| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-02-19 16:04:40 |
| Primary Accession Number |
DB02703 |
| Secondary Accession Number |
|
| Name |
Fusidic Acid |
| Drug Type |
|
| Description |
An antibiotic isolated from the fermentation broth of Fusidium coccineum. (From Merck Index, 11th ed) It acts by inhibiting translocation during protein synthesis. |
| Synonyms |
- Diethanolamine fusidate
- Fucidate
- Fucidate Sodium
- Fucidic acid
- Fusidate
- Fusidate Sodium
|
| Brand Names |
- Fucidin
- Fucidin Cream 2%
- Fucidin acid
- Fucidine
- Fucithalmic
- Fusidine
- Ramycin
|
| Brand Mixtures |
- Fucibet (Fusidic acid + betamethasone)
- Fucicort (Fusidic acid + hydrocortisone)
|
| Chemical IUPAC Name |
(2Z)-2-[(3R,4S,5S,8S,9S,10S,11R,13R,14S,16S)-16-acetyloxy-3,11-dihydroxy-4,8,10,14-tetramethyl-2,3,4,5,6,7,9,11,12,13,15,16-dodecahydro-1H-cyclopenta[a]phenanthren-17-ylidene]-6-methylhept-5-enoic acid |
| Chemical Formula |
C31H48O6 |
| Chemical Structure |
 |
| CAS Registry Number |
6990-06-3 |
| InChI Identifier |
InChI=1/C31H48O6/c1-17(2)9-8-10-20(28(35)36)26-22-15-24(34)27-29(5)13-12-23(33)18(3)21(29)11-14-30(27,6)31(22,7)16-25(26)37-19(4)32/h9,18,21-25,27,33-34H,8,10-16H2,1-7H3,(H,35,36)/b26-20-/t18-,21-,22-,23+,24+,25-,27-,29-,30-,31-/m0/s1/f/h35H |
| InChI Key |
IECPWNUMDGFDKC-YLSUCPHCDU |
| KEGG Drug |
D04281  |
| KEGG Compound |
C06694  |
| PubChem Compound |
3000226  |
| PubChem Substance |
8919  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA10087  |
| HET ID |
FUA  |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
00586668  |
| RxList Link |
Not Available |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Fusidic_acid  |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
Not Available |
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
516.7092 |
| Monoisotopic Molecular Weight |
516.3451 |
| State |
Solid |
| Melting Point |
192.5 oC |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
5.21e-03 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP |
4.97
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-5.00
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
1QCA  |
| Experimental PDB File |
Show |
| Experimental PDB Structure |
|
| Isomeric SMILES |
C[C@@H]1[C@H](O)CC[C@@]2(C)[C@H]1CC[C@@]1(C)[C@H]2[C@H](O)C[C@H]2\C([C@H](C[C@]12C)OC(C)=O)=C(/CC\C=C(\C)C)C(O)=O |
| Canonical SMILES |
CC1C(O)CCC2(C)C1CCC1(C)C2C(O)CC2C(C(CC12C)OC(C)=O)=C(CCC=C(C)C)C(O)=O |
| Drug Category |
- Anti-Bacterial Agents
- Antibacterial Agents
- Protein Synthesis Inhibitors
|
| ATC Codes |
Not Available |
| AHFS Codes |
Not Available |
| Indication |
For the treatment of bacterial infections. |
| Pharmacology |
Fusidic acid is a bacteriostatic antibiotic that is often used topically in creams and eyedrops, but may also be given systemically as tablets or injections. |
| Mechanism of Action |
Fusidic acid works by interfering with bacterial protein synthesis, specifically by preventing the translocation of the elongation factor G (EF-G) from the ribosome. |
| Absorption |
Sodium fusidic acid tablets have a 91% oral bioavailability. Absorption of the film-coated tablets is complete when compared to a solution, however oral absorption is variable. Oral fusidic acid hemihydrate (suspension) achieved a 22.5% bioavailability in pediatric patients following a 20 milligram/kilogram dose. |
| Toxicity |
Not Available |
| Protein Binding |
97 to 99% |
| Biotransformation |
Metabolites include dicarboxylic ester/acid, 3-keto fusidic acid, hydroxy fusidic acid, glucuronide fusidic acid and a glycol metabolite. |
| Half Life |
Approximately 5 to 6 hours in adults. |
| Dosage Forms |
Not Available
|
| Patient Information |
Not Available |
| Contraindications |
Not Available |
| Interactions |
Not Available |
| Drug Interactions |
| Drug |
Interaction |
| Amprenavir |
The protease inhibitor increases the effect and toxicity of fusidic acid |
| Atorvastatin |
Increased risk of myopathy/rhabdomyolysis |
| Fosamprenavir |
The protease inhibitor increases the effect and toxicity of fusidic acid |
| Indinavir |
Indinavir increases the effect and toxicity of fusidic acid |
| Nelfinavir |
The protease inhibitor increases the effect and toxicity of fusidic acid |
| Ritonavir |
The protease inhibitor increases the effect and toxicity of fusidic acid |
| Saquinavir |
The protease inhibitor increases the effect and toxicity of fusidic acid |
| Simvastatin |
Increased risk of myopathy/rhabdomyolysis |
|
| Food Interactions |
- Take with food to reduce irritation.
|
| Pathways |
Not Available
|
| General References |
- Wikipedia

|
| Organisms Affected |
- Enteric bacteria and other eubacteria
|
| Targets |
- Chloramphenicol acetyltransferase 3
- Chloramphenicol acetyltransferase
|
|
Drug Target 1
[top]
|
| Target 1 ID |
2808 |
| Target 1 Name |
Chloramphenicol acetyltransferase 3 |
| Target 1 Synonyms |
- Chloramphenicol acetyltransferase III
- EC 2.3.1.28
- catIII
|
| Target 1 Gene Name |
cat3 |
| Target 1 Protein Sequence |
>Chloramphenicol acetyltransferase 3
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQ
AVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVME
RYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLL
LPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
|
| Target 1 Number of Residues |
216 |
| Target 1 Molecular Weight |
24994 |
| Target 1 Theoretical pI |
6.15 |
| Target 1 GO Classification |
|
Function
|
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring groups other than amino-acyl groups
acyltransferase activity
O-acyltransferase activity
O-acetyltransferase activity
chloramphenicol O-acetyltransferase activity |
|
Process
|
| Not Available |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Involved in chloramphenicol O-acetyltransferase activity |
| Target 1 Specific Function |
This enzyme is an effector of chloramphenicol resistance in bacteria |
| Target 1 Pathways |
Not Available
|
| Target 1 Reactions |
- acetyl-CoA + chloramphenicol = CoA + chloramphenicol 3-acetate
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Essential |
| Target 1 GenBank ID Protein |
47025  |
| Target 1 UniProtKB/Swiss-Prot ID |
P00484  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
CAT3_ECOLI  |
| Target 1 PDB ID |
3CLA  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
Not Available |
| Target 1 Gene Sequence |
>642 bp
ATGAACTATACAAAATTTGATGTAAAAAATTGGGTTCGCCGTGAGCATTTTGAGTTTTAT
CGGCATCGTTTACCATGTGGTTTTAGCTTAACAAGCAAAATTGATATCACGACGTTAAAA
AAGTCATTGGATGATTCAGCGTATAAGTTTTATCCGGTAATGATCTATCTGATTGCTCAG
GCCGTGAATCAATTTGATGAGTTGAGAATGGCGATAAAAGATGATGAATTGATCGTATGG
GATTCAGTCGACCCACAATTCACCGTATTCCATCAAGAAACAGAGACATTTTCAGCACTG
AGTTGCCCATACTCATCCGATATTGATCAATTTATGGTGAATTATTTATCGGTAATGGAA
CGTTATAAAAGTGATACCAAGTTATTTCCTCAAGGGGTAACACCAGAAAATCATTTAAAT
ATTTCAGCATTACCTTGGGTTAATTTTGATAGCTTTAATTTAAATGTTGCTAATTTTACC
GATTATTTTGCACCCATTATAACAATGGCAAAATATCAGCAAGAAGGGGATAGACTGTTA
TTGCCGCTCTCAGTACAGGTTCATCATGCAGTTTGTGATGGCTTCCATGTTGCACGCTTT
ATTAATCGGCTACAAGAGTTGTGTAACAGTAAATTAAAATAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
Not Available |
| Target 1 GenAtlas ID |
Not Available |
| Target 1 HGNC ID |
Not Available |
| Target 1 Chromosome Location |
Not Available |
| Target 1 Locus |
Not Available |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Leslie AG: Refined crystal structure of type III chloramphenicol acetyltransferase at 1.75 A resolution. J Mol Biol. 1990 May 5;213(1):167-86. [PubMed
]
- Murray IA, Hawkins AR, Keyte JW, Shaw WV: Nucleotide sequence analysis and overexpression of the gene encoding a type III chloramphenicol acetyltransferase. Biochem J. 1988 May 15;252(1):173-9. [PubMed
]
- Leslie AG, Moody PC, Shaw WV: Structure of chloramphenicol acetyltransferase at 1.75-A resolution. Proc Natl Acad Sci U S A. 1988 Jun;85(12):4133-7. [PubMed
]
|
| Target 1 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
3278 |
| Target 2 Name |
Chloramphenicol acetyltransferase |
| Target 2 Synonyms |
- CAT
- EC 2.3.1.28
|
| Target 2 Gene Name |
cat |
| Target 2 Protein Sequence |
>Chloramphenicol acetyltransferase
MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFI
HILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIY
SQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDNFFAPVFTMGKYYTQG
DKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA
|
| Target 2 Number of Residues |
222 |
| Target 2 Molecular Weight |
25663 |
| Target 2 Theoretical pI |
6.36 |
| Target 2 GO Classification |
|
Function
|
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring groups other than amino-acyl groups
acyltransferase activity
O-acyltransferase activity
O-acetyltransferase activity
chloramphenicol O-acetyltransferase activity |
|
Process
|
| Not Available |
|
Component
|
| Not Available |
|
| Target 2 General Function |
Involved in chloramphenicol O-acetyltransferase activity |
| Target 2 Specific Function |
This enzyme is an effector of chloramphenicol resistance in bacteria |
| Target 2 Pathways |
Not Available
|
| Target 2 Reactions |
- acetyl-CoA + chloramphenicol = CoA + chloramphenicol 3-acetate
|
| Target 2 Pfam Domain Function |
|
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
|
| Target 2 Essentiality |
Essential |
| Target 2 GenBank ID Protein |
16505914  |
| Target 2 UniProtKB/Swiss-Prot ID |
P62580  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
CAT_SALTI  |
| Target 2 PDB ID |
1Q23  |
| Target 2 PDB File |
Show |
| Target 2 3D Structure |
|
| Target 2 Cellular Location |
Not Available |
| Target 2 Gene Sequence |
>660 bp
ATGGAGAAAAAAATCACTGGATATACCACCGTTGATATATCCCAATGGCATCGTAAAGAA
CATTTTGAGGCATTTCAGTCAGTTGCTCAATGTACCTATAACCAGACCGTTCAGCTGGAT
ATTACGGCCTTTTTAAAGACCGTAAAGAAAAATAAGCACAAGTTTTATCCGGCCTTTATT
CACATTCTTGCCCGCCTGATGAATGCTCATCCGGAATTCCGTATGGCAATGAAAGACGGT
GAGCTGGTGATATGGGATAGTGTTCACCCTTGTTACACCGTTTTCCATGAGCAAACTGAA
ACGTTTTCATCGCTCTGGAGTGAATACCACGACGATTTCCGGCAGTTTCTACACATATAT
TCGCAAGATGTGGCGTGTTACGGTGAAAACCTGGCCTATTTCCCTAAAGGGTTTATTGAG
AATATGTTTTTCGTCTCAGCCAATCCCTGGGTGAGTTTCACCAGTTTTGATTTAAACGTG
GCCAATATGGACAACTTCTTCGCCCCCGTTTTCACCATGGGCAAATATTATACGCAAGGC
GACAAGGTGCTGATGCCGCTGGCGATTCAGGTTCATCATGCCGTTTGTGATGGCTTCCAT
GTCGGCAGAATGCTTAATGAATTACAACAGTACTGCGATGAGTGGCAGGGCGGGGCGTAA
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
Not Available |
| Target 2 GenAtlas ID |
Not Available |
| Target 2 HGNC ID |
Not Available |
| Target 2 Chromosome Location |
Not Available |
| Target 2 Locus |
Not Available |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Parkhill J, Dougan G, James KD, Thomson NR, Pickard D, Wain J, Churcher C, Mungall KL, Bentley SD, Holden MT, Sebaihia M, Baker S, Basham D, Brooks K, Chillingworth T, Connerton P, Cronin A, Davis P, Davies RM, Dowd L, White N, Farrar J, Feltwell T, Hamlin N, Haque A, Hien TT, Holroyd S, Jagels K, Krogh A, Larsen TS, Leather S, Moule S, O'Gaora P, Parry C, Quail M, Rutherford K, Simmonds M, Skelton J, Stevens K, Whitehead S, Barrell BG: Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18. Nature. 2001 Oct 25;413(6858):848-52. [PubMed
]
|
| Target 2 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|