Identification

Name
Etanercept
Accession Number
DB00005  (BTD00052, BIOD00052)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Fusion proteins
Description

Dimeric fusion protein consisting of the extracellular ligand-binding portion of the human 75 kilodalton (p75) tumor necrosis factor receptor (TNFR) linked to the Fc portion of human IgG1. The Fc component of etanercept contains the CH2 domain, the CH3 domain and hinge region, but not the CH1 domain of IgG1. Etanercept is produced by recombinant DNA technology in a Chinese hamster ovary (CHO) mammalian cell expression system. It consists of 934 amino acids

Protein structure
Db00005
Protein chemical formula
C2224H3475N621O698S36
Protein average weight
51234.9 Da
Sequences
> Etanercept Sequence
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST
YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK
CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS
TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • CD120b
  • p75
  • p80 TNF-alpha receptor
  • TNF-R2
  • Tumor necrosis factor receptor 2
  • Tumor necrosis factor receptor superfamily member 1B precursor
  • Tumor necrosis factor receptor type II
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
BrenzysSolution50 mgSubcutaneousSamsung Bioepis Co., Ltd.2016-09-13Not applicableCanada
BrenzysSolution50 mgSubcutaneousSamsung Bioepis Co., Ltd.2016-09-23Not applicableCanada
EnbrelSolution50 mgSubcutaneousImmunex Corporation2005-12-21Not applicableCanada
EnbrelInjection, solution25 mgSubcutaneousPfizer2000-02-03Not applicableEu
EnbrelInjection, powder, for solution50 mgSubcutaneousPfizer2000-02-03Not applicableEu
EnbrelInjection, solution50 mgSubcutaneousPfizer2000-02-03Not applicableEu
EnbrelInjection, powder, for solution50 mgSubcutaneousPfizer2000-02-03Not applicableEu
EnbrelKitImmunex Corporation2003-01-02Not applicableUs
EnbrelInjection, powder, for solution25 mgSubcutaneousPfizer2000-02-03Not applicableEu
EnbrelInjection, solution50 mgSubcutaneousPfizer2000-02-03Not applicableEu
Unapproved/Other Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
EnbrelSolution50 mg/mLSubcutaneousImmunex Corporation2017-10-20Not applicableUs
EnbrelSolution50 mg/mLSubcutaneousImmunex Corporation2017-09-29Not applicableUs
International/Other Brands
Enbrel Sureclick
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
EnbrelEtanercept (25 mg) + Water (1 ml)Kit; Liquid; Powder, for solutionSubcutaneousImmunex Corporation2001-03-14Not applicableCanada
Categories
UNII
OP401G7OJC
CAS number
185243-69-0

Pharmacology

Indication

Etanercept is indicated for the treatment of moderately to severely active rheumatoid arthritis in adults and chronic moderate to severe plaque psoriasis in adults. It is also used to manage signs and symptoms of polyarticular idiopathic arthritis in those aged 4 to 17 after insufficient response to one or more disease-modifying anti-rheumatic drugs. Etanercept is also used to improve psoriatic arthritis and ankylosing spondylitis.

Structured Indications
Pharmacodynamics

Etanercept binds specifically to tumor necrosis factor (TNF) and thereby modulates biological processes that are induced or regulated by TNF. Such processes or molecules affected include the level of adhesion molecules expressed, as well as serum levels of cytokines and matrix metalloproteinase-3, also known as stromelysin. In animal models, etanarcept has been demonstrated to affect inflammation, such as in murine collagen-induced arthritis.

Mechanism of action

There are two distinct receptors for TNF (TNFRs), a 55 kilodalton protein (p55) and a 75 kilodalton protein (p75). The biological activity of TNF is dependent upon binding to either cell surface receptor (p75 or p55). Etanercept is a dimeric soluble form of the p75 TNF receptor that can bind to two TNF molecules, thereby effectively removing them from circulation.

TNF is a naturally occurring cytokine that is involved in normal inflammatory and immune responses. Increased levels of TNF are found in tissues and fluids of those with rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis (AS), and plaque psoriasis.

TargetActionsOrganism
ATumor necrosis factor
antibody
Human
UTumor necrosis factor receptor superfamily member 1BNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
ULymphotoxin-alphaNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
Absorption

Bioavailability following sub-Q administration is approximately 60%. Peak plasma concentrations achieved within 69 hours.

Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

102 +/- 30 hrs in individuals with rheumatoid arthritis and 68 hours in healthy adults

Clearance
  • 160 +/- 80 mL/hr [RA patients]
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
16-BromoepiandrosteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with 16-Bromoepiandrosterone.Investigational
19-norandrostenedioneThe risk or severity of adverse effects can be increased when Etanercept is combined with 19-norandrostenedione.Experimental, Illicit
5-androstenedioneThe risk or severity of adverse effects can be increased when Etanercept is combined with 5-androstenedione.Experimental, Illicit
AbataceptThe risk or severity of infection can be increased when Etanercept is combined with Abatacept.Approved
AbciximabEtanercept may increase the anticoagulant activities of Abciximab.Approved
AcebutololEtanercept may decrease the antihypertensive activities of Acebutolol.Approved
AceclofenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Aceclofenac.Approved, Investigational
AcemetacinThe risk or severity of adverse effects can be increased when Etanercept is combined with Acemetacin.Approved
AcenocoumarolEtanercept may increase the anticoagulant activities of Acenocoumarol.Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Acetylsalicylic acid.Approved, Vet Approved
AclarubicinEtanercept may decrease the excretion rate of Aclarubicin which could result in a higher serum level.Investigational
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Etanercept.Approved
AdapaleneThe risk or severity of adverse effects can be increased when Etanercept is combined with Adapalene.Approved
AlclofenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Alclofenac.Approved, Withdrawn
AlclometasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Alclometasone.Approved
AldosteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Aldosterone.Experimental, Investigational
Alendronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Alendronic acid.Approved
AliskirenEtanercept may decrease the antihypertensive activities of Aliskiren.Approved, Investigational
AlminoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Alminoprofen.Experimental
AlprenololEtanercept may decrease the antihypertensive activities of Alprenolol.Approved, Withdrawn
AlprostadilThe therapeutic efficacy of Alprostadil can be decreased when used in combination with Etanercept.Approved, Investigational
AmcinonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Amcinonide.Approved
AmikacinEtanercept may decrease the excretion rate of Amikacin which could result in a higher serum level.Approved, Vet Approved
AmilorideEtanercept may decrease the antihypertensive activities of Amiloride.Approved
AmrubicinEtanercept may decrease the excretion rate of Amrubicin which could result in a higher serum level.Approved, Investigational
AnakinraThe risk or severity of adverse effects can be increased when Etanercept is combined with Anakinra.Approved
AncrodEtanercept may increase the anticoagulant activities of Ancrod.Investigational
AndrographolideThe risk or severity of adverse effects can be increased when Etanercept is combined with Andrographolide.Investigational
AndrostenedioneThe risk or severity of adverse effects can be increased when Etanercept is combined with Androstenedione.Experimental, Illicit
AnecortaveThe risk or severity of adverse effects can be increased when Etanercept is combined with Anecortave.Investigational
anecortave acetateThe risk or severity of adverse effects can be increased when Etanercept is combined with anecortave acetate.Investigational
AnisodamineThe risk or severity of adverse effects can be increased when Etanercept is combined with Anisodamine.Investigational
annamycinEtanercept may decrease the excretion rate of annamycin which could result in a higher serum level.Investigational
AntipyrineThe risk or severity of adverse effects can be increased when Etanercept is combined with Antipyrine.Approved
Antithrombin III humanEtanercept may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanEtanercept may increase the anticoagulant activities of Apixaban.Approved
ApocyninThe risk or severity of adverse effects can be increased when Etanercept is combined with Apocynin.Investigational
ApramycinEtanercept may decrease the excretion rate of Apramycin which could result in a higher serum level.Experimental, Vet Approved
ApremilastThe risk or severity of adverse effects can be increased when Etanercept is combined with Apremilast.Approved, Investigational
ArbekacinEtanercept may decrease the excretion rate of Arbekacin which could result in a higher serum level.Approved, Investigational
ArdeparinEtanercept may increase the anticoagulant activities of Ardeparin.Approved, Investigational, Withdrawn
ArgatrobanEtanercept may increase the anticoagulant activities of Argatroban.Approved, Investigational
ArotinololEtanercept may decrease the antihypertensive activities of Arotinolol.Approved, Investigational
AtamestaneThe risk or severity of adverse effects can be increased when Etanercept is combined with Atamestane.Investigational
AtenololEtanercept may decrease the antihypertensive activities of Atenolol.Approved
AzapropazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Azapropazone.Withdrawn
AzelastineThe risk or severity of adverse effects can be increased when Etanercept is combined with Azelastine.Approved
Azilsartan medoxomilThe risk or severity of adverse effects can be increased when Azilsartan medoxomil is combined with Etanercept.Approved
BalsalazideEtanercept may increase the nephrotoxic activities of Balsalazide.Approved, Investigational
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Etanercept.Investigational
BecaplerminEtanercept may increase the anticoagulant activities of Becaplermin.Approved, Investigational
Beclomethasone dipropionateThe risk or severity of adverse effects can be increased when Etanercept is combined with Beclomethasone dipropionate.Approved, Investigational
BefunololEtanercept may decrease the antihypertensive activities of Befunolol.Experimental
BekanamycinEtanercept may decrease the excretion rate of Bekanamycin which could result in a higher serum level.Experimental
BelimumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Belimumab.Approved
BenazeprilThe risk or severity of adverse effects can be increased when Benazepril is combined with Etanercept.Approved, Investigational
BendazacThe risk or severity of adverse effects can be increased when Etanercept is combined with Bendazac.Experimental
BendroflumethiazideThe therapeutic efficacy of Bendroflumethiazide can be decreased when used in combination with Etanercept.Approved
BenorilateThe risk or severity of adverse effects can be increased when Etanercept is combined with Benorilate.Experimental
BenoxaprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Benoxaprofen.Withdrawn
BenzydamineThe risk or severity of adverse effects can be increased when Etanercept is combined with Benzydamine.Approved
BeraprostThe therapeutic efficacy of Beraprost can be decreased when used in combination with Etanercept.Investigational
BetamethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Betamethasone.Approved, Vet Approved
BetaxololEtanercept may decrease the antihypertensive activities of Betaxolol.Approved
BevantololEtanercept may decrease the antihypertensive activities of Bevantolol.Approved
BevoniumThe risk or severity of adverse effects can be increased when Etanercept is combined with Bevonium.Experimental
BimatoprostThe therapeutic efficacy of Bimatoprost can be decreased when used in combination with Etanercept.Approved, Investigational
BisoprololEtanercept may decrease the antihypertensive activities of Bisoprolol.Approved
BivalirudinEtanercept may increase the anticoagulant activities of Bivalirudin.Approved, Investigational
BopindololEtanercept may decrease the antihypertensive activities of Bopindolol.Approved
BromfenacThe risk or severity of adverse effects can be increased when Bromfenac is combined with Etanercept.Approved
BucillamineThe risk or severity of adverse effects can be increased when Etanercept is combined with Bucillamine.Investigational
BucindololEtanercept may decrease the antihypertensive activities of Bucindolol.Investigational
BudesonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Budesonide.Approved
BufexamacThe risk or severity of adverse effects can be increased when Etanercept is combined with Bufexamac.Experimental
BufuralolEtanercept may decrease the antihypertensive activities of Bufuralol.Experimental, Investigational
BumadizoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Bumadizone.Experimental
BumetanideEtanercept may decrease the diuretic activities of Bumetanide.Approved
BupranololEtanercept may decrease the antihypertensive activities of Bupranolol.Approved
CanakinumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Canakinumab.Approved, Investigational
CandesartanThe risk or severity of adverse effects can be increased when Candesartan is combined with Etanercept.Experimental
Candesartan cilexetilThe risk or severity of adverse effects can be increased when Candesartan cilexetil is combined with Etanercept.Approved
CandoxatrilThe risk or severity of adverse effects can be increased when Candoxatril is combined with Etanercept.Experimental
CaptoprilThe risk or severity of adverse effects can be increased when Captopril is combined with Etanercept.Approved
Carbaspirin calciumThe risk or severity of adverse effects can be increased when Etanercept is combined with Carbaspirin calcium.Experimental, Investigational
Carboprost TromethamineThe therapeutic efficacy of Carboprost Tromethamine can be decreased when used in combination with Etanercept.Approved
CarprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Carprofen.Approved, Vet Approved, Withdrawn
CarteololEtanercept may decrease the antihypertensive activities of Carteolol.Approved
CarvedilolEtanercept may decrease the antihypertensive activities of Carvedilol.Approved, Investigational
CastanospermineThe risk or severity of adverse effects can be increased when Etanercept is combined with Castanospermine.Experimental
CelecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Celecoxib.Approved, Investigational
CeliprololEtanercept may decrease the antihypertensive activities of Celiprolol.Approved, Investigational
Certolizumab pegolEtanercept may increase the immunosuppressive activities of Certolizumab pegol.Approved
CertoparinEtanercept may increase the anticoagulant activities of Certoparin.Approved, Investigational
ChloroquineThe risk or severity of adverse effects can be increased when Etanercept is combined with Chloroquine.Approved, Vet Approved
ChlorothiazideThe therapeutic efficacy of Chlorothiazide can be decreased when used in combination with Etanercept.Approved, Vet Approved
ChlorthalidoneThe therapeutic efficacy of Chlorthalidone can be decreased when used in combination with Etanercept.Approved
CholestyramineCholestyramine can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
Choline magnesium trisalicylateThe risk or severity of adverse effects can be increased when Etanercept is combined with Choline magnesium trisalicylate.Approved
CiclesonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Ciclesonide.Approved, Investigational
CilazaprilThe risk or severity of adverse effects can be increased when Cilazapril is combined with Etanercept.Approved
CinoxacinEtanercept may increase the neuroexcitatory activities of Cinoxacin.Approved, Investigational, Withdrawn
Citric AcidEtanercept may increase the anticoagulant activities of Citric Acid.Approved, Nutraceutical, Vet Approved
ClobetasolThe risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasol.Investigational
Clobetasol propionateThe risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasol propionate.Approved
ClobetasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasone.Approved
ClocortoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Clocortolone.Approved
Clodronic AcidThe risk or severity of adverse effects can be increased when Etanercept is combined with Clodronic Acid.Approved, Investigational, Vet Approved
ClonixinThe risk or severity of adverse effects can be increased when Etanercept is combined with Clonixin.Approved
CloprostenolThe therapeutic efficacy of Cloprostenol can be decreased when used in combination with Etanercept.Vet Approved
CloranololEtanercept may decrease the antihypertensive activities of Cloranolol.Experimental
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Etanercept.Approved
ColesevelamColesevelam can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
ColestipolColestipol can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
Cortexolone 17α-propionateThe risk or severity of adverse effects can be increased when Etanercept is combined with Cortexolone 17α-propionate.Investigational
CorticosteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Corticosterone.Experimental
Cortisone acetateThe risk or severity of adverse effects can be increased when Etanercept is combined with Cortisone acetate.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Etanercept.Approved
CurcuminThe risk or severity of adverse effects can be increased when Etanercept is combined with Curcumin.Investigational
CyclopenthiazideThe therapeutic efficacy of Cyclopenthiazide can be decreased when used in combination with Etanercept.Experimental
CyclophosphamideThe risk or severity of adverse effects can be increased when Etanercept is combined with Cyclophosphamide.Approved, Investigational
CyclosporineEtanercept may increase the nephrotoxic activities of Cyclosporine.Approved, Investigational, Vet Approved
D-LimoneneThe risk or severity of adverse effects can be increased when Etanercept is combined with D-Limonene.Investigational
Dabigatran etexilateEtanercept may increase the anticoagulant activities of Dabigatran etexilate.Approved
DalteparinEtanercept may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidEtanercept may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DarexabanEtanercept may increase the anticoagulant activities of Darexaban.Investigational
DaunorubicinEtanercept may decrease the excretion rate of Daunorubicin which could result in a higher serum level.Approved
DeferasiroxThe risk or severity of adverse effects can be increased when Etanercept is combined with Deferasirox.Approved, Investigational
DeflazacortThe risk or severity of adverse effects can be increased when Etanercept is combined with Deflazacort.Approved
DelaprilThe risk or severity of adverse effects can be increased when Delapril is combined with Etanercept.Experimental
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Etanercept.Approved
DesirudinEtanercept may increase the anticoagulant activities of Desirudin.Approved
DesmopressinThe risk or severity of adverse effects can be increased when Etanercept is combined with Desmopressin.Approved
DesonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Desonide.Approved, Investigational
DesoximetasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Desoximetasone.Approved
Desoxycorticosterone acetateThe risk or severity of adverse effects can be increased when Etanercept is combined with Desoxycorticosterone acetate.Approved
Desoxycorticosterone PivalateThe risk or severity of adverse effects can be increased when Etanercept is combined with Desoxycorticosterone Pivalate.Experimental, Vet Approved
DexamethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Dexamethasone.Approved, Investigational, Vet Approved
Dexamethasone isonicotinateThe risk or severity of adverse effects can be increased when Etanercept is combined with Dexamethasone isonicotinate.Vet Approved
DexketoprofenThe risk or severity of adverse effects can be increased when Dexketoprofen is combined with Etanercept.Approved, Investigational
DextranEtanercept may increase the anticoagulant activities of Dextran.Approved, Vet Approved
Dextran 40Etanercept may increase the anticoagulant activities of Dextran 40.Approved
Dextran 70Etanercept may increase the anticoagulant activities of Dextran 70.Approved
Dextran 75Etanercept may increase the anticoagulant activities of Dextran 75.Approved
DibekacinEtanercept may decrease the excretion rate of Dibekacin which could result in a higher serum level.Experimental
DiclofenacThe risk or severity of adverse effects can be increased when Diclofenac is combined with Etanercept.Approved, Vet Approved
DicoumarolEtanercept may increase the anticoagulant activities of Dicoumarol.Approved
DifenpiramideThe risk or severity of adverse effects can be increased when Etanercept is combined with Difenpiramide.Experimental
DiflorasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Diflorasone.Approved
DiflunisalThe risk or severity of adverse effects can be increased when Etanercept is combined with Diflunisal.Approved
DifluocortoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Difluocortolone.Approved, Investigational
DifluprednateThe risk or severity of adverse effects can be increased when Etanercept is combined with Difluprednate.Approved
DigoxinThe serum concentration of Digoxin can be increased when it is combined with Etanercept.Approved
DihydrostreptomycinEtanercept may decrease the excretion rate of Dihydrostreptomycin which could result in a higher serum level.Investigational, Vet Approved
DinoprostThe therapeutic efficacy of Dinoprost can be decreased when used in combination with Etanercept.Investigational
Dinoprost TromethamineThe therapeutic efficacy of Dinoprost Tromethamine can be decreased when used in combination with Etanercept.Approved, Vet Approved
DinoprostoneThe therapeutic efficacy of Dinoprostone can be decreased when used in combination with Etanercept.Approved
DoxorubicinEtanercept may decrease the excretion rate of Doxorubicin which could result in a higher serum level.Approved, Investigational
DrospirenoneEtanercept may increase the hyperkalemic activities of Drospirenone.Approved
DroxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Droxicam.Approved
DuvelisibThe risk or severity of adverse effects can be increased when Etanercept is combined with Duvelisib.Investigational
E-6201The risk or severity of adverse effects can be increased when Etanercept is combined with E-6201.Investigational
Edetic AcidEtanercept may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanEtanercept may increase the anticoagulant activities of Edoxaban.Approved
EnalaprilThe risk or severity of adverse effects can be increased when Enalapril is combined with Etanercept.Approved, Vet Approved
EnalaprilatThe risk or severity of adverse effects can be increased when Enalaprilat is combined with Etanercept.Approved
EnoxacinEtanercept may increase the neuroexcitatory activities of Enoxacin.Approved, Investigational
EnoxaparinEtanercept may increase the anticoagulant activities of Enoxaparin.Approved
EnprostilThe therapeutic efficacy of Enprostil can be decreased when used in combination with Etanercept.Experimental
EpanololEtanercept may decrease the antihypertensive activities of Epanolol.Experimental
EpirizoleThe risk or severity of adverse effects can be increased when Etanercept is combined with Epirizole.Approved
EpirubicinEtanercept may decrease the excretion rate of Epirubicin which could result in a higher serum level.Approved
EplerenoneEtanercept may decrease the antihypertensive activities of Eplerenone.Approved
EpoprostenolThe therapeutic efficacy of Epoprostenol can be decreased when used in combination with Etanercept.Approved
EprosartanThe risk or severity of adverse effects can be increased when Eprosartan is combined with Etanercept.Approved
EquileninThe risk or severity of adverse effects can be increased when Etanercept is combined with Equilenin.Experimental
EquilinThe risk or severity of adverse effects can be increased when Etanercept is combined with Equilin.Approved
EsmololEtanercept may decrease the antihypertensive activities of Esmolol.Approved
EstroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Estrone.Approved
Estrone sulfateThe risk or severity of adverse effects can be increased when Etanercept is combined with Estrone sulfate.Approved
Etacrynic acidEtanercept may decrease the diuretic activities of Etacrynic acid.Approved
EthenzamideThe risk or severity of adverse effects can be increased when Etanercept is combined with Ethenzamide.Experimental
Ethyl biscoumacetateEtanercept may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
Etidronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Etidronic acid.Approved
EtodolacThe risk or severity of adverse effects can be increased when Etanercept is combined with Etodolac.Approved, Investigational, Vet Approved
EtofenamateThe risk or severity of adverse effects can be increased when Etanercept is combined with Etofenamate.Approved, Investigational
EtoricoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Etoricoxib.Approved, Investigational
Evening primrose oilThe risk or severity of adverse effects can be increased when Etanercept is combined with Evening primrose oil.Approved, Investigational
exisulindThe risk or severity of adverse effects can be increased when Etanercept is combined with exisulind.Investigational
FelbinacThe risk or severity of adverse effects can be increased when Etanercept is combined with Felbinac.Experimental
FenbufenThe risk or severity of adverse effects can be increased when Etanercept is combined with Fenbufen.Approved
FenoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Fenoprofen.Approved
FenprostaleneThe therapeutic efficacy of Fenprostalene can be decreased when used in combination with Etanercept.Vet Approved
FentiazacThe risk or severity of adverse effects can be increased when Etanercept is combined with Fentiazac.Experimental
FeprazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Feprazone.Experimental
Ferulic acidEtanercept may increase the anticoagulant activities of Ferulic acid.Experimental
FimasartanThe risk or severity of adverse effects can be increased when Fimasartan is combined with Etanercept.Approved, Investigational
FingolimodEtanercept may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
FleroxacinEtanercept may increase the neuroexcitatory activities of Fleroxacin.Approved
FloctafenineThe risk or severity of adverse effects can be increased when Floctafenine is combined with Etanercept.Approved, Withdrawn
fluasteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with fluasterone.Investigational
FludrocortisoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fludrocortisone.Approved
FluindioneEtanercept may increase the anticoagulant activities of Fluindione.Investigational
FlumequineEtanercept may increase the neuroexcitatory activities of Flumequine.Withdrawn
FlumethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Flumethasone.Approved, Vet Approved
FlunisolideThe risk or severity of adverse effects can be increased when Etanercept is combined with Flunisolide.Approved, Investigational
FlunixinThe risk or severity of adverse effects can be increased when Etanercept is combined with Flunixin.Vet Approved
FlunoxaprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Flunoxaprofen.Experimental
Fluocinolone AcetonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluocinolone Acetonide.Approved, Investigational, Vet Approved
FluocinonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluocinonide.Approved, Investigational
FluocortoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluocortolone.Approved, Withdrawn
FluorometholoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluorometholone.Approved
FluprednideneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluprednidene.Approved, Withdrawn
FluprednisoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluprednisolone.Approved
FluprostenolThe therapeutic efficacy of Fluprostenol can be decreased when used in combination with Etanercept.Vet Approved
FlurandrenolideThe risk or severity of adverse effects can be increased when Etanercept is combined with Flurandrenolide.Approved
FlurbiprofenThe risk or severity of adverse effects can be increased when Flurbiprofen is combined with Etanercept.Approved, Investigational
Fluticasone furoateThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluticasone furoate.Approved
Fluticasone propionateThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluticasone propionate.Approved
Folic AcidThe therapeutic efficacy of Folic Acid can be decreased when used in combination with Etanercept.Approved, Nutraceutical, Vet Approved
FondaparinuxEtanercept may increase the anticoagulant activities of Fondaparinux.Investigational
Fondaparinux sodiumEtanercept may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
ForasartanThe risk or severity of adverse effects can be increased when Forasartan is combined with Etanercept.Experimental
FormestaneThe risk or severity of adverse effects can be increased when Etanercept is combined with Formestane.Approved, Investigational, Withdrawn
FosinoprilThe risk or severity of adverse effects can be increased when Fosinopril is combined with Etanercept.Approved
FramycetinEtanercept may decrease the excretion rate of Framycetin which could result in a higher serum level.Approved
FurosemideEtanercept may decrease the diuretic activities of Furosemide.Approved, Vet Approved
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Etanercept.Investigational
GabexateEtanercept may increase the anticoagulant activities of Gabexate.Investigational
GarenoxacinEtanercept may increase the neuroexcitatory activities of Garenoxacin.Investigational
GatifloxacinEtanercept may increase the neuroexcitatory activities of Gatifloxacin.Approved, Investigational
GemeprostThe therapeutic efficacy of Gemeprost can be decreased when used in combination with Etanercept.Approved, Withdrawn
GemifloxacinEtanercept may increase the neuroexcitatory activities of Gemifloxacin.Approved, Investigational
GeneticinEtanercept may decrease the excretion rate of Geneticin which could result in a higher serum level.Experimental
GentamicinEtanercept may decrease the excretion rate of Gentamicin which could result in a higher serum level.Approved, Vet Approved
GENTAMICIN C1AEtanercept may decrease the excretion rate of GENTAMICIN C1A which could result in a higher serum level.Experimental
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Etanercept.Investigational
GolimumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Golimumab.Approved
GPX-150Etanercept may decrease the excretion rate of GPX-150 which could result in a higher serum level.Investigational
GrepafloxacinEtanercept may increase the neuroexcitatory activities of Grepafloxacin.Investigational, Withdrawn
GuacetisalThe risk or severity of adverse effects can be increased when Etanercept is combined with Guacetisal.Experimental
HalcinonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Halcinonide.Approved, Investigational, Withdrawn
HaloperidolThe risk or severity of adverse effects can be increased when Etanercept is combined with Haloperidol.Approved
HE3286The risk or severity of adverse effects can be increased when Etanercept is combined with HE3286.Investigational
HeparinEtanercept may increase the anticoagulant activities of Heparin.Approved, Investigational
Hepatitis A VaccineThe therapeutic efficacy of Hepatitis A Vaccine can be decreased when used in combination with Etanercept.Approved
Hepatitis B Vaccine (Recombinant)The therapeutic efficacy of Hepatitis B Vaccine (Recombinant) can be decreased when used in combination with Etanercept.Approved, Withdrawn
HigenamineThe risk or severity of adverse effects can be increased when Etanercept is combined with Higenamine.Investigational
HydralazineEtanercept may decrease the antihypertensive activities of Hydralazine.Approved
HydrochlorothiazideThe therapeutic efficacy of Hydrochlorothiazide can be decreased when used in combination with Etanercept.Approved, Vet Approved
HydrocortisoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Hydroflumethiazide can be decreased when used in combination with Etanercept.Approved, Investigational
Hygromycin BEtanercept may decrease the excretion rate of Hygromycin B which could result in a higher serum level.Vet Approved
IbandronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibandronate.Approved, Investigational
IbuprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibuprofen.Approved
IbuproxamThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibuproxam.Withdrawn
IcatibantThe risk or severity of adverse effects can be increased when Etanercept is combined with Icatibant.Approved
IdarubicinEtanercept may decrease the excretion rate of Idarubicin which could result in a higher serum level.Approved
IdraparinuxEtanercept may increase the anticoagulant activities of Idraparinux.Investigational
IloprostThe therapeutic efficacy of Iloprost can be decreased when used in combination with Etanercept.Approved, Investigational
ImidaprilThe risk or severity of adverse effects can be increased when Imidapril is combined with Etanercept.Investigational
Imidazole salicylateThe risk or severity of adverse effects can be increased when Etanercept is combined with Imidazole salicylate.Experimental
IndapamideThe therapeutic efficacy of Indapamide can be decreased when used in combination with Etanercept.Approved
IndenololEtanercept may decrease the antihypertensive activities of Indenolol.Withdrawn
IndobufenThe risk or severity of adverse effects can be increased when Etanercept is combined with Indobufen.Investigational
IndomethacinThe risk or severity of adverse effects can be increased when Etanercept is combined with Indomethacin.Approved, Investigational
IndoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Indoprofen.Withdrawn
InfliximabEtanercept may increase the immunosuppressive activities of Infliximab.Approved
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Etanercept.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Etanercept.Investigational
INNO-206Etanercept may decrease the excretion rate of INNO-206 which could result in a higher serum level.Investigational
IrbesartanThe risk or severity of adverse effects can be increased when Irbesartan is combined with Etanercept.Approved, Investigational
IsepamicinEtanercept may decrease the excretion rate of Isepamicin which could result in a higher serum level.Experimental
IsoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Isoxicam.Withdrawn
IstaroximeThe risk or severity of adverse effects can be increased when Etanercept is combined with Istaroxime.Investigational
KanamycinEtanercept may decrease the excretion rate of Kanamycin which could result in a higher serum level.Approved, Investigational, Vet Approved
KebuzoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Kebuzone.Experimental
KetoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Ketoprofen.Approved, Vet Approved
KetorolacThe risk or severity of adverse effects can be increased when Ketorolac is combined with Etanercept.Approved
LabetalolEtanercept may decrease the antihypertensive activities of Labetalol.Approved
LandiololEtanercept may decrease the antihypertensive activities of Landiolol.Investigational
LatanoprostThe therapeutic efficacy of Latanoprost can be decreased when used in combination with Etanercept.Approved, Investigational
Latanoprostene BunodThe therapeutic efficacy of Latanoprostene Bunod can be decreased when used in combination with Etanercept.Approved, Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Etanercept is combined with Leflunomide.Approved, Investigational
LepirudinEtanercept may increase the anticoagulant activities of Lepirudin.Approved
LetaxabanEtanercept may increase the anticoagulant activities of Letaxaban.Investigational
LevobunololEtanercept may decrease the antihypertensive activities of Levobunolol.Approved
LevofloxacinEtanercept may increase the neuroexcitatory activities of Levofloxacin.Approved, Investigational
LimaprostThe therapeutic efficacy of Limaprost can be decreased when used in combination with Etanercept.Approved, Investigational
LisinoprilThe risk or severity of adverse effects can be increased when Lisinopril is combined with Etanercept.Approved, Investigational
LisofyllineThe risk or severity of adverse effects can be increased when Etanercept is combined with Lisofylline.Investigational
LithiumThe serum concentration of Lithium can be increased when it is combined with Etanercept.Approved
LonazolacThe risk or severity of adverse effects can be increased when Etanercept is combined with Lonazolac.Experimental
LornoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Lornoxicam.Approved, Investigational
LosartanThe risk or severity of adverse effects can be increased when Losartan is combined with Etanercept.Approved
LoteprednolThe risk or severity of adverse effects can be increased when Etanercept is combined with Loteprednol.Approved
LoxoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Loxoprofen.Approved, Investigational
LubiprostoneThe therapeutic efficacy of Lubiprostone can be decreased when used in combination with Etanercept.Approved, Investigational
LumiracoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Lumiracoxib.Approved, Investigational
LuprostiolThe therapeutic efficacy of Luprostiol can be decreased when used in combination with Etanercept.Vet Approved
Magnesium salicylateThe risk or severity of adverse effects can be increased when Etanercept is combined with Magnesium salicylate.Approved
MasoprocolThe risk or severity of adverse effects can be increased when Etanercept is combined with Masoprocol.Approved, Investigational
ME-609The risk or severity of adverse effects can be increased when Etanercept is combined with ME-609.Investigational
Meclofenamic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Meclofenamic acid.Approved, Vet Approved
MedrysoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Medrysone.Approved
Mefenamic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Mefenamic acid.Approved
MelagatranEtanercept may increase the anticoagulant activities of Melagatran.Experimental
MelengestrolThe risk or severity of adverse effects can be increased when Etanercept is combined with Melengestrol.Vet Approved
MeloxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Meloxicam.Approved, Vet Approved
MepindololEtanercept may decrease the antihypertensive activities of Mepindolol.Experimental
MesalazineEtanercept may increase the nephrotoxic activities of Mesalazine.Approved
MetamizoleThe risk or severity of adverse effects can be increased when Etanercept is combined with Metamizole.Investigational, Withdrawn
MethotrexateThe serum concentration of Methotrexate can be increased when it is combined with Etanercept.Approved
MethyclothiazideThe therapeutic efficacy of Methyclothiazide can be decreased when used in combination with Etanercept.Approved
MethylprednisoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Methylprednisolone.Approved, Vet Approved
MetipranololEtanercept may decrease the antihypertensive activities of Metipranolol.Approved
MetolazoneThe therapeutic efficacy of Metolazone can be decreased when used in combination with Etanercept.Approved
MetoprololEtanercept may decrease the antihypertensive activities of Metoprolol.Approved, Investigational
MetrizamideEtanercept may decrease the excretion rate of Metrizamide which could result in a higher serum level.Approved
MicronomicinEtanercept may decrease the excretion rate of Micronomicin which could result in a higher serum level.Experimental
MisoprostolThe therapeutic efficacy of Misoprostol can be decreased when used in combination with Etanercept.Approved
MizoribineThe risk or severity of adverse effects can be increased when Etanercept is combined with Mizoribine.Investigational
MoexiprilThe risk or severity of adverse effects can be increased when Moexipril is combined with Etanercept.Approved
MofebutazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Mofebutazone.Experimental
MometasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Mometasone.Approved, Vet Approved
MorniflumateThe risk or severity of adverse effects can be increased when Morniflumate is combined with Etanercept.Approved
Mycophenolate mofetilThe risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolate mofetil.Approved, Investigational
Mycophenolic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolic acid.Approved
NabumetoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Nabumetone.Approved
NadololEtanercept may decrease the antihypertensive activities of Nadolol.Approved
NadroparinEtanercept may increase the anticoagulant activities of Nadroparin.Approved
NafamostatEtanercept may increase the anticoagulant activities of Nafamostat.Approved, Investigational
NaftifineThe risk or severity of adverse effects can be increased when Etanercept is combined with Naftifine.Approved
Nalidixic AcidEtanercept may increase the neuroexcitatory activities of Nalidixic Acid.Approved, Investigational
NaproxenThe risk or severity of adverse effects can be increased when Etanercept is combined with Naproxen.Approved, Vet Approved
NatalizumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Natalizumab.Approved, Investigational
NCX 1022The risk or severity of adverse effects can be increased when Etanercept is combined with NCX 1022.Investigational
NeamineEtanercept may decrease the excretion rate of Neamine which could result in a higher serum level.Experimental
NebivololEtanercept may decrease the antihypertensive activities of Nebivolol.Approved, Investigational
NemonoxacinEtanercept may increase the neuroexcitatory activities of Nemonoxacin.Investigational
NeomycinEtanercept may decrease the excretion rate of Neomycin which could result in a higher serum level.Approved, Vet Approved
NepafenacThe risk or severity of adverse effects can be increased when Nepafenac is combined with Etanercept.Approved
NetilmicinEtanercept may decrease the excretion rate of Netilmicin which could result in a higher serum level.Approved, Investigational
NifenazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Nifenazone.Experimental
Niflumic AcidThe risk or severity of adverse effects can be increased when Etanercept is combined with Niflumic Acid.Approved
NimesulideThe risk or severity of adverse effects can be increased when Etanercept is combined with Nimesulide.Approved, Investigational, Withdrawn
NitroaspirinThe risk or severity of adverse effects can be increased when Etanercept is combined with Nitroaspirin.Investigational
NorfloxacinEtanercept may increase the neuroexcitatory activities of Norfloxacin.Approved
Oleoyl-estroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Oleoyl-estrone.Investigational
OlmesartanThe risk or severity of adverse effects can be increased when Olmesartan is combined with Etanercept.Approved, Investigational
OlopatadineThe risk or severity of adverse effects can be increased when Etanercept is combined with Olopatadine.Approved
OlsalazineEtanercept may increase the nephrotoxic activities of Olsalazine.Approved
Omacetaxine mepesuccinateThe risk or severity of adverse effects can be increased when Etanercept is combined with Omacetaxine mepesuccinate.Approved
OmapatrilatThe risk or severity of adverse effects can be increased when Omapatrilat is combined with Etanercept.Investigational
OrgoteinThe risk or severity of adverse effects can be increased when Etanercept is combined with Orgotein.Vet Approved
OtamixabanEtanercept may increase the anticoagulant activities of Otamixaban.Investigational
OxaprozinThe risk or severity of adverse effects can be increased when Etanercept is combined with Oxaprozin.Approved
Oxolinic acidEtanercept may increase the neuroexcitatory activities of Oxolinic acid.Experimental
OxprenololEtanercept may decrease the antihypertensive activities of Oxprenolol.Approved
OxyphenbutazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Oxyphenbutazone.Approved, Withdrawn
PamidronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Pamidronate.Approved
ParamethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Paramethasone.Approved
ParecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Parecoxib.Approved
ParomomycinEtanercept may decrease the excretion rate of Paromomycin which could result in a higher serum level.Approved, Investigational
ParthenolideThe risk or severity of adverse effects can be increased when Etanercept is combined with Parthenolide.Investigational
PazufloxacinEtanercept may increase the neuroexcitatory activities of Pazufloxacin.Investigational
PefloxacinEtanercept may increase the neuroexcitatory activities of Pefloxacin.Approved
PenbutololEtanercept may decrease the antihypertensive activities of Penbutolol.Approved, Investigational
Pentaerythritol TetranitrateEtanercept may increase the anticoagulant activities of Pentaerythritol Tetranitrate.Approved
Pentosan PolysulfateEtanercept may increase the anticoagulant activities of Pentosan Polysulfate.Approved
PerindoprilThe risk or severity of adverse effects can be increased when Perindopril is combined with Etanercept.Approved
PhenindioneEtanercept may increase the anticoagulant activities of Phenindione.Approved, Investigational
PhenprocoumonEtanercept may increase the anticoagulant activities of Phenprocoumon.Approved, Investigational
PhenylbutazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Phenylbutazone.Approved, Vet Approved
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Etanercept.Approved, Investigational
PindololEtanercept may decrease the antihypertensive activities of Pindolol.Approved
Pipemidic acidEtanercept may increase the neuroexcitatory activities of Pipemidic acid.Experimental
PirarubicinEtanercept may decrease the excretion rate of Pirarubicin which could result in a higher serum level.Investigational
PiretanideEtanercept may decrease the diuretic activities of Piretanide.Experimental
PirfenidoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Pirfenidone.Approved, Investigational
Piromidic acidEtanercept may increase the neuroexcitatory activities of Piromidic acid.Experimental
PiroxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Piroxicam.Approved, Investigational
PirprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Pirprofen.Experimental
Platelet Activating FactorEtanercept may decrease the antihypertensive activities of Platelet Activating Factor.Experimental
PlazomicinEtanercept may decrease the excretion rate of Plazomicin which could result in a higher serum level.Investigational
PlicamycinEtanercept may decrease the excretion rate of Plicamycin which could result in a higher serum level.Approved, Investigational, Withdrawn
PolythiazideThe therapeutic efficacy of Polythiazide can be decreased when used in combination with Etanercept.Approved
PractololEtanercept may decrease the antihypertensive activities of Practolol.Approved
PralatrexateThe serum concentration of Pralatrexate can be increased when it is combined with Etanercept.Approved
PranoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Pranoprofen.Experimental, Investigational
PrasteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Prasterone.Approved, Nutraceutical
Prasterone sulfateThe risk or severity of adverse effects can be increased when Etanercept is combined with Prasterone sulfate.Investigational
PrednicarbateThe risk or severity of adverse effects can be increased when Etanercept is combined with Prednicarbate.Approved
PrednisoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Prednisolone.Approved, Vet Approved
PrednisoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Prednisone.Approved, Vet Approved
PregnenoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Pregnenolone.Experimental, Investigational
ProbenecidThe serum concentration of Etanercept can be increased when it is combined with Probenecid.Approved
ProglumetacinThe risk or severity of adverse effects can be increased when Etanercept is combined with Proglumetacin.Experimental
PropacetamolThe risk or severity of adverse effects can be increased when Etanercept is combined with Propacetamol.Approved, Investigational
PropranololEtanercept may decrease the antihypertensive activities of Propranolol.Approved, Investigational
PropyphenazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Propyphenazone.Experimental
ProquazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Proquazone.Experimental
Prostaglandin B2The therapeutic efficacy of Prostaglandin B2 can be decreased when used in combination with Etanercept.Experimental
Prostaglandin G2The therapeutic efficacy of Prostaglandin G2 can be decreased when used in combination with Etanercept.Experimental
ProstaleneThe therapeutic efficacy of Prostalene can be decreased when used in combination with Etanercept.Vet Approved
Protein CEtanercept may increase the anticoagulant activities of Protein C.Approved
Protein S humanEtanercept may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeEtanercept may increase the anticoagulant activities of Protocatechualdehyde.Approved
