimab.
AmilorideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
AmlodipineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
AtenololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
Azilsartan medoxomilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
BelimumabMonoclonal Antibodies may enhance the adverse/toxic effect of Belimumab.
BenazeprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
BendroflumethiazideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
BisoprololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
BumetanideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
CandesartanAntihypertensives may enhance the hypotensive effect of RiTUXimab.
CaptoprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
CarvedilolAntihypertensives may enhance the hypotensive effect of RiTUXimab.
Certolizumab pegolRiTUXimab may enhance the immunosuppressive effect of Certolizumab Pegol.
ChlorothiazideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
ChlorthalidoneAntihypertensives may enhance the hypotensive effect of RiTUXimab.
CilazaprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
ClevidipineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
ClonidineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
ClozapineMyelosuppressive Agents may enhance the adverse/toxic effect of CloZAPine. Specifically, the risk for agranulocytosis may be increased.
DenosumabMay enhance the adverse/toxic effect of Immunosuppressants. Specifically, the risk for serious infections may be increased.
DiltiazemAntihypertensives may enhance the hypotensive effect of RiTUXimab.
DoxazosinAntihypertensives may enhance the hypotensive effect of RiTUXimab.
EnalaprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
EplerenoneAntihypertensives may enhance the hypotensive effect of RiTUXimab.
EprosartanAntihypertensives may enhance the hypotensive effect of RiTUXimab.
EsmololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
Ethacrynic acidAntihypertensives may enhance the hypotensive effect of RiTUXimab.
FelodipineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
FosinoprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
FurosemideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
GuanfacineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
HydralazineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
HydrochlorothiazideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
IndapamideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
IrbesartanAntihypertensives may enhance the hypotensive effect of RiTUXimab.
IsradipineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
LabetalolAntihypertensives may enhance the hypotensive effect of RiTUXimab.
LeflunomideImmunosuppressants may enhance the adverse/toxic effect of Leflunomide. Specifically, the risk for hematologic toxicity such as pancytopenia, agranulocytosis, and/or thrombocytopenia may be increased.
LisinoprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
LosartanAntihypertensives may enhance the hypotensive effect of RiTUXimab.
MannitolAntihypertensives may enhance the hypotensive effect of RiTUXimab.
MethyclothiazideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
MethyldopaAntihypertensives may enhance the hypotensive effect of RiTUXimab.
MetolazoneAntihypertensives may enhance the hypotensive effect of RiTUXimab.
MetoprololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
MoexiprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
NadololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
NatalizumabImmunosuppressants may enhance the adverse/toxic effect of Natalizumab. Specifically, the risk of concurrent infection may be increased.
NebivololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
NifedipineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
NimodipineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
NisoldipineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
NitroprussideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
OlmesartanAntihypertensives may enhance the hypotensive effect of RiTUXimab.
PenbutololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
PerindoprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
PhenoxybenzamineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
PhentolamineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
PimecrolimusMay enhance the adverse/toxic effect of Immunosuppressants.
PindololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
PrazosinAntihypertensives may enhance the hypotensive effect of RiTUXimab.
PropranololAntihypertensives may enhance the hypotensive effect of RiTUXimab.
QuinaprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
RamiprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
ReserpineAntihypertensives may enhance the hypotensive effect of RiTUXimab.
RoflumilastMay enhance the immunosuppressive effect of Immunosuppressants.
Sipuleucel-TImmunosuppressants may diminish the therapeutic effect of Sipuleucel-T.
SotalolAntihypertensives may enhance the hypotensive effect of RiTUXimab.
SpironolactoneAntihypertensives may enhance the hypotensive effect of RiTUXimab.
TelmisartanAntihypertensives may enhance the hypotensive effect of RiTUXimab.
TerazosinAntihypertensives may enhance the hypotensive effect of RiTUXimab.
TofacitinibRiTUXimab may enhance the adverse/toxic effect of Tofacitinib.
TorasemideAntihypertensives may enhance the hypotensive effect of RiTUXimab.
TrandolaprilAntihypertensives may enhance the hypotensive effect of RiTUXimab.
TrastuzumabMay enhance the neutropenic effect of Immunosuppressants.
TriamtereneAntihypertensives may enhance the hypotensive effect of RiTUXimab.
ValsartanAntihypertensives may enhance the hypotensive effect of RiTUXimab.
Food InteractionsNot Available

Targets

1. Low affinity immunoglobulin gamma Fc region receptor III-B

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Low affinity immunoglobulin gamma Fc region receptor III-B O75015 Details

References:

  1. Treon SP, Hansen M, Branagan AR, Verselis S, Emmanouilides C, Kimby E, Frankel SR, Touroutoglou N, Turnbull B, Anderson KC, Maloney DG, Fox EA: Polymorphisms in FcgammaRIIIA (CD16) receptor expression are associated with clinical response to rituximab in Waldenstrom’s macroglobulinemia. J Clin Oncol. 2005 Jan 20;23(3):474-81. Pubmed
  2. Bowles JA, Weiner GJ: CD16 polymorphisms and NK activation induced by monoclonal antibody-coated target cells. J Immunol Methods. 2005 Sep;304(1-2):88-99. Pubmed
  3. Bowles JA, Wang SY, Link BK, Allan B, Beuerlein G, Campbell MA, Marquis D, Ondek B, Wooldridge JE, Smith BJ, Breitmeyer JB, Weiner GJ: Anti-CD20 monoclonal antibody with enhanced affinity for CD16 activates NK cells at lower concentrations and more effectively than rituximab. Blood. 2006 Oct 15;108(8):2648-54. Epub 2006 Jul 6. Pubmed
  4. Hatjiharissi E, Xu L, Santos DD, Hunter ZR, Ciccarelli BT, Verselis S, Modica M, Cao Y, Manning RJ, Leleu X, Dimmock EA, Kortsaris A, Mitsiades C, Anderson KC, Fox EA, Treon SP: Increased natural killer cell expression of CD16, augmented binding and ADCC activity to rituximab among individuals expressing the Fc{gamma}RIIIa-158 V/V and V/F polymorphism. Blood. 2007 Oct 1;110(7):2561-4. Epub 2007 May 2. Pubmed

2. Complement C1r subcomponent

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Complement C1r subcomponent P00736 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

3. Complement C1q subcomponent subunit A

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Complement C1q subcomponent subunit A P02745 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed
  3. Di Gaetano N, Cittera E, Nota R, Vecchi A, Grieco V, Scanziani E, Botto M, Introna M, Golay J: Complement activation determines the therapeutic activity of rituximab in vivo. J Immunol. 2003 Aug 1;171(3):1581-7. Pubmed

4. Complement C1q subcomponent subunit B

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Complement C1q subcomponent subunit B P02746 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

5. Complement C1q subcomponent subunit C

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Complement C1q subcomponent subunit C P02747 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

6. Low affinity immunoglobulin gamma Fc region receptor III-A

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Low affinity immunoglobulin gamma Fc region receptor III-A P08637 Details

References:

  1. Niwa R, Hatanaka S, Shoji-Hosaka E, Sakurada M, Kobayashi Y, Uehara A, Yokoi H, Nakamura K, Shitara K: Enhancement of the antibody-dependent cellular cytotoxicity of low-fucose IgG1 Is independent of FcgammaRIIIa functional polymorphism. Clin Cancer Res. 2004 Sep 15;10(18 Pt 1):6248-55. Pubmed
  2. Hatjiharissi E, Hansen M, Santos DD, Xu L, Leleu X, Dimmock EW, Ho AW, Hunter ZR, Branagan AR, Patterson CJ, Kortsaris A, Verselis S, Fox E, Treon SP: Genetic linkage of Fc gamma RIIa and Fc gamma RIIIa and implications for their use in predicting clinical responses to CD20-directed monoclonal antibody therapy. Clin Lymphoma Myeloma. 2007 Jan;7(4):286-90. Pubmed
  3. Kim DH, Jung HD, Kim JG, Lee JJ, Yang DH, Park YH, Do YR, Shin HJ, Kim MK, Hyun MS, Sohn SK: FCGR3A gene polymorphisms may correlate with response to frontline R-CHOP therapy for diffuse large B-cell lymphoma. Blood. 2006 Oct 15;108(8):2720-5. Epub 2006 Apr 11. Pubmed

7. Complement C1s subcomponent

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Complement C1s subcomponent P09871 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

8. High affinity immunoglobulin gamma Fc receptor I

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
High affinity immunoglobulin gamma Fc receptor I P12314 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

9. Low affinity immunoglobulin gamma Fc region receptor II-a

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Low affinity immunoglobulin gamma Fc region receptor II-a P12318 Details

References:

  1. Hatjiharissi E, Hansen M, Santos DD, Xu L, Leleu X, Dimmock EW, Ho AW, Hunter ZR, Branagan AR, Patterson CJ, Kortsaris A, Verselis S, Fox E, Treon SP: Genetic linkage of Fc gamma RIIa and Fc gamma RIIIa and implications for their use in predicting clinical responses to CD20-directed monoclonal antibody therapy. Clin Lymphoma Myeloma. 2007 Jan;7(4):286-90. Pubmed
  2. Kim DH, Jung HD, Kim JG, Lee JJ, Yang DH, Park YH, Do YR, Shin HJ, Kim MK, Hyun MS, Sohn SK: FCGR3A gene polymorphisms may correlate with response to frontline R-CHOP therapy for diffuse large B-cell lymphoma. Blood. 2006 Oct 15;108(8):2720-5. Epub 2006 Apr 11. Pubmed

10. Low affinity immunoglobulin gamma Fc region receptor II-b

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Low affinity immunoglobulin gamma Fc region receptor II-b P31994 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

11. Low affinity immunoglobulin gamma Fc region receptor II-c

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Low affinity immunoglobulin gamma Fc region receptor II-c P31995 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

12. B-lymphocyte antigen CD20

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: antibody

Components

Name UniProt ID Details
B-lymphocyte antigen CD20 P11836 Details

References:

  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed
  2. van Meerten T, Hagenbeek A: CD20-targeted therapy: the next generation of antibodies. Semin Hematol. 2010 Apr;47(2):199-210. Pubmed
  3. Jaglowski SM, Byrd JC: Rituximab in chronic lymphocytic leukemia. Semin Hematol. 2010 Apr;47(2):156-69. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on January 31, 2014 11:10