Etanercept - DrugBank

ID Pharmacology Interactions References Trials Economics Properties Taxonomy

Targets (14)Enzymes (1)

Targets (14)Enzymes (1)Biointeractions (2)

Identification

Name

Etanercept

Accession Number

DB00005 (BTD00052, BIOD00052)

Type

Biotech

Groups

Approved, Investigational

Description

Dimeric fusion protein consisting of the extracellular ligand-binding portion of the human 75 kilodalton (p75) tumor necrosis factor receptor (TNFR) linked to the Fc portion of human IgG1. The Fc component of etanercept contains the CH2 domain, the CH3 domain and hinge region, but not the CH1 domain of IgG1. Etanercept is produced by recombinant DNA technology in a Chinese hamster ovary (CHO) mammalian cell expression system. It consists of 934 amino acids

Protein structure

Protein chemical formula

C₂₂₂₄H₃₄₇₅N₆₂₁O₆₉₈S₃₆

Protein average weight

51234.9 Da

Sequences

> Etanercept Sequence
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST
YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK
CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS
TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Download FASTA Format

Synonyms

CD120b

p75

p80 TNF-alpha receptor

TNF-R2

Tumor necrosis factor receptor 2

Tumor necrosis factor receptor superfamily member 1B precursor

Tumor necrosis factor receptor type II

External IDs

Not Available

Product Ingredients

Not Available

Approved Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Brenzys	Solution	50 mg	Subcutaneous	Samsung Bioepis Co., Ltd.	2016-09-13	Not applicable	Canada
Brenzys	Solution	50 mg	Subcutaneous	Samsung Bioepis Co., Ltd.	2016-09-23	Not applicable	Canada
Enbrel	Solution	50 mg	Subcutaneous	Immunex Corporation	2005-12-21	Not applicable	Canada
Enbrel	Injection, solution	25 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Kit			Immunex Corporation	2003-01-02	Not applicable	US
Enbrel	Injection, powder, for solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, powder, for solution	25 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Solution	25 mg/.5mL	Subcutaneous	Immunex Corporation	2005-11-10	Not applicable	US
Enbrel	Injection, powder, for solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, powder, for solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, powder, for solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, powder, for solution	10 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, powder, for solution	25 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, solution	25 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Solution	50 mg/mL	Subcutaneous	Immunex Corporation	2005-10-06	Not applicable	US
Enbrel	Injection, powder, for solution	25 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, powder, for solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, powder, for solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, powder, for solution	25 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, solution	25 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Solution	50 mg/mL	Subcutaneous	Immunex Corporation	2005-11-10	Not applicable	US
Enbrel	Injection, powder, for solution	25 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Enbrel	Injection, solution	50 mg	Subcutaneous	Pfizer	2000-02-03	Not applicable	EU
Erelzi	Solution	25 mg	Subcutaneous	Sandoz Canada Incorporated	Not applicable	Not applicable	Canada
Erelzi	Solution	50 mg	Subcutaneous	Sandoz Canada Incorporated	Not applicable	Not applicable	Canada
Erelzi	Solution	50 mg	Subcutaneous	Sandoz Canada Incorporated	Not applicable	Not applicable	Canada

Approved Generic Prescription Products

Not Available

Approved Over the Counter Products

Not Available

Unapproved/Other Products

Not Available

International Brands

Name	Company
Enbrel Sureclick	Not Available

Brand mixtures

Name	Ingredients	Dosage	Route	Labeller	Marketing Start	Marketing End
Enbrel	Etanercept Water	Kit; Liquid; Powder, for solution	Subcutaneous	Immunex Corporation	2001-03-14	Not applicable	Canada

Categories

UNII

OP401G7OJC

CAS number

185243-69-0

Pharmacology

Indication

Etanercept is indicated for the treatment of moderately to severely active rheumatoid arthritis in adults and chronic moderate to severe plaque psoriasis in adults. It is also used to manage signs and symptoms of polyarticular idiopathic arthritis in those aged 4 to 17 after insufficient response to one or more disease-modifying anti-rheumatic drugs. Etanercept is also used to improve psoriatic arthritis and ankylosing spondylitis.

Structured Indications

Pharmacodynamics

Etanercept binds specifically to tumor necrosis factor (TNF) and thereby modulates biological processes that are induced or regulated by TNF. Such processes or molecules affected include the level of adhesion molecules expressed, as well as serum levels of cytokines and matrix metalloproteinase-3, also known as stromelysin. In animal models, etanarcept has been demonstrated to affect inflammation, such as in murine collagen-induced arthritis.

Mechanism of action

There are two distinct receptors for TNF (TNFRs), a 55 kilodalton protein (p55) and a 75 kilodalton protein (p75). The biological activity of TNF is dependent upon binding to either cell surface receptor (p75 or p55). Etanercept is a dimeric soluble form of the p75 TNF receptor that can bind to two TNF molecules, thereby effectively removing them from circulation.

TNF is a naturally occurring cytokine that is involved in normal inflammatory and immune responses. Increased levels of TNF are found in tissues and fluids of those with rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis (AS), and plaque psoriasis.

Target	Kind	Pharmacological action	Actions	Organism	UniProt ID
Tumor necrosis factor	Protein	yes	antibody	Human	P01375	details
Tumor necrosis factor receptor superfamily member 1B	Protein	unknown	Not Available	Human	P20333	details
High affinity immunoglobulin gamma Fc receptor I	Protein	unknown	Not Available	Human	P12314	details
Low affinity immunoglobulin gamma Fc region receptor III-A	Protein	unknown	Not Available	Human	P08637	details
Low affinity immunoglobulin gamma Fc region receptor II-a	Protein	unknown	Not Available	Human	P12318	details
Low affinity immunoglobulin gamma Fc region receptor II-b	Protein	unknown	Not Available	Human	P31994	details
Low affinity immunoglobulin gamma Fc region receptor II-c	Protein	unknown	Not Available	Human	P31995	details
Lymphotoxin-alpha	Protein	unknown	Not Available	Human	P01374	details
Low affinity immunoglobulin gamma Fc region receptor III-B	Protein	unknown	Not Available	Human	O75015	details
Complement C1s subcomponent	Protein	unknown	Not Available	Human	P09871	details
Complement C1r subcomponent	Protein	unknown	Not Available	Human	P00736	details
Complement C1q subcomponent subunit A	Protein	unknown	Not Available	Human	P02745	details
Complement C1q subcomponent subunit B	Protein	unknown	Not Available	Human	P02746	details
Complement C1q subcomponent subunit C	Protein	unknown	Not Available	Human	P02747	details

Absorption

Bioavailability following sub-Q administration is approximately 60%. Peak plasma concentrations achieved within 69 hours.

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism

Not Available

Route of elimination

Not Available

Half life

102 +/- 30 hrs in individuals with rheumatoid arthritis and 68 hours in healthy adults

Clearance

160 +/- 80 mL/hr [RA patients]

Toxicity

Not Available

Affected organisms

Humans and other mammals

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

Drug	Interaction	Drug group
16-Bromoepiandrosterone	The risk or severity of adverse effects can be increased when Etanercept is combined with 16-Bromoepiandrosterone.	Investigational
19-norandrostenedione	The risk or severity of adverse effects can be increased when Etanercept is combined with 19-norandrostenedione.	Experimental, Illicit
5-androstenedione	The risk or severity of adverse effects can be increased when Etanercept is combined with 5-androstenedione.	Experimental, Illicit
Abatacept	The risk or severity of adverse effects can be increased when Etanercept is combined with Abatacept.	Approved
Abciximab	Etanercept may increase the anticoagulant activities of Abciximab.	Approved
Acebutolol	Etanercept may decrease the antihypertensive activities of Acebutolol.	Approved
Aceclofenac	The risk or severity of adverse effects can be increased when Etanercept is combined with Aceclofenac.	Approved
Acenocoumarol	Etanercept may increase the anticoagulant activities of Acenocoumarol.	Approved
Acetylsalicylic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Acetylsalicylic acid.	Approved, Vet Approved
Aclarubicin	Etanercept may decrease the excretion rate of Aclarubicin which could result in a higher serum level.	Investigational
Adalimumab	The risk or severity of adverse effects can be increased when Adalimumab is combined with Etanercept.	Approved
Adapalene	The risk or severity of adverse effects can be increased when Etanercept is combined with Adapalene.	Approved
Alclometasone	The risk or severity of adverse effects can be increased when Etanercept is combined with Alclometasone.	Approved
Aldosterone	The risk or severity of adverse effects can be increased when Etanercept is combined with Aldosterone.	Experimental
Alendronic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Alendronic acid.	Approved
Aliskiren	Etanercept may decrease the antihypertensive activities of Aliskiren.	Approved, Investigational
Alprenolol	Etanercept may decrease the antihypertensive activities of Alprenolol.	Approved, Withdrawn
Alprostadil	The therapeutic efficacy of Alprostadil can be decreased when used in combination with Etanercept.	Approved, Investigational
Amcinonide	The risk or severity of adverse effects can be increased when Etanercept is combined with Amcinonide.	Approved
Amikacin	Etanercept may decrease the excretion rate of Amikacin which could result in a higher serum level.	Approved, Vet Approved
Amiloride	Etanercept may decrease the antihypertensive activities of Amiloride.	Approved
Amrubicin	Etanercept may decrease the excretion rate of Amrubicin which could result in a higher serum level.	Approved, Investigational
Anakinra	The risk or severity of adverse effects can be increased when Etanercept is combined with Anakinra.	Approved
Ancrod	Etanercept may increase the anticoagulant activities of Ancrod.	Investigational
Andrographolide	The risk or severity of adverse effects can be increased when Etanercept is combined with HMPL-004.	Investigational
Androstenedione	The risk or severity of adverse effects can be increased when Etanercept is combined with 4-Androstenedione.	Experimental, Illicit
Anecortave	The risk or severity of adverse effects can be increased when Etanercept is combined with Anecortave.	Investigational
Anisodamine	The risk or severity of adverse effects can be increased when Etanercept is combined with Anisodamine.	Investigational
Antipyrine	The risk or severity of adverse effects can be increased when Etanercept is combined with Antipyrine.	Approved
Antithrombin III human	Etanercept may increase the anticoagulant activities of Antithrombin III human.	Approved
Apixaban	Etanercept may increase the anticoagulant activities of Apixaban.	Approved
Apocynin	The risk or severity of adverse effects can be increased when Etanercept is combined with Acetovanillone.	Investigational
Apramycin	Etanercept may decrease the excretion rate of Apramycin which could result in a higher serum level.	Experimental, Vet Approved
Apremilast	The risk or severity of adverse effects can be increased when Etanercept is combined with Apremilast.	Approved, Investigational
Arbekacin	Etanercept may decrease the excretion rate of Arbekacin which could result in a higher serum level.	Approved
Ardeparin	Etanercept may increase the anticoagulant activities of Ardeparin.	Approved, Withdrawn
Argatroban	Etanercept may increase the anticoagulant activities of Argatroban.	Approved, Investigational
Arotinolol	Etanercept may decrease the antihypertensive activities of Arotinolol.	Approved
Atenolol	Etanercept may decrease the antihypertensive activities of Atenolol.	Approved
Azapropazone	The risk or severity of adverse effects can be increased when Etanercept is combined with Azapropazone.	Withdrawn
Azelastine	The risk or severity of adverse effects can be increased when Etanercept is combined with Azelastine.	Approved
Azilsartan medoxomil	The risk or severity of adverse effects can be increased when Azilsartan medoxomil is combined with Etanercept.	Approved
Balsalazide	Etanercept may increase the nephrotoxic activities of Balsalazide.	Approved, Investigational
BCG vaccine	The therapeutic efficacy of Bcg can be decreased when used in combination with Etanercept.	Investigational
Becaplermin	Etanercept may increase the anticoagulant activities of Becaplermin.	Approved, Investigational
Beclomethasone dipropionate	The risk or severity of adverse effects can be increased when Etanercept is combined with Beclomethasone dipropionate.	Approved, Investigational
Befunolol	Etanercept may decrease the antihypertensive activities of Befunolol.	Experimental
Belimumab	The risk or severity of adverse effects can be increased when Etanercept is combined with Belimumab.	Approved
Benazepril	The risk or severity of adverse effects can be increased when Benazepril is combined with Etanercept.	Approved, Investigational
Bendroflumethiazide	The therapeutic efficacy of Bendroflumethiazide can be decreased when used in combination with Etanercept.	Approved
Benoxaprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Benoxaprofen.	Withdrawn
Beraprost	The therapeutic efficacy of Beraprost can be decreased when used in combination with Etanercept.	Investigational
Betamethasone	The risk or severity of adverse effects can be increased when Etanercept is combined with Betamethasone.	Approved, Vet Approved
Betaxolol	Etanercept may decrease the antihypertensive activities of Betaxolol.	Approved
Betulinic Acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Betulinic Acid.	Investigational
Bevantolol	Etanercept may decrease the antihypertensive activities of Bevantolol.	Approved
Bimatoprost	The therapeutic efficacy of Bimatoprost can be decreased when used in combination with Etanercept.	Approved, Investigational
Bisoprolol	Etanercept may decrease the antihypertensive activities of Bisoprolol.	Approved
Bivalirudin	Etanercept may increase the anticoagulant activities of Bivalirudin.	Approved, Investigational
Bopindolol	Etanercept may decrease the antihypertensive activities of Bopindolol.	Approved
Bromfenac	The risk or severity of adverse effects can be increased when Etanercept is combined with Bromfenac.	Approved
Bucillamine	The risk or severity of adverse effects can be increased when Etanercept is combined with Bucillamine.	Investigational
Bucindolol	Etanercept may decrease the antihypertensive activities of Bucindolol.	Investigational
Budesonide	The risk or severity of adverse effects can be increased when Etanercept is combined with Budesonide.	Approved
Bufuralol	Etanercept may decrease the antihypertensive activities of Bufuralol.	Experimental, Investigational
Bumetanide	Etanercept may decrease the diuretic activities of Bumetanide.	Approved
Bupranolol	Etanercept may decrease the antihypertensive activities of Bupranolol.	Approved
Canakinumab	The risk or severity of adverse effects can be increased when Etanercept is combined with Canakinumab.	Approved, Investigational
Candesartan	The risk or severity of adverse effects can be increased when Candesartan is combined with Etanercept.	Approved
Candoxatril	The risk or severity of adverse effects can be increased when Candoxatril is combined with Etanercept.	Experimental
Captopril	The risk or severity of adverse effects can be increased when Captopril is combined with Etanercept.	Approved
Carboprost Tromethamine	The therapeutic efficacy of Carboprost Tromethamine can be decreased when used in combination with Etanercept.	Approved
Carprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Carprofen.	Approved, Vet Approved, Withdrawn
Carteolol	Etanercept may decrease the antihypertensive activities of Carteolol.	Approved
Carvedilol	Etanercept may decrease the antihypertensive activities of Carvedilol.	Approved, Investigational
Castanospermine	The risk or severity of adverse effects can be increased when Etanercept is combined with Castanospermine.	Experimental
Celecoxib	The risk or severity of adverse effects can be increased when Etanercept is combined with Celecoxib.	Approved, Investigational
Celiprolol	Etanercept may decrease the antihypertensive activities of Celiprolol.	Approved, Investigational
Certolizumab pegol	Etanercept may increase the immunosuppressive activities of Certolizumab pegol.	Approved
Certoparin	Etanercept may increase the anticoagulant activities of Certoparin.	Approved
Chloroquine	The risk or severity of adverse effects can be increased when Etanercept is combined with Chloroquine.	Approved, Vet Approved
Chlorothiazide	The therapeutic efficacy of Chlorothiazide can be decreased when used in combination with Etanercept.	Approved, Vet Approved
Chlorthalidone	The therapeutic efficacy of Chlorthalidone can be decreased when used in combination with Etanercept.	Approved
Cholestyramine	Cholestyramine can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.	Approved
Choline magnesium trisalicylate	The risk or severity of adverse effects can be increased when Etanercept is combined with Trisalicylate-choline.	Approved
Ciclesonide	The risk or severity of adverse effects can be increased when Etanercept is combined with Ciclesonide.	Approved, Investigational
Cilazapril	The risk or severity of adverse effects can be increased when Cilazapril is combined with Etanercept.	Approved
Cinoxacin	Etanercept may increase the neuroexcitatory activities of Cinoxacin.	Approved, Withdrawn
Ciprofloxacin	Etanercept may increase the neuroexcitatory activities of Ciprofloxacin.	Approved, Investigational
Citric Acid	Etanercept may increase the anticoagulant activities of Citric Acid.	Nutraceutical, Vet Approved
Clobetasol	The risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasol.	Investigational
Clobetasol propionate	The risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasol propionate.	Approved
Clocortolone	The risk or severity of adverse effects can be increased when Etanercept is combined with Clocortolone.	Approved
Clodronic Acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Clodronate.	Approved, Investigational, Vet Approved
Clonixin	The risk or severity of adverse effects can be increased when Etanercept is combined with Clonixin.	Approved
Colesevelam	Colesevelam can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.	Approved
Colestipol	Colestipol can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.	Approved
Cortisone acetate	The risk or severity of adverse effects can be increased when Etanercept is combined with Cortisone acetate.	Approved
Curcumin	The risk or severity of adverse effects can be increased when Etanercept is combined with Curcumin.	Investigational
Cyclophosphamide	The risk or severity of adverse effects can be increased when Etanercept is combined with Cyclophosphamide.	Approved, Investigational
Cyclosporine	Etanercept may increase the nephrotoxic activities of Cyclosporine.	Approved, Investigational, Vet Approved
Dabigatran etexilate	Etanercept may increase the anticoagulant activities of Dabigatran etexilate.	Approved
Dalteparin	Etanercept may increase the anticoagulant activities of Dalteparin.	Approved
Darexaban	Etanercept may increase the anticoagulant activities of Ym150.	Investigational
Daunorubicin	Etanercept may decrease the excretion rate of Daunorubicin which could result in a higher serum level.	Approved
Deferasirox	The risk or severity of adverse effects can be increased when Etanercept is combined with Deferasirox.	Approved, Investigational
Denosumab	The risk or severity of adverse effects can be increased when Denosumab is combined with Etanercept.	Approved
Desirudin	Etanercept may increase the anticoagulant activities of Desirudin.	Approved
Desmopressin	The risk or severity of adverse effects can be increased when Etanercept is combined with Desmopressin.	Approved
Desoximetasone	The risk or severity of adverse effects can be increased when Etanercept is combined with Desoximetasone.	Approved
Desoxycorticosterone Pivalate	The risk or severity of adverse effects can be increased when Etanercept is combined with Desoxycorticosterone Pivalate.	Experimental, Vet Approved
Dexamethasone	The risk or severity of adverse effects can be increased when Etanercept is combined with Dexamethasone.	Approved, Investigational, Vet Approved
Dexketoprofen	The risk or severity of adverse effects can be increased when Dexketoprofen is combined with Etanercept.	Approved
Dextran	Etanercept may increase the anticoagulant activities of Dextran.	Approved, Vet Approved
Dextran 40	Etanercept may increase the anticoagulant activities of Dextran 40.	Approved
Diclofenac	The risk or severity of adverse effects can be increased when Diclofenac is combined with Etanercept.	Approved, Vet Approved
Dicoumarol	Etanercept may increase the anticoagulant activities of Dicoumarol.	Approved
Diflorasone	The risk or severity of adverse effects can be increased when Etanercept is combined with Diflorasone.	Approved
Diflunisal	The risk or severity of adverse effects can be increased when Etanercept is combined with Diflunisal.	Approved
Difluocortolone	The risk or severity of adverse effects can be increased when Etanercept is combined with Difluocortolone.	Approved
Difluprednate	The risk or severity of adverse effects can be increased when Etanercept is combined with Difluprednate.	Approved
Digoxin	The serum concentration of Digoxin can be increased when it is combined with Etanercept.	Approved
Dinoprost	The therapeutic efficacy of Dinoprost can be decreased when used in combination with Etanercept.	Investigational
Dinoprost Tromethamine	The therapeutic efficacy of Dinoprost Tromethamine can be decreased when used in combination with Etanercept.	Approved, Vet Approved
Dinoprostone	The therapeutic efficacy of Dinoprostone can be decreased when used in combination with Etanercept.	Approved
Doxorubicin	Etanercept may decrease the excretion rate of Doxorubicin which could result in a higher serum level.	Approved, Investigational
Drospirenone	Etanercept may increase the hyperkalemic activities of Drospirenone.	Approved
Droxicam	The risk or severity of adverse effects can be increased when Etanercept is combined with Droxicam.	Approved
Duvelisib	The risk or severity of adverse effects can be increased when Etanercept is combined with Duvelisib.	Investigational
E-6201	The risk or severity of adverse effects can be increased when Etanercept is combined with E6201.	Investigational
Ebselen	The risk or severity of adverse effects can be increased when Etanercept is combined with Ebselen.	Investigational
Edetic Acid	Etanercept may increase the anticoagulant activities of Edetic Acid.	Approved, Vet Approved
Edoxaban	Etanercept may increase the anticoagulant activities of Edoxaban.	Approved
Enalapril	The risk or severity of adverse effects can be increased when Enalapril is combined with Etanercept.	Approved, Vet Approved
Enalaprilat	The risk or severity of adverse effects can be increased when Enalaprilat is combined with Etanercept.	Approved
Enoxacin	Etanercept may increase the neuroexcitatory activities of Enoxacin.	Approved
Enoxaparin	Etanercept may increase the anticoagulant activities of Enoxaparin.	Approved
Epirizole	The risk or severity of adverse effects can be increased when Etanercept is combined with Epirizole.	Approved
Epirubicin	Etanercept may decrease the excretion rate of Epirubicin which could result in a higher serum level.	Approved
Eplerenone	Etanercept may decrease the antihypertensive activities of Eplerenone.	Approved
Epoprostenol	The therapeutic efficacy of Epoprostenol can be decreased when used in combination with Etanercept.	Approved
Eprosartan	The risk or severity of adverse effects can be increased when Eprosartan is combined with Etanercept.	Approved
Equilenin	The risk or severity of adverse effects can be increased when Etanercept is combined with Equilenin.	Experimental
Equilin	The risk or severity of adverse effects can be increased when Etanercept is combined with Equilin.	Approved
Esmolol	Etanercept may decrease the antihypertensive activities of Esmolol.	Approved
Estrone	The risk or severity of adverse effects can be increased when Etanercept is combined with Estrone.	Approved
Estrone sulfate	The risk or severity of adverse effects can be increased when Etanercept is combined with Estrone sulfate.	Approved
Etacrynic acid	Etanercept may decrease the diuretic activities of Etacrynic acid.	Approved
Ethyl biscoumacetate	Etanercept may increase the anticoagulant activities of Ethyl biscoumacetate.	Withdrawn
Etidronic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Etidronic acid.	Approved
Etodolac	The risk or severity of adverse effects can be increased when Etanercept is combined with Etodolac.	Approved, Investigational, Vet Approved
Etofenamate	The risk or severity of adverse effects can be increased when Etanercept is combined with Etofenamate.	Approved
Etoricoxib	The risk or severity of adverse effects can be increased when Etanercept is combined with Etoricoxib.	Approved, Investigational
Fenbufen	The risk or severity of adverse effects can be increased when Etanercept is combined with Fenbufen.	Approved
Fenoprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Fenoprofen.	Approved
Fingolimod	Etanercept may increase the immunosuppressive activities of Fingolimod.	Approved, Investigational
Fleroxacin	Etanercept may increase the neuroexcitatory activities of Fleroxacin.	Approved
Floctafenine	The risk or severity of adverse effects can be increased when Floctafenine is combined with Etanercept.	Approved, Withdrawn
Fludrocortisone	The risk or severity of adverse effects can be increased when Etanercept is combined with Fludrocortisone.	Approved
Fluindione	Etanercept may increase the anticoagulant activities of Fluindione.	Investigational
Flumequine	Etanercept may increase the neuroexcitatory activities of Flumequine.	Withdrawn
Flumethasone	The risk or severity of adverse effects can be increased when Etanercept is combined with Flumethasone.	Approved, Vet Approved
Flunisolide	The risk or severity of adverse effects can be increased when Etanercept is combined with Flunisolide.	Approved, Investigational
Fluocinolone Acetonide	The risk or severity of adverse effects can be increased when Etanercept is combined with Fluocinolone Acetonide.	Approved, Investigational, Vet Approved
Fluocinonide	The risk or severity of adverse effects can be increased when Etanercept is combined with Fluocinonide.	Approved, Investigational
Fluocortolone	The risk or severity of adverse effects can be increased when Etanercept is combined with Fluocortolone.	Approved, Withdrawn
Fluorometholone	The risk or severity of adverse effects can be increased when Etanercept is combined with Fluorometholone.	Approved
Fluprednidene	The risk or severity of adverse effects can be increased when Etanercept is combined with Fluprednidene.	Approved, Withdrawn
Flurandrenolide	The risk or severity of adverse effects can be increased when Etanercept is combined with Flurandrenolide.	Approved
Flurbiprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Flurbiprofen.	Approved, Investigational
Fluticasone furoate	The risk or severity of adverse effects can be increased when Etanercept is combined with Fluticasone furoate.	Approved
Fluticasone propionate	The risk or severity of adverse effects can be increased when Etanercept is combined with Fluticasone Propionate.	Approved
Folic Acid	The therapeutic efficacy of Folic Acid can be decreased when used in combination with Etanercept.	Approved, Nutraceutical, Vet Approved
Fondaparinux	Etanercept may increase the anticoagulant activities of Fondaparinux.	Investigational
Fondaparinux sodium	Etanercept may increase the anticoagulant activities of Fondaparinux sodium.	Approved, Investigational
Forasartan	The risk or severity of adverse effects can be increased when Forasartan is combined with Etanercept.	Experimental
Formestane	The risk or severity of adverse effects can be increased when Etanercept is combined with Formestane.	Approved, Investigational, Withdrawn
Fosinopril	The risk or severity of adverse effects can be increased when Fosinopril is combined with Etanercept.	Approved
Framycetin	Etanercept may decrease the excretion rate of Framycetin which could result in a higher serum level.	Approved
Furosemide	Etanercept may decrease the diuretic activities of Furosemide.	Approved, Vet Approved
G17DT	The risk or severity of adverse effects can be increased when Etanercept is combined with G17DT.	Investigational
Gabexate	Etanercept may increase the anticoagulant activities of Gabexate.	Investigational
Gatifloxacin	Etanercept may increase the neuroexcitatory activities of Gatifloxacin.	Approved, Investigational
Gemeprost	The therapeutic efficacy of Gemeprost can be decreased when used in combination with Etanercept.	Approved, Withdrawn
Gemifloxacin	Etanercept may increase the neuroexcitatory activities of Gemifloxacin.	Approved, Investigational
Geneticin	Etanercept may decrease the excretion rate of Geneticin which could result in a higher serum level.	Experimental
Gentamicin	Etanercept may decrease the excretion rate of Gentamicin which could result in a higher serum level.	Approved, Vet Approved
GENTAMICIN C1A	Etanercept may decrease the excretion rate of GENTAMICIN C1A which could result in a higher serum level.	Experimental
Golimumab	The risk or severity of adverse effects can be increased when Etanercept is combined with Golimumab.	Approved
Grepafloxacin	Etanercept may increase the neuroexcitatory activities of Grepafloxacin.	Withdrawn
Haloperidol	The risk or severity of adverse effects can be increased when Etanercept is combined with Haloperidol.	Approved
HE3286	The risk or severity of adverse effects can be increased when Etanercept is combined with HE3286.	Investigational
Heparin	Etanercept may increase the anticoagulant activities of Heparin.	Approved, Investigational
Higenamine	The risk or severity of adverse effects can be increased when Etanercept is combined with Higenamine.	Investigational
Hydralazine	Etanercept may decrease the antihypertensive activities of Hydralazine.	Approved
Hydrochlorothiazide	The therapeutic efficacy of Hydrochlorothiazide can be decreased when used in combination with Etanercept.	Approved, Vet Approved
Hydrocortisone	The risk or severity of adverse effects can be increased when Etanercept is combined with Hydrocortisone.	Approved, Vet Approved
Hydroflumethiazide	The therapeutic efficacy of Hydroflumethiazide can be decreased when used in combination with Etanercept.	Approved
Ibandronate	The risk or severity of adverse effects can be increased when Etanercept is combined with Ibandronate.	Approved, Investigational
Ibuprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Ibuprofen.	Approved
Ibuproxam	The risk or severity of adverse effects can be increased when Etanercept is combined with Ibuproxam.	Withdrawn
Icatibant	The risk or severity of adverse effects can be increased when Etanercept is combined with Icatibant.	Approved
Idarubicin	Etanercept may decrease the excretion rate of Idarubicin which could result in a higher serum level.	Approved
Iloprost	The therapeutic efficacy of Iloprost can be decreased when used in combination with Etanercept.	Approved, Investigational
Imidapril	The risk or severity of adverse effects can be increased when Imidapril is combined with Etanercept.	Investigational
Indapamide	The therapeutic efficacy of Indapamide can be decreased when used in combination with Etanercept.	Approved
Indenolol	Etanercept may decrease the antihypertensive activities of Indenolol.	Withdrawn
Indomethacin	The risk or severity of adverse effects can be increased when Etanercept is combined with Indomethacin.	Approved, Investigational
Indoprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Indoprofen.	Withdrawn
Infliximab	Etanercept may increase the immunosuppressive activities of Infliximab.	Approved
INGN 201	The risk or severity of adverse effects can be increased when Etanercept is combined with INGN 201.	Investigational
INGN 225	The risk or severity of adverse effects can be increased when Etanercept is combined with INGN 225.	Investigational
Irbesartan	The risk or severity of adverse effects can be increased when Irbesartan is combined with Etanercept.	Approved, Investigational
Isoxicam	The risk or severity of adverse effects can be increased when Etanercept is combined with Isoxicam.	Withdrawn
Kanamycin	Etanercept may decrease the excretion rate of Kanamycin which could result in a higher serum level.	Approved, Vet Approved
Kebuzone	The risk or severity of adverse effects can be increased when Etanercept is combined with Kebuzone.	Experimental
Ketoprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Ketoprofen.	Approved, Vet Approved
Ketorolac	The risk or severity of adverse effects can be increased when Ketorolac is combined with Etanercept.	Approved
Labetalol	Etanercept may decrease the antihypertensive activities of Labetalol.	Approved
Landiolol	Etanercept may decrease the antihypertensive activities of Aop200704.	Investigational
Latanoprost	The therapeutic efficacy of Latanoprost can be decreased when used in combination with Etanercept.	Approved, Investigational
Leflunomide	The risk or severity of adverse effects can be increased when Etanercept is combined with Leflunomide.	Approved, Investigational
Lepirudin	Etanercept may increase the anticoagulant activities of Lepirudin.	Approved
Levobunolol	Etanercept may decrease the antihypertensive activities of Levobunolol.	Approved
Levofloxacin	Etanercept may increase the neuroexcitatory activities of Levofloxacin.	Approved, Investigational
Limaprost	The therapeutic efficacy of Limaprost can be decreased when used in combination with Etanercept.	Approved
Lisinopril	The risk or severity of adverse effects can be increased when Lisinopril is combined with Etanercept.	Approved, Investigational
Lisofylline	The risk or severity of adverse effects can be increased when Etanercept is combined with Lisofylline.	Investigational
Lithium	The serum concentration of Lithium can be increased when it is combined with Etanercept.	Approved
Lomefloxacin	Etanercept may increase the neuroexcitatory activities of Lomefloxacin.	Approved
Lornoxicam	The risk or severity of adverse effects can be increased when Etanercept is combined with Lornoxicam.	Approved
Losartan	The risk or severity of adverse effects can be increased when Losartan is combined with Etanercept.	Approved
Loxoprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Loxoprofen.	Approved
Lubiprostone	The therapeutic efficacy of Lubiprostone can be decreased when used in combination with Etanercept.	Approved, Investigational
Lumiracoxib	The risk or severity of adverse effects can be increased when Etanercept is combined with Lumiracoxib.	Approved, Investigational
Magnesium salicylate	The risk or severity of adverse effects can be increased when Etanercept is combined with Magnesium salicylate.	Approved
Masoprocol	The risk or severity of adverse effects can be increased when Etanercept is combined with Masoprocol.	Approved
ME-609	The risk or severity of adverse effects can be increased when Etanercept is combined with ME-609.	Investigational
Meclofenamic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Meclofenamic acid.	Approved, Vet Approved
Medrysone	The risk or severity of adverse effects can be increased when Etanercept is combined with Medrysone.	Approved
Mefenamic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Mefenamic acid.	Approved
Meloxicam	The risk or severity of adverse effects can be increased when Etanercept is combined with Meloxicam.	Approved, Vet Approved
Mesalazine	Etanercept may increase the nephrotoxic activities of Mesalazine.	Approved
Metamizole	The risk or severity of adverse effects can be increased when Etanercept is combined with Metamizole.	Withdrawn
Methotrexate	The serum concentration of Methotrexate can be increased when it is combined with Etanercept.	Approved
Methyclothiazide	The therapeutic efficacy of Methyclothiazide can be decreased when used in combination with Etanercept.	Approved
Methylprednisolone	The risk or severity of adverse effects can be increased when Etanercept is combined with Methylprednisolone.	Approved, Vet Approved
Metipranolol	Etanercept may decrease the antihypertensive activities of Metipranolol.	Approved
Metolazone	The therapeutic efficacy of Metolazone can be decreased when used in combination with Etanercept.	Approved
Metoprolol	Etanercept may decrease the antihypertensive activities of Metoprolol.	Approved, Investigational
Metrizamide	Etanercept may decrease the excretion rate of Metrizamide which could result in a higher serum level.	Approved
Misoprostol	The therapeutic efficacy of Misoprostol can be decreased when used in combination with Etanercept.	Approved
Mizoribine	The risk or severity of adverse effects can be increased when Etanercept is combined with Mizoribine.	Investigational
Moexipril	The risk or severity of adverse effects can be increased when Moexipril is combined with Etanercept.	Approved
Mometasone	The risk or severity of adverse effects can be increased when Etanercept is combined with Mometasone.	Approved, Vet Approved
Morniflumate	The risk or severity of adverse effects can be increased when Morniflumate is combined with Etanercept.	Approved
Moxifloxacin	Etanercept may increase the neuroexcitatory activities of Moxifloxacin.	Approved, Investigational
Mycophenolate mofetil	The risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolate mofetil.	Approved, Investigational
Mycophenolic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolic acid.	Approved
Nabumetone	The risk or severity of adverse effects can be increased when Etanercept is combined with Nabumetone.	Approved
Nadolol	Etanercept may decrease the antihypertensive activities of Nadolol.	Approved
Nadroparin	Etanercept may increase the anticoagulant activities of Nadroparin.	Approved
Nafamostat	Etanercept may increase the anticoagulant activities of Nafamostat.	Approved, Investigational
Naftifine	The risk or severity of adverse effects can be increased when Etanercept is combined with Naftifine.	Approved
Nalidixic Acid	Etanercept may increase the neuroexcitatory activities of Nalidixic Acid.	Approved
Naproxen	The risk or severity of adverse effects can be increased when Etanercept is combined with Naproxen.	Approved, Vet Approved
Natalizumab	The risk or severity of adverse effects can be increased when Etanercept is combined with Natalizumab.	Approved, Investigational
NCX 1022	The risk or severity of adverse effects can be increased when Etanercept is combined with NCX 1022.	Investigational
Neamine	Etanercept may decrease the excretion rate of Neamine which could result in a higher serum level.	Experimental
Neomycin	Etanercept may decrease the excretion rate of Neomycin which could result in a higher serum level.	Approved, Vet Approved
Nepafenac	The risk or severity of adverse effects can be increased when Etanercept is combined with Nepafenac.	Approved
Netilmicin	Etanercept may decrease the excretion rate of Netilmicin which could result in a higher serum level.	Approved
Niflumic Acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Niflumic Acid.	Approved
Nimesulide	The risk or severity of adverse effects can be increased when Etanercept is combined with Nimesulide.	Approved, Withdrawn
Nitroaspirin	The risk or severity of adverse effects can be increased when Etanercept is combined with Nitroaspirin.	Investigational
Norfloxacin	Etanercept may increase the neuroexcitatory activities of Norfloxacin.	Approved
Ofloxacin	Etanercept may increase the neuroexcitatory activities of Ofloxacin.	Approved
Oleoyl-estrone	The risk or severity of adverse effects can be increased when Etanercept is combined with Oleoyl estrone.	Investigational
Olmesartan	The risk or severity of adverse effects can be increased when Olmesartan is combined with Etanercept.	Approved, Investigational
Olopatadine	The risk or severity of adverse effects can be increased when Etanercept is combined with Olopatadine.	Approved
Olsalazine	Etanercept may increase the nephrotoxic activities of Olsalazine.	Approved
Omacetaxine mepesuccinate	The risk or severity of adverse effects can be increased when Etanercept is combined with Omacetaxine mepesuccinate.	Approved
Omapatrilat	The risk or severity of adverse effects can be increased when Omapatrilat is combined with Etanercept.	Investigational
Oxaprozin	The risk or severity of adverse effects can be increased when Etanercept is combined with Oxaprozin.	Approved
Oxprenolol	Etanercept may decrease the antihypertensive activities of Oxprenolol.	Approved
Oxyphenbutazone	The risk or severity of adverse effects can be increased when Etanercept is combined with Oxyphenbutazone.	Withdrawn
Pamidronate	The risk or severity of adverse effects can be increased when Etanercept is combined with Pamidronate.	Approved
Paramethasone	The risk or severity of adverse effects can be increased when Etanercept is combined with Paramethasone.	Approved
Parecoxib	The risk or severity of adverse effects can be increased when Etanercept is combined with Parecoxib.	Approved
Paromomycin	Etanercept may decrease the excretion rate of Paromomycin which could result in a higher serum level.	Approved, Investigational
Pazufloxacin	Etanercept may increase the neuroexcitatory activities of Pazufloxacin.	Investigational
Pefloxacin	Etanercept may increase the neuroexcitatory activities of Pefloxacin.	Approved
Penbutolol	Etanercept may decrease the antihypertensive activities of Penbutolol.	Approved, Investigational
Pentosan Polysulfate	Etanercept may increase the anticoagulant activities of Pentosan Polysulfate.	Approved
Perindopril	The risk or severity of adverse effects can be increased when Perindopril is combined with Etanercept.	Approved
Phenindione	Etanercept may increase the anticoagulant activities of Phenindione.	Approved
Phenprocoumon	Etanercept may increase the anticoagulant activities of Phenprocoumon.	Approved
Phenylbutazone	The risk or severity of adverse effects can be increased when Etanercept is combined with Phenylbutazone.	Approved, Vet Approved
Pimecrolimus	The risk or severity of adverse effects can be increased when Pimecrolimus is combined with Etanercept.	Approved, Investigational
Pindolol	Etanercept may decrease the antihypertensive activities of Pindolol.	Approved
Pirarubicin	Etanercept may decrease the excretion rate of Pirarubicin which could result in a higher serum level.	Investigational
Piretanide	Etanercept may decrease the diuretic activities of Piretanide.	Experimental
Pirfenidone	The risk or severity of adverse effects can be increased when Etanercept is combined with Pirfenidone.	Investigational
Piroxicam	The risk or severity of adverse effects can be increased when Etanercept is combined with Piroxicam.	Approved, Investigational
Plicamycin	Etanercept may decrease the excretion rate of Plicamycin which could result in a higher serum level.	Approved, Withdrawn
Polythiazide	The therapeutic efficacy of Polythiazide can be decreased when used in combination with Etanercept.	Approved
Practolol	Etanercept may decrease the antihypertensive activities of Practolol.	Approved
Pralatrexate	The serum concentration of Pralatrexate can be increased when it is combined with Etanercept.	Approved
Prasterone	The risk or severity of adverse effects can be increased when Etanercept is combined with Prasterone.	Approved, Nutraceutical
Prasterone sulfate	The risk or severity of adverse effects can be increased when Etanercept is combined with dehydroepiandrosterone sulfate.	Investigational
Prednicarbate	The risk or severity of adverse effects can be increased when Etanercept is combined with Prednicarbate.	Approved
Prednisolone	The risk or severity of adverse effects can be increased when Etanercept is combined with Prednisolone.	Approved, Vet Approved
Prednisone	The risk or severity of adverse effects can be increased when Etanercept is combined with Prednisone.	Approved, Vet Approved
Pregnenolone	The risk or severity of adverse effects can be increased when Etanercept is combined with Pregnenolone.	Experimental
Probenecid	The serum concentration of Etanercept can be increased when it is combined with Probenecid.	Approved
Propacetamol	The risk or severity of adverse effects can be increased when Etanercept is combined with Propacetamol.	Approved
Propranolol	Etanercept may decrease the antihypertensive activities of Propranolol.	Approved, Investigational
Prostaglandin B2	The therapeutic efficacy of Prostaglandin B2 can be decreased when used in combination with Etanercept.	Experimental
Prostaglandin G2	The therapeutic efficacy of Prostaglandin G2 can be decreased when used in combination with Etanercept.	Experimental
Protein S human	Etanercept may increase the anticoagulant activities of Protein S human.	Approved
Prulifloxacin	Etanercept may increase the neuroexcitatory activities of Prulifloxacin.	Investigational
PTC299	The risk or severity of adverse effects can be increased when Etanercept is combined with PTC299.	Investigational
Puromycin	Etanercept may decrease the excretion rate of Puromycin which could result in a higher serum level.	Experimental
Quinapril	The risk or severity of adverse effects can be increased when Quinapril is combined with Etanercept.	Approved, Investigational
Quinethazone	The therapeutic efficacy of Quinethazone can be decreased when used in combination with Etanercept.	Approved
Ramipril	The risk or severity of adverse effects can be increased when Ramipril is combined with Etanercept.	Approved
Rescinnamine	The risk or severity of adverse effects can be increased when Rescinnamine is combined with Etanercept.	Approved
Resveratrol	The risk or severity of adverse effects can be increased when Etanercept is combined with Resveratrol.	Experimental, Investigational
Reviparin	Etanercept may increase the anticoagulant activities of Reviparin.	Approved
Ribostamycin	Etanercept may decrease the excretion rate of Ribostamycin which could result in a higher serum level.	Approved
Rilonacept	The risk or severity of adverse effects can be increased when Etanercept is combined with Rilonacept.	Approved
Rimexolone	The risk or severity of adverse effects can be increased when Etanercept is combined with Rimexolone.	Approved
Rindopepimut	The risk or severity of adverse effects can be increased when Etanercept is combined with CDX-110.	Investigational
Risedronate	The risk or severity of adverse effects can be increased when Etanercept is combined with Risedronate.	Approved, Investigational
Rituximab	The risk or severity of adverse effects can be increased when Etanercept is combined with Rituximab.	Approved
Rivaroxaban	Etanercept may increase the anticoagulant activities of Rivaroxaban.	Approved
Rofecoxib	The risk or severity of adverse effects can be increased when Etanercept is combined with Rofecoxib.	Investigational, Withdrawn
Roflumilast	Roflumilast may increase the immunosuppressive activities of Etanercept.	Approved
Rosoxacin	Etanercept may increase the neuroexcitatory activities of Rosoxacin.	Approved
Sacubitril	The risk or severity of adverse effects can be increased when Sacubitril is combined with Etanercept.	Approved
Salicylamide	The risk or severity of adverse effects can be increased when Etanercept is combined with Salicylamide.	Approved
Salicylic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Salicylic acid.	Approved, Vet Approved
Salsalate	The risk or severity of adverse effects can be increased when Etanercept is combined with Salsalate.	Approved
Saprisartan	The risk or severity of adverse effects can be increased when Saprisartan is combined with Etanercept.	Experimental
Seratrodast	The risk or severity of adverse effects can be increased when Etanercept is combined with Seratrodast.	Approved
Sipuleucel-T	The therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Etanercept.	Approved
Sisomicin	Etanercept may decrease the excretion rate of Sisomicin which could result in a higher serum level.	Investigational
Sotalol	Etanercept may decrease the antihypertensive activities of Sotalol.	Approved
SP1049C	Etanercept may decrease the excretion rate of SP1049C which could result in a higher serum level.	Investigational
Sparfloxacin	Etanercept may increase the neuroexcitatory activities of Sparfloxacin.	Approved
Spectinomycin	Etanercept may decrease the excretion rate of Spectinomycin which could result in a higher serum level.	Approved, Vet Approved
Spirapril	The risk or severity of adverse effects can be increased when Spirapril is combined with Etanercept.	Approved
Spironolactone	Etanercept may decrease the antihypertensive activities of Spironolactone.	Approved
SRP 299	The risk or severity of adverse effects can be increased when Etanercept is combined with SRP 299.	Investigational
SRT501	The risk or severity of adverse effects can be increased when Etanercept is combined with SRT501.	Investigational
Streptomycin	Etanercept may decrease the excretion rate of Streptomycin which could result in a higher serum level.	Approved, Vet Approved
Streptozocin	Etanercept may decrease the excretion rate of Streptozocin which could result in a higher serum level.	Approved
Sulfasalazine	Etanercept may increase the nephrotoxic activities of Sulfasalazine.	Approved
Sulindac	The risk or severity of adverse effects can be increased when Etanercept is combined with Sulindac.	Approved
Sulodexide	Etanercept may increase the anticoagulant activities of Sulodexide.	Approved, Investigational
Sulprostone	The therapeutic efficacy of Sulprostone can be decreased when used in combination with Etanercept.	Investigational
Suprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Suprofen.	Approved, Withdrawn
Tacrolimus	The risk or severity of adverse effects can be increased when Tacrolimus is combined with Etanercept.	Approved, Investigational
Tacrolimus	Etanercept may increase the nephrotoxic activities of Tacrolimus.	Approved, Investigational
Tafluprost	The therapeutic efficacy of Tafluprost can be decreased when used in combination with Etanercept.	Approved
Talniflumate	The risk or severity of adverse effects can be increased when Talniflumate is combined with Etanercept.	Approved
Tasosartan	The risk or severity of adverse effects can be increased when Tasosartan is combined with Etanercept.	Approved
Technetium Tc-99m medronate	The risk or severity of adverse effects can be increased when Etanercept is combined with Technetium Tc-99m Medronate.	Approved
Telmisartan	The risk or severity of adverse effects can be increased when Telmisartan is combined with Etanercept.	Approved, Investigational
Temafloxacin	Etanercept may increase the neuroexcitatory activities of Temafloxacin.	Withdrawn
Temocapril	The risk or severity of adverse effects can be increased when Temocapril is combined with Etanercept.	Experimental, Investigational
Tenofovir disoproxil	The risk or severity of adverse effects can be increased when Etanercept is combined with Tenofovir.	Approved, Investigational
Tenoxicam	The risk or severity of adverse effects can be increased when Etanercept is combined with Tenoxicam.	Approved
Teriflunomide	The risk or severity of adverse effects can be increased when Etanercept is combined with Teriflunomide.	Approved
Tiaprofenic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Tiaprofenic acid.	Approved
Tiludronic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Tiludronate.	Approved, Vet Approved
Timolol	Etanercept may decrease the antihypertensive activities of Timolol.	Approved
Tinoridine	The risk or severity of adverse effects can be increased when Etanercept is combined with Tinoridine.	Investigational
Tixocortol	The risk or severity of adverse effects can be increased when Etanercept is combined with Tixocortol.	Approved
Tobramycin	Etanercept may decrease the excretion rate of Tobramycin which could result in a higher serum level.	Approved, Investigational
Tocilizumab	Tocilizumab may increase the immunosuppressive activities of Etanercept.	Approved
Tofacitinib	The risk or severity of adverse effects can be increased when Etanercept is combined with Tofacitinib.	Approved, Investigational
Tolfenamic Acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Tolfenamic Acid.	Approved
Tolmetin	The risk or severity of adverse effects can be increased when Etanercept is combined with Tolmetin.	Approved
Torasemide	Etanercept may decrease the diuretic activities of Torasemide.	Approved
Trandolapril	The risk or severity of adverse effects can be increased when Trandolapril is combined with Etanercept.	Approved
Tranilast	The risk or severity of adverse effects can be increased when Etanercept is combined with Tranilast.	Approved, Investigational
Trastuzumab	Trastuzumab may increase the neutropenic activities of Etanercept.	Approved, Investigational
Travoprost	The therapeutic efficacy of Travoprost can be decreased when used in combination with Etanercept.	Approved
Treprostinil	The risk or severity of adverse effects can be increased when Treprostinil is combined with Etanercept.	Approved, Investigational
Triamcinolone	The risk or severity of adverse effects can be increased when Etanercept is combined with Triamcinolone.	Approved, Vet Approved
Triamterene	Etanercept may decrease the antihypertensive activities of Triamterene.	Approved
Trichlormethiazide	The therapeutic efficacy of Trichlormethiazide can be decreased when used in combination with Etanercept.	Approved, Vet Approved
Trovafloxacin	Etanercept may increase the neuroexcitatory activities of Trovafloxacin.	Approved, Withdrawn
Unoprostone	The therapeutic efficacy of Unoprostone can be decreased when used in combination with Etanercept.	Approved
Valdecoxib	The risk or severity of adverse effects can be increased when Etanercept is combined with Valdecoxib.	Investigational, Withdrawn
Valrubicin	Etanercept may decrease the excretion rate of Valrubicin which could result in a higher serum level.	Approved
Valsartan	The risk or severity of adverse effects can be increased when Valsartan is combined with Etanercept.	Approved, Investigational
Vancomycin	The serum concentration of Vancomycin can be increased when it is combined with Etanercept.	Approved
Vedolizumab	The risk or severity of adverse effects can be increased when Etanercept is combined with Vedolizumab.	Approved
Warfarin	Etanercept may increase the anticoagulant activities of Warfarin.	Approved
Ximelagatran	Etanercept may increase the anticoagulant activities of Ximelagatran.	Approved, Investigational, Withdrawn
Zaltoprofen	The risk or severity of adverse effects can be increased when Etanercept is combined with Zaltoprofen.	Approved
Zileuton	The risk or severity of adverse effects can be increased when Etanercept is combined with Zileuton.	Approved, Investigational, Withdrawn
Zoledronic acid	The risk or severity of adverse effects can be increased when Etanercept is combined with Zoledronic acid.	Approved
Zomepirac	The risk or severity of adverse effects can be increased when Etanercept is combined with Zomepirac.	Withdrawn
Zorubicin	Etanercept may decrease the excretion rate of Zorubicin which could result in a higher serum level.	Experimental

Food Interactions

Not Available

References

Synthesis Reference

Timothy D. Osslund, Christi L. Clogston, Shon Lee Crampton, Randal B. Bass, "Crystals of etanercept and methods of making thereof." U.S. Patent US07276477, issued October 02, 2007.

US07276477

General References

Link [Link]
Link [Link]

External Links

Resource	Link
UniProt	P20333
Genbank	M32315
PharmGKB	PA449515
Drug Product Database	12032
RxList	http://www.rxlist.com/cgi/generic/etanercept.htm
Drugs.com	http://www.drugs.com/cdi/etanercept.html
Wikipedia	Etanercept

ATC Codes

L04AB01 — Etanercept

AHFS Codes

92:00.00

PDB Entries

2DTQ

FDA label

Not Available

MSDS

Not Available

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Completed	Treatment	Inclusion Body Myositis (IBM)	1
1	Active Not Recruiting	Other	Healthy Volunteers	1
1	Completed	Not Available	Healthy Volunteers	1
1	Completed	Basic Science	Healthy Volunteers	2
1	Completed	Health Services Research	Alzheimer's Disease (AD)	1
1	Completed	Treatment	Acute and Chronic Inflammation / Autoimmune Diseases / Disorder of Pleura and Pleural Cavity / Disorder of Synovium / Felty's Syndrome / Rheumatoid Arthritis / Rheumatoid Nodules / Sjogren's Syndrome	1
1	Completed	Treatment	Dermatomyositis	1
1	Completed	Treatment	Healthy Men and Women	1
1	Completed	Treatment	Healthy Volunteers	4
1	Completed	Treatment	Human Immunodeficiency Virus (HIV) Infections	1
1	Completed	Treatment	Psoriasis	1
1	Completed	Treatment	Rheumatoid Arthritis	1
1	Completed	Treatment	Tumors	1
1	Not Yet Recruiting	Prevention	Subarachnoid Hemorrhage, Aneurysmal	1
1	Recruiting	Treatment	Psoriatic plaque	1
1	Recruiting	Treatment	Rheumatoid Arthritis	1
1	Terminated	Treatment	Bone destruction / One to five years postmenopausal / Osteopenia / Rheumatoid Arthritis	1
1	Unknown Status	Not Available	Rheumatoid Arthritis	1
1, 2	Completed	Treatment	Adenocarcinomas / Neoplasms, Pancreatic	1
1, 2	Completed	Treatment	Chronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)	1
1, 2	Completed	Treatment	De Novo Myelodysplastic Syndromes / Previously Treated Myelodysplastic Syndromes / Secondary Myelodysplastic Syndromes	1
1, 2	Completed	Treatment	Diabetes, Diabetes Mellitus Type 1	2
1, 2	Completed	Treatment	Leukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases	1
1, 2	Completed	Treatment	Obliterative Bronchiolitis / Pneumonia / Respiratory Distress Syndrome, Adult	1
1, 2	Completed	Treatment	Psoriasis	1
1, 2	Not Yet Recruiting	Treatment	Autoimmune Diseases / Diabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 1 / Hypoglycemia	1
1, 2	Not Yet Recruiting	Treatment	Diabetes, Diabetes Mellitus Type 1	1
1, 2	Not Yet Recruiting	Treatment	Plaque Psoriasis	1
1, 2	Recruiting	Other	Rheumatoid Arthritis	1
1, 2	Recruiting	Treatment	Diabetes, Diabetes Mellitus Type 1	1
1, 2	Withdrawn	Treatment	Diabetes, Diabetes Mellitus Type 1	1
2	Active Not Recruiting	Other	Rheumatoid Arthritis	1
2	Active Not Recruiting	Prevention	Graft Versus Host Disease (GVHD)	1
2	Active Not Recruiting	Treatment	Accelerated Phase Chronic Myelogenous Leukemia / Blastic Phase Chronic Myelogenous Leukemia / Childhood Acute Lymphoblastic Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission / Childhood Chronic Myelogenous Leukemia / Childhood Myelodysplastic Syndromes / Chronic Phase Chronic Myelogenous Leukemia / De Novo Myelodysplastic Syndromes / Disseminated Neuroblastoma / Juvenile Myelomonocytic Leukemia / Previously Treated Childhood Rhabdomyosarcoma / Previously Treated Myelodysplastic Syndromes / Pulmonary Complications / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Neuroblastoma / Recurrent Wilms Tumor and Other Childhood Kidney Tumors / Recurrent/Refractory Childhood Hodgkin Lymphoma / Relapsing Chronic Myelogenous Leukemia / Secondary Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes	1
2	Active Not Recruiting	Treatment	Diabetes, Diabetes Mellitus Type 1	1
2	Active Not Recruiting	Treatment	Lichen Planus (LP)	1
2	Active Not Recruiting	Treatment	Mucocutaneous Lymph Node Syndrome	1
2	Completed	Treatment	Alzheimer's Disease (AD)	1
2	Completed	Treatment	Arthritis, Juvenile Rheumatoid / Uveitis	1
2	Completed	Treatment	Asthma Bronchial	1
2	Completed	Treatment	Diabetes, Diabetes Mellitus Type 1	2
2	Completed	Treatment	Graft Versus Host Disease (GVHD)	2
2	Completed	Treatment	Graft Versus Host Disease (GVHD) / Immune System Disorders	1
2	Completed	Treatment	Granulomatosis With Polyangiitis / Vasculitis	1
2	Completed	Treatment	Healthy Volunteers / Inflammatory Reaction	1
2	Completed	Treatment	Healthy Volunteers / Rheumatoid Arthritis	1
2	Completed	Treatment	Hidradenitis Suppurativa (HS)	1
2	Completed	Treatment	Histiocytosis, Langerhans-Cell	1
2	Completed	Treatment	Leukemias / Myelodysplastic Syndromes	1
2	Completed	Treatment	Leukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases	1
2	Completed	Treatment	Lung Injury, Acute / Obliterative Bronchiolitis / Respiratory Distress Syndrome, Adult	1
2	Completed	Treatment	Pemphigus Vulgaris (PV)	1
2	Completed	Treatment	Persistent Knee Joint Synovitis	1
2	Completed	Treatment	Psoriasis	1
2	Completed	Treatment	Pulmonary Fibrosis	1
2	Completed	Treatment	Rheumatoid Arthritis	2
2	Completed	Treatment	Sjogren's Syndrome	1
2	Completed	Treatment	Temporomandibular Joint Disorders	1
2	Completed	Treatment	Transplanted Kidney Ischemia Reperfusion Injury	1
2	Completed	Treatment	Vitiligo	1
2	Recruiting	Treatment	Ankylosing Spondylitis (AS)	1
2	Recruiting	Treatment	Diabetes, Diabetes Mellitus Type 1 / Transplant, Kidney	1
2	Recruiting	Treatment	Lupus Erythematosus, Chronic Cutaneous / Lupus Erythematosus, Cutaneous / Lupus Erythematosus, Discoid	1
2	Suspended	Treatment	Primary Systemic Amyloidosis	1
2	Terminated	Treatment	End Stage Renal Disease (ESRD)	1
2	Terminated	Treatment	Leukemias	1
2	Terminated	Treatment	Lichen Planus (LP)	1
2	Terminated	Treatment	Myalgic Encephalomyelitis (ME)	1
2	Terminated	Treatment	Nephritis, Lupus	1
2	Terminated	Treatment	Rheumatoid Arthritis	1
2	Terminated	Treatment	Vesicular Stomatitis	1
2	Unknown Status	Treatment	Ankylosing Spondylitis (AS)	1
2	Unknown Status	Treatment	Discoid Lupus Erythematosus (DLE)	1
2	Unknown Status	Treatment	Moderate to Severe Active Axial Spondyloarthritis	1
2	Unknown Status	Treatment	Spondyloarthritis	1
2, 3	Completed	Treatment	Acute Exacerbation of Chronic Obstructive Pulmonary Disease	1
2, 3	Completed	Treatment	Granulomatosis With Polyangiitis	1
2, 3	Completed	Treatment	Lumbosacral Radiculopathy	1
2, 3	Recruiting	Treatment	Ankylosing Spondylitis (AS) / Arthritis / Bone Diseases / Joint ankylosis / Musculoskeletal Disorders / Spinal Diseases / Spondylarthritis / Spondylarthropathy / Spondylitis	1
2, 3	Terminated	Diagnostic	Bone Cancer / Lung Cancers / Neoplasms Metastasis / Prostate Cancer	1
2, 3	Terminated	Treatment	Dermatomyositis	1
2, 3	Withdrawn	Treatment	Chronic Idiopathic Urticaria	1
3	Active Not Recruiting	Treatment	Diabetes, Diabetes Mellitus Type 1	1
3	Active Not Recruiting	Treatment	Juvenile Idiopahtic Arthritis	1
3	Active Not Recruiting	Treatment	Pediatric Plaque Psoriasis	1
3	Active Not Recruiting	Treatment	Plaque Psoriasis	1
3	Active Not Recruiting	Treatment	Plaque Psoriasis / Psoriasis	1
3	Active Not Recruiting	Treatment	Psoriasis	2
3	Active Not Recruiting	Treatment	Psoriatic Arthritis	1
3	Active Not Recruiting	Treatment	Rheumatoid Arthritis	2
3	Completed	Prevention	Psoriasis / Psoriatic Arthritis	1
3	Completed	Supportive Care	Anorexic / Cachexia / Unspecified Adult Solid Tumor, Protocol Specific	1
3	Completed	Treatment	Active Rheumatoid Arthritis	1
3	Completed	Treatment	Acute Graft Versus Host Disease	1
3	Completed	Treatment	Ankylosing Spondylitis (AS)	6
3	Completed	Treatment	Chronic Plaque Psoriasis	1
3	Completed	Treatment	Diabetes, Diabetes Mellitus Type 1	1
3	Completed	Treatment	Idiopathic Pneumonia Syndrome / Pneumonia	1
3	Completed	Treatment	Inflammatory Reaction / Psoriasis	1
3	Completed	Treatment	Juvenile Idiopathic Arthritis (JIA)	1
3	Completed	Treatment	Moderate to Severe Plaque Psoriasis	1
3	Completed	Treatment	Palmoplantaris Pustulosis	1
3	Completed	Treatment	Plaque Psoriasis	2
3	Completed	Treatment	Polymyalgia Rheumatica	1
3	Completed	Treatment	Psoriasis	11
3	Completed	Treatment	Psoriasis / Psoriatic Arthritis	1
3	Completed	Treatment	Psoriatic Arthritis / Rheumatoid Arthritis	1
3	Completed	Treatment	Prophylaxis of Rheumatic fever / Psoriatic Arthritis / Rheumatoid Arthritis	1
3	Completed	Treatment	Rheumatoid Arthritis	13
3	Not Yet Recruiting	Treatment	Stevens Johnson Syndrome / Toxic Epidermal Necrolyses	1
3	Recruiting	Treatment	Chronic Severe Plaque-type Psoriasis	1
3	Recruiting	Treatment	Diabetes, Diabetes Mellitus Type 1	1
3	Recruiting	Treatment	Juvenile Idiopathic Arthritis (JIA)	1
3	Recruiting	Treatment	Plaque Psoriasis / Psoriasis	1
3	Suspended	Treatment	Rheumatoid Arthritis	1
3	Terminated	Treatment	Arthritis, Juvenile Rheumatoid	1
3	Terminated	Treatment	Rheumatoid Arthritis	1
3	Withdrawn	Treatment	Plaque-Type Psoriasis	1
4	Active Not Recruiting	Treatment	Ankylosing Spondylitis (AS)	1
4	Active Not Recruiting	Treatment	Ankylosing Spondylitis (AS) / Inflammatory Reaction	1
4	Active Not Recruiting	Treatment	Plaque Psoriasis	1
4	Active Not Recruiting	Treatment	Spondyloarthritis	1
4	Completed	Not Available	Ankylosing Spondylitis (AS)	3
4	Completed	Not Available	Arthritis / Rheumatoid	1
4	Completed	Not Available	Inflammatory Reaction / Rheumatoid Arthritis	1
4	Completed	Not Available	Psoriasis	1
4	Completed	Not Available	Psoriatic Arthritis / Rheumatoid Arthritis	1
4	Completed	Not Available	Rheumatoid Arthritis	2
4	Completed	Prevention	Ankylosing Spondylitis (AS) / Recurrences	1
4	Completed	Treatment	Active Rheumatoid Arthritis / Rheumatoid Arthritis	1
4	Completed	Treatment	Ankylosing Spondylitis (AS)	6
4	Completed	Treatment	Ankylosing Spondylitis (AS) / Psoriatic Arthritis / Spondylarthropathy	1
4	Completed	Treatment	Arthritis, Juvenile Rheumatoid / Juvenile Chronic Polyarthritis / Juvenile Idiopathic Arthritis (JIA)	1
4	Completed	Treatment	Cardiovascular Disease, Rheumatoid Arthritis / Rheumatoid Arthritis	1
4	Completed	Treatment	Melanoma / Non-Melanoma Skin Cancer (NMSC) / Psoriasis	1
4	Completed	Treatment	Nail Psoriasis / Plaque Psoriasis	1
4	Completed	Treatment	Plaque Psoriasis	2
4	Completed	Treatment	Plaque Psoriasis / Psoriasis	1
4	Completed	Treatment	Plaque Psoriasis / Rheumatoid Arthritis	1
4	Completed	Treatment	Psoriasis	9
4	Completed	Treatment	Psoriasis Vulgaris	1
4	Completed	Treatment	Psoriasis, Moderate to Severe	1
4	Completed	Treatment	Psoriasis / Psoriatic Arthritis	1
4	Completed	Treatment	Psoriatic Arthritis	3
4	Completed	Treatment	Rheumatoid Arthritis	20
4	Completed	Treatment	Spondylarthropathies, Enthesitis	1
4	Completed	Treatment	Spondyloarthritis, Axial	1
4	Completed	Treatment	Spondyloarthropathies	1
4	Enrolling by Invitation	Basic Science	Rheumatoid Arthritis	1
4	Not Yet Recruiting	Treatment	Ankylosing Spondylitis (AS)	1
4	Not Yet Recruiting	Treatment	Rheumatoid Arthritis	1
4	Recruiting	Basic Science	Rheumatoid Arthritis	1
4	Recruiting	Treatment	Ankylosing Spondylitis (AS)	1
4	Recruiting	Treatment	Pancreatitis, Chronic; Diabetes; Transplant	1
4	Recruiting	Treatment	Psoriasis	1
4	Recruiting	Treatment	Rheumatoid Arthritis	6
4	Terminated	Treatment	Ankylosing Spondylitis (AS)	1
4	Terminated	Treatment	Moderate to Severe Rheumatoid Arthritis	1
4	Terminated	Treatment	Psoriasis	1
4	Terminated	Treatment	Rheumatoid Arthritis	3
4	Terminated	Treatment	Rheumatoid Arthritis / Vascular Inflammation	1
4	Unknown Status	Basic Science	Absolute Number, Density of Immune Infiltrate and Dendritic Cells and Inflammatory Cytokines Expression Pattern / Psoriasis, Moderate to Severe	1
4	Unknown Status	Screening	Ankylosing Spondylitis (AS) / Rheumatoid Arthritis	1
4	Unknown Status	Treatment	Ankylosing Spondylitis (AS) / Hypertensive / Psoriatic Arthritis / Rheumatoid Arthritis	1
4	Unknown Status	Treatment	Arthritis / Rheumatoid Arthritis	1
4	Unknown Status	Treatment	Juvenile Idiopathic Arthritis (JIA)	1
4	Unknown Status	Treatment	Myocardial Infarction (MI)	1
4	Unknown Status	Treatment	Psoriasis	2
4	Unknown Status	Treatment	Rheumatoid Arthritis	2
4	Withdrawn	Not Available	Pediatric Psoriasis	1
4	Withdrawn	Basic Science	Rheumatoid Arthritis	1
4	Withdrawn	Treatment	Plaque Psoriasis	1
4	Withdrawn	Treatment	Rheumatoid Arthritis	1
Not Available	Active Not Recruiting	Not Available	Inflammatory Reaction / Psoriasis	1
Not Available	Active Not Recruiting	Not Available	Psoriasis	1
Not Available	Active Not Recruiting	Treatment	Psoriasis	1
Not Available	Completed	Not Available	Ankylosing Spondylitis (AS)	3
Not Available	Completed	Not Available	Ankylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis	1
Not Available	Completed	Not Available	Arthritis, Juvenile Rheumatoid	1
Not Available	Completed	Not Available	Atherosclerosis / Moderate, refractory Atopic dermatitis / Psoriasis	1
Not Available	Completed	Not Available	Hidradenitis Suppurativa (HS)	1
Not Available	Completed	Not Available	Human Immunodeficiency Virus (HIV) Infections	1
Not Available	Completed	Not Available	Inflammatory Bowel Diseases (IBD) / Psoriasis	1
Not Available	Completed	Not Available	Juvenile Idiopathic Arthritis (JIA)	1
Not Available	Completed	Not Available	Pregnancy	1
Not Available	Completed	Not Available	Psoriasis	3
Not Available	Completed	Not Available	Psoriasis / Psoriatic Arthritis / Skin Diseases, Papulosquamous	2
Not Available	Completed	Not Available	Psoriatic Arthritis	1
Not Available	Completed	Not Available	Rheumatoid Arthritis	12
Not Available	Completed	Not Available	Rhupus Syndrome, Etanercept	1
Not Available	Completed	Not Available	Spondyloarthritis / Ultrasonography	1
Not Available	Completed	Health Services Research	Congenital Hypoplastic Anemia	1
Not Available	Completed	Prevention	Inguinal Hernias / Postoperative pain	1
Not Available	Completed	Treatment	Asthma Bronchial	1
Not Available	Completed	Treatment	Metabolic Syndromes	3
Not Available	Completed	Treatment	Psoriasis	1
Not Available	Completed	Treatment	Rheumatoid Arthritis	1
Not Available	Enrolling by Invitation	Not Available	Psoriasis Arthritis / Rheumatoid Arthritis	1
Not Available	Not Yet Recruiting	Not Available	Rheumatoid Arthritis	1
Not Available	Not Yet Recruiting	Not Available	Rheumatoid Arthritis / Spondyloarthritis, Axial	1
Not Available	Recruiting	Not Available	Ankylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis	1
Not Available	Recruiting	Not Available	Plaque Psoriasis / Psoriatic Arthritis / Rheumatoid Arthritis / Spondyloarthritis, Axial	1
Not Available	Recruiting	Not Available	Psoriasis	1
Not Available	Recruiting	Not Available	Rheumatoid Arthritis	3
Not Available	Recruiting	Screening	Ankylosing Spondylitis (AS)	1
Not Available	Recruiting	Treatment	Osteoarthritis Of Knee	2
Not Available	Terminated	Not Available	Ankylosing Spondylitis (AS) / Rheumatoid Arthritis	1
Not Available	Terminated	Prevention	BMI >30 kg/m2 / Hyperlipidemias / Hypertensive / Metabolic Syndromes / Psoriasis	1
Not Available	Unknown Status	Not Available	Scleritis / Uveitis	1
Not Available	Unknown Status	Treatment	Behcet's Syndrome / Uveal Disease	1
Not Available	Unknown Status	Treatment	Drug hypersensitivity reaction	1
Not Available	Unknown Status	Treatment	Psoriasis	1
Not Available	Withdrawn	Not Available	Rheumatoid Arthritis	1
Not Available	Withdrawn	Treatment	Chronic Regional Pain Syndrome / CRP	1

Pharmacoeconomics

Manufacturers

Amgen Inc. + Wyeth + Takeda

Packagers

Dosage forms

Form	Route	Strength
Injection, powder, for solution	Subcutaneous	10 mg
Injection, powder, for solution	Subcutaneous	25 mg
Injection, powder, for solution	Subcutaneous	50 mg
Injection, solution	Subcutaneous	25 mg
Injection, solution	Subcutaneous	50 mg
Kit
Kit; liquid; powder, for solution	Subcutaneous
Solution	Subcutaneous	25 mg/.5mL
Solution	Subcutaneous	50 mg
Solution	Subcutaneous	50 mg/mL
Solution	Subcutaneous	25 mg

Prices

Unit description	Cost	Unit
Enbrel (1 Box = 1 Kit = Four 50 mg Syringes) 3.92ml Box	2033.14USD	box
Enbrel SureClick (1 Box Contains Four 50 mg Prefilled Autoinjectors)	2033.14USD	box
Enbrel 4 25 mg Kit (1 Box = 1 Kit = Four 25 mg Vials)	1016.57USD	box
Enbrel 50 mg/ml sureclick syr	488.74USD	syringe
Enbrel 25 mg kit	250.37USD	each

DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)
CA2476934	No	2009-06-16	2023-02-27	Canada
CA2123593	No	2000-03-14	2013-09-14	Canada
US7276477	No	2007-10-02	2024-07-29	US
US36755	No	2000-06-27	2012-10-23	US

Properties

State

Liquid

Experimental Properties

Property	Value	Source
melting point (°C)	71 °C (whole mAb)	Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity	-0.529	Not Available
isoelectric point	7.89	Not Available

Taxonomy

Description

Not Available

Kingdom

Organic Compounds

Super Class

Organic Acids

Class

Carboxylic Acids and Derivatives

Sub Class

Amino Acids, Peptides, and Analogues

Direct Parent

Peptides

Alternative Parents

Not Available

Substituents

Not Available

Molecular Framework

Not Available

External Descriptors

Not Available

Targets

Details

1. Tumor necrosis factor

Kind: Protein
Organism: Human
Pharmacological action: yes
Actions: antibody

General Function:: Tumor necrosis factor receptor binding
Specific Function:: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs ...
Gene Name:: TNF
Uniprot ID:: P01375
Uniprot Name:: Tumor necrosis factor
Molecular Weight:: 25644.15 Da

References

Park YC, Burkitt V, Villa AR, Tong L, Wu H: Structural basis for self-association and receptor recognition of human TRAF2. Nature. 1999 Apr 8;398(6727):533-8. [PubMed:10206649 ]
Sandborn WJ, Hanauer SB: Antitumor necrosis factor therapy for inflammatory bowel disease: a review of agents, pharmacology, clinical results, and safety. Inflamm Bowel Dis. 1999 May;5(2):119-33. [PubMed:10338381 ]
Grell M, Zimmermann G, Gottfried E, Chen CM, Grunwald U, Huang DC, Wu Lee YH, Durkop H, Engelmann H, Scheurich P, Wajant H, Strasser A: Induction of cell death by tumour necrosis factor (TNF) receptor 2, CD40 and CD30: a role for TNF-R1 activation by endogenous membrane-anchored TNF. EMBO J. 1999 Jun 1;18(11):3034-43. [PubMed:10357816 ]
Moreland LW: Inhibitors of tumor necrosis factor: new treatment options for rheumatoid arthritis. Cleve Clin J Med. 1999 Jun;66(6):367-74. [PubMed:10375846 ]
Calabrese LH: Rheumatoid arthritis and primary care: the case for early diagnosis and treatment. J Am Osteopath Assoc. 1999 Jun;99(6):313-21. [PubMed:10405518 ]
Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]

Details

2. Tumor necrosis factor receptor superfamily member 1B

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Ubiquitin protein ligase binding
Specific Function:: Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by ant...
Gene Name:: TNFRSF1B
Uniprot ID:: P20333
Uniprot Name:: Tumor necrosis factor receptor superfamily member 1B
Molecular Weight:: 48290.85 Da

References

Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]

Details

3. High affinity immunoglobulin gamma Fc receptor I

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Receptor signaling protein activity
Specific Function:: High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:: FCGR1A
Uniprot ID:: P12314
Uniprot Name:: High affinity immunoglobulin gamma Fc receptor I
Molecular Weight:: 42631.525 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Details

4. Low affinity immunoglobulin gamma Fc region receptor III-A

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Not Available
Specific Function:: Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:: FCGR3A
Uniprot ID:: P08637
Uniprot Name:: Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight:: 29088.895 Da

References

Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]

Details

5. Low affinity immunoglobulin gamma Fc region receptor II-a

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Not Available
Specific Function:: Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:: FCGR2A
Uniprot ID:: P12318
Uniprot Name:: Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight:: 35000.42 Da

References

Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]

Details

6. Low affinity immunoglobulin gamma Fc region receptor II-b

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Not Available
Specific Function:: Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:: FCGR2B
Uniprot ID:: P31994
Uniprot Name:: Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight:: 34043.355 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Details

7. Low affinity immunoglobulin gamma Fc region receptor II-c

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Transmembrane signaling receptor activity
Specific Function:: Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:: FCGR2C
Uniprot ID:: P31995
Uniprot Name:: Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight:: 35577.96 Da

References

Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083 ]
Ranheim EA, Kipps TJ: Tumor necrosis factor-alpha facilitates induction of CD80 (B7-1) and CD54 on human B cells by activated T cells: complex regulation by IL-4, IL-10, and CD40L. Cell Immunol. 1995 Apr 1;161(2):226-35. [PubMed:7535196 ]

Details

8. Lymphotoxin-alpha

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Receptor binding
Specific Function:: Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
Gene Name:: LTA
Uniprot ID:: P01374
Uniprot Name:: Lymphotoxin-alpha
Molecular Weight:: 22296.57 Da

References

Johnson CJ, Reilly KM, Murray KM: Etanercept in juvenile rheumatoid arthritis. Ann Pharmacother. 2001 Apr;35(4):464-71. [PubMed:11302411 ]
Pennica D, Lam VT, Mize NK, Weber RF, Lewis M, Fendly BM, Lipari MT, Goeddel DV: Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation. J Biol Chem. 1992 Oct 15;267(29):21172-8. [PubMed:1328224 ]
Gudbrandsdottir S, Larsen R, Sorensen LK, Nielsen S, Hansen MB, Svenson M, Bendtzen K, Muller K: TNF and LT binding capacities in the plasma of arthritis patients: effect of etanercept treatment in juvenile idiopathic arthritis. Clin Exp Rheumatol. 2004 Jan-Feb;22(1):118-24. [PubMed:15005015 ]
Buch MH, Conaghan PG, Quinn MA, Bingham SJ, Veale D, Emery P: True infliximab resistance in rheumatoid arthritis: a role for lymphotoxin alpha? Ann Rheum Dis. 2004 Oct;63(10):1344-6. Epub 2004 Mar 19. [PubMed:15033655 ]
Kang CP, Lee KW, Yoo DH, Kang C, Bae SC: The influence of a polymorphism at position -857 of the tumour necrosis factor alpha gene on clinical response to etanercept therapy in rheumatoid arthritis. Rheumatology (Oxford). 2005 Apr;44(4):547-52. Epub 2005 Feb 3. [PubMed:15695296 ]

Details

9. Low affinity immunoglobulin gamma Fc region receptor III-B

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Not Available
Specific Function:: Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:: FCGR3B
Uniprot ID:: O75015
Uniprot Name:: Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight:: 26215.64 Da

References

Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083 ]
Ozgocmen S, Godekmerdan A, Ozkurt-Zengin F: Acute-phase response, clinical measures and disease activity in ankylosing spondylitis. Joint Bone Spine. 2007 May;74(3):249-53. Epub 2007 Mar 5. [PubMed:17387033 ]
Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]

Details

10. Complement C1s subcomponent

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Serine-type endopeptidase activity
Specific Function:: C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:: C1S
Uniprot ID:: P09871
Uniprot Name:: Complement C1s subcomponent
Molecular Weight:: 76683.905 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Details

11. Complement C1r subcomponent

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Serine-type peptidase activity
Specific Function:: C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:: C1R
Uniprot ID:: P00736
Uniprot Name:: Complement C1r subcomponent
Molecular Weight:: 80118.04 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Details

12. Complement C1q subcomponent subunit A

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Not Available
Specific Function:: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:: C1QA
Uniprot ID:: P02745
Uniprot Name:: Complement C1q subcomponent subunit A
Molecular Weight:: 26016.47 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Details

13. Complement C1q subcomponent subunit B

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Not Available
Specific Function:: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:: C1QB
Uniprot ID:: P02746
Uniprot Name:: Complement C1q subcomponent subunit B
Molecular Weight:: 26721.62 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Details

14. Complement C1q subcomponent subunit C

Kind: Protein
Organism: Human
Pharmacological action: unknown

General Function:: Not Available
Specific Function:: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:: C1QC
Uniprot ID:: P02747
Uniprot Name:: Complement C1q subcomponent subunit C
Molecular Weight:: 25773.56 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Enzymes

Details

1. Prostaglandin G/H synthase 2

Kind: Protein
Organism: Human
Pharmacological action: unknown
Actions: inhibitor

General Function:: Prostaglandin-endoperoxide synthase activity
Specific Function:: Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and in pathological conditions, such as in cancer. PTGS2 is responsible for production of inflammatory prostaglandins. Up-regulation of PTGS2 is also associated with increased cell adhesion, p...
Gene Name:: PTGS2
Uniprot ID:: P35354
Uniprot Name:: Prostaglandin G/H synthase 2
Molecular Weight:: 68995.625 Da

References

Bawolak MT, Touzin K, Moreau ME, Desormeaux A, Adam A, Marceau F: Cardiovascular expression of inflammatory signaling molecules, the kinin B1 receptor and COX2, in the rabbit: effects of LPS, anti-inflammatory and anti-hypertensive drugs. Regul Pept. 2008 Feb 7;146(1-3):157-68. Epub 2007 Sep 14. [PubMed:17931716 ]
Genovese T, Mazzon E, Crisafulli C, Di Paola R, Muia C, Bramanti P, Cuzzocrea S: Immunomodulatory effects of etanercept in an experimental model of spinal cord injury. J Pharmacol Exp Ther. 2006 Mar;316(3):1006-16. Epub 2005 Nov 22. [PubMed:16303916 ]

Drug created on June 13, 2005 07:24 / Updated on March 10, 2017 13:08