PrulifloxacinEtanercept may increase the neuroexcitatory activities of Prulifloxacin.Investigational
PTC299The risk or severity of adverse effects can be increased when Etanercept is combined with PTC299.Investigational
PuromycinEtanercept may decrease the excretion rate of Puromycin which could result in a higher serum level.Experimental
QuinaprilThe risk or severity of adverse effects can be increased when Quinapril is combined with Etanercept.Approved, Investigational
QuinethazoneThe therapeutic efficacy of Quinethazone can be decreased when used in combination with Etanercept.Approved
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Etanercept.Approved
RamiprilThe risk or severity of adverse effects can be increased when Ramipril is combined with Etanercept.Approved
RescinnamineThe risk or severity of adverse effects can be increased when Rescinnamine is combined with Etanercept.Approved
ResveratrolThe risk or severity of adverse effects can be increased when Etanercept is combined with Resveratrol.Approved, Experimental, Investigational
ReviparinEtanercept may increase the anticoagulant activities of Reviparin.Approved, Investigational
RibostamycinEtanercept may decrease the excretion rate of Ribostamycin which could result in a higher serum level.Approved, Investigational
RilonaceptThe risk or severity of adverse effects can be increased when Etanercept is combined with Rilonacept.Approved
RimexoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Rimexolone.Approved
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Etanercept.Investigational
RisedronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Risedronate.Approved, Investigational
RituximabThe risk or severity of adverse effects can be increased when Etanercept is combined with Rituximab.Approved
RivaroxabanEtanercept may increase the anticoagulant activities of Rivaroxaban.Approved
RofecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Rofecoxib.Investigational, Withdrawn
RoflumilastRoflumilast may increase the immunosuppressive activities of Etanercept.Approved
RosoxacinEtanercept may increase the neuroexcitatory activities of Rosoxacin.Approved, Investigational
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Etanercept.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Etanercept.Approved
RufloxacinEtanercept may increase the neuroexcitatory activities of Rufloxacin.Experimental
SabarubicinEtanercept may decrease the excretion rate of Sabarubicin which could result in a higher serum level.Investigational
SacubitrilThe risk or severity of adverse effects can be increased when Sacubitril is combined with Etanercept.Approved
SalicylamideThe risk or severity of adverse effects can be increased when Etanercept is combined with Salicylamide.Approved
Salicylic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Salicylic acid.Approved, Vet Approved
Salmonella typhi ty21a live antigenThe therapeutic efficacy of Salmonella typhi ty21a live antigen can be decreased when used in combination with Etanercept.Approved
SalsalateThe risk or severity of adverse effects can be increased when Etanercept is combined with Salsalate.Approved
SaprisartanThe risk or severity of adverse effects can be increased when Saprisartan is combined with Etanercept.Experimental
SaralasinThe risk or severity of adverse effects can be increased when Saralasin is combined with Etanercept.Investigational
SemapimodThe risk or severity of adverse effects can be increased when Etanercept is combined with Semapimod.Investigational
SeratrodastThe risk or severity of adverse effects can be increased when Etanercept is combined with Seratrodast.Approved
SerrapeptaseThe risk or severity of adverse effects can be increased when Etanercept is combined with Serrapeptase.Investigational
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Etanercept.Approved
SisomicinEtanercept may decrease the excretion rate of Sisomicin which could result in a higher serum level.Investigational
SitafloxacinEtanercept may increase the neuroexcitatory activities of Sitafloxacin.Experimental, Investigational
Sodium phosphateSodium phosphate may increase the nephrotoxic activities of Etanercept.Approved
SotalolEtanercept may decrease the antihypertensive activities of Sotalol.Approved
SP1049CEtanercept may decrease the excretion rate of SP1049C which could result in a higher serum level.Investigational
SparfloxacinEtanercept may increase the neuroexcitatory activities of Sparfloxacin.Approved, Investigational
SpectinomycinEtanercept may decrease the excretion rate of Spectinomycin which could result in a higher serum level.Approved, Investigational, Vet Approved
SpiraprilThe risk or severity of adverse effects can be increased when Spirapril is combined with Etanercept.Approved
SpironolactoneEtanercept may decrease the antihypertensive activities of Spironolactone.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Etanercept.Investigational
SRT501The risk or severity of adverse effects can be increased when Etanercept is combined with SRT501.Investigational
StreptomycinEtanercept may decrease the excretion rate of Streptomycin which could result in a higher serum level.Approved, Vet Approved
StreptozocinEtanercept may decrease the excretion rate of Streptozocin which could result in a higher serum level.Approved
SulfasalazineThe risk or severity of adverse effects can be increased when Etanercept is combined with Sulfasalazine.Approved
SulindacThe risk or severity of adverse effects can be increased when Etanercept is combined with Sulindac.Approved
SulodexideEtanercept may increase the anticoagulant activities of Sulodexide.Approved, Investigational
SulprostoneThe therapeutic efficacy of Sulprostone can be decreased when used in combination with Etanercept.Investigational
SuprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Suprofen.Approved, Withdrawn
SuxibuzoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Suxibuzone.Experimental
TacrolimusEtanercept may increase the nephrotoxic activities of Tacrolimus.Approved, Investigational
TafluprostThe therapeutic efficacy of Tafluprost can be decreased when used in combination with Etanercept.Approved
TalinololEtanercept may decrease the antihypertensive activities of Talinolol.Investigational
TalniflumateThe risk or severity of adverse effects can be increased when Talniflumate is combined with Etanercept.Approved
TarenflurbilThe risk or severity of adverse effects can be increased when Etanercept is combined with Tarenflurbil.Investigational
TasosartanThe risk or severity of adverse effects can be increased when Tasosartan is combined with Etanercept.Approved
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Etanercept.Investigational
Technetium Tc-99m etidronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Technetium Tc-99m etidronate.Approved
Technetium Tc-99m medronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Technetium Tc-99m medronate.Approved
TelmisartanThe risk or severity of adverse effects can be increased when Telmisartan is combined with Etanercept.Approved, Investigational
TemafloxacinEtanercept may increase the neuroexcitatory activities of Temafloxacin.Withdrawn
TemocaprilThe risk or severity of adverse effects can be increased when Temocapril is combined with Etanercept.Experimental, Investigational
TenidapThe risk or severity of adverse effects can be increased when Etanercept is combined with Tenidap.Experimental
Tenofovir disoproