Arachidonate 5-lipoxygenase

Details

Name
Arachidonate 5-lipoxygenase
Synonyms
  • 1.13.11.34
  • 5-LO
  • LOG5
Gene Name
ALOX5
Organism
Human
Amino acid sequence
>lcl|BSEQ0036979|Arachidonate 5-lipoxygenase
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
YYLSPDRIPNSVAI
Number of residues
674
Molecular Weight
77982.595
Theoretical pI
5.54
GO Classification
Functions
iron ion binding / arachidonate 5-lipoxygenase activity
Processes
response to nutrient / positive regulation of vasoconstriction / small molecule metabolic process / acute inflammatory response / leukotriene biosynthetic process / arachidonic acid metabolic process / response to hyperoxia / leukotriene metabolic process / leukotriene production involved in inflammatory response / sensory perception of pain / lipoxin metabolic process / lipoxygenase pathway
Components
nuclear matrix / extracellular space / sarcolemma / cytosol / nuclear membrane / dendrite / nuclear envelope lumen / nuclear envelope
General Function
Iron ion binding
Specific Function
Catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0010032|Arachidonate 5-lipoxygenase (ALOX5)
ATGCCCTCCTACACGGTCACCGTGGCCACTGGCAGCCAGTGGTTCGCCGGCACTGACGAC
TACATCTACCTCAGCCTCGTGGGCTCGGCGGGCTGCAGCGAGAAGCACCTGCTGGACAAG
CCCTTCTACAACGACTTCGAGCGTGGCGCGGTGGATTCATACGACGTGACTGTGGACGAG
GAACTGGGCGAGATCCAGCTGGTCAGAATCGAGAAGCGCAAGTACTGGCTGAATGACGAC
TGGTACCTGAAGTACATCACGCTGAAGACGCCCCACGGGGACTACATCGAGTTCCCCTGC
TACCGCTGGATCACCGGCGATGTCGAGGTTGTCCTGAGGGATGGACGCGCAAAGTTGGCC
CGAGATGACCAAATTCACATTCTCAAGCAACACCGACGTAAAGAACTGGAAACACGGCAA
AAACAATATCGATGGATGGAGTGGAACCCTGGCTTCCCCTTGAGCATCGATGCCAAATGC
CACAAGGATTTACCCCGTGATATCCAGTTTGATAGTGAAAAAGGAGTGGACTTTGTTCTG
AATTACTCCAAAGCGATGGAGAACCTGTTCATCAACCGCTTCATGCACATGTTCCAGTCT
TCTTGGAATGACTTCGCCGACTTTGAGAAAATCTTTGTCAAGATCAGCAACACTATTTCT
GAGCGGGTCATGAATCACTGGCAGGAAGACCTGATGTTTGGCTACCAGTTCCTGAATGGC
TGCAACCCTGTGTTGATCCGGCGCTGCACAGAGCTGCCCGAGAAGCTCCCGGTGACCACG
GAGATGGTAGAGTGCAGCCTGGAGCGGCAGCTCAGCTTGGAGCAGGAGGTCCAGCAAGGG
AACATTTTCATCGTGGACTTTGAGCTGCTGGATGGCATCGATGCCAACAAAACAGACCCC
TGCACACTCCAGTTCCTGGCCGCTCCCATCTGCTTGCTGTATAAGAACCTGGCCAACAAG
ATTGTCCCCATTGCCATCCAGCTCAACCAAATCCCGGGAGATGAGAACCCTATTTTCCTC
CCTTCGGATGCAAAATACGACTGGCTTTTGGCCAAAATCTGGGTGCGTTCCAGTGACTTC
CACGTCCACCAGACCATCACCCACCTTCTGCGAACACATCTGGTGTCTGAGGTTTTTGGC
ATTGCAATGTACCGCCAGCTGCCTGCTGTGCACCCCATTTTCAAGCTGCTGGTGGCACAC
GTGAGATTCACCATTGCAATCAACACCAAGGCCCGTGAGCAGCTCATCTGCGAGTGTGGC
CTCTTTGACAAGGCCAACGCCACAGGGGGCGGTGGGCACGTGCAGATGGTGCAGAGGGCC
ATGAAGGACCTGACCTATGCCTCCCTGTGCTTTCCCGAGGCCATCAAGGCCCGGGGCATG
GAGAGCAAAGAAGACATCCCCTACTACTTCTACCGGGACGACGGGCTCCTGGTGTGGGAA
GCCATCAGGACGTTCACGGCCGAGGTGGTAGACATCTACTACGAGGGCGACCAGGTGGTG
GAGGAGGACCCGGAGCTGCAGGACTTCGTGAACGATGTCTACGTGTACGGCATGCGGGGC
CGCAAGTCCTCAGGCTTCCCCAAGTCGGTCAAGAGCCGGGAGCAGCTGTCGGAGTACCTG
ACCGTGGTGATCTTCACCGCCTCCGCCCAGCACGCCGCGGTCAACTTCGGCCAGTACGAC
TGGTGCTCCTGGATCCCCAATGCGCCCCCAACCATGCGAGCCCCGCCACCGACTGCCAAG
GGCGTGGTGACCATTGAGCAGATCGTGGACACGCTGCCCGACCGCGGCCGCTCCTGCTGG
CATCTGGGTGCAGTGTGGGCGCTGAGCCAGTTCCAGGAAAACGAGCTGTTCCTGGGCATG
TACCCAGAAGAGCATTTTATCGAGAAGCCTGTGAAGGAAGCCATGGCCCGATTCCGCAAG
AACCTCGAGGCCATTGTCAGCGTGATTGCTGAGCGCAACAAGAAGAAGCAGCTGCCATAT
TACTACTTGTCCCCAGACCGGATTCCGAACAGTGTGGCCATCTGA
Chromosome Location
10
Locus
10q11.2
External Identifiers
ResourceLink
UniProtKB IDP09917
UniProtKB Entry NameLOX5_HUMAN
GenBank Protein ID187193
GenBank Gene IDJ03600
GenAtlas IDALOX5
HGNC IDHGNC:435
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00711Diethylcarbamazineapproved, investigational, vet_approvedyesinhibitorDetails
DB00471Montelukastapprovedunknownother/unknownDetails
DB00744Zileutonapproved, investigational, withdrawnyesinhibitorDetails
DB00939Meclofenamic acidapproved, vet_approvedyesinhibitorDetails
DB01017Minocyclineapproved, investigationalunknowninhibitorDetails
DB01892HyperforinnutraceuticalunknowninhibitorDetails
DB04725LicofeloneinvestigationalunknownDetails
DB00163Vitamin Eapproved, nutraceutical, vet_approvedunknownDetails
DB00179Masoprocolapproved, investigationalyesinhibitorDetails
DB05431MLN-977investigationalunknownDetails
DB01014Balsalazideapproved, investigationalyesinhibitorDetails
DB00244MesalazineapprovedyesinhibitorDetails
DB00795SulfasalazineapprovedyesinhibitorDetails
DB00233Aminosalicylic AcidapprovedunknowninhibitorDetails
DB00586Diclofenacapproved, vet_approvedyespotentiatorDetails
DB13174RheinexperimentalunknowninhibitorDetails
DB11994Diacereinapproved, investigationalunknowninhibitorDetails
DB11133Omega-3 fatty acidsapproved, nutraceuticalunknownsubstrateDetails
DB13168Omega-6 fatty acidsnutraceuticalunknownsubstrateDetails
DB02709Resveratrolapproved, experimental, investigationalunknownDetails
DB09061Cannabidiolapproved, investigationalunknowninhibitorDetails
DB09285MorniflumateapprovedunknownantagonistDetails
DB09285MorniflumateapprovedunknowninhibitorDetails
DB14001alpha-Tocopherol succinateapproved, nutraceutical, vet_approvedunknownDetails
DB14002D-alpha-Tocopherol acetateapproved, nutraceutical, vet_approvedunknownDetails
DB14011Nabiximolsapproved, investigationalunknowninhibitorDetails
DB14009Medical Cannabisexperimental, investigationalunknowninhibitorDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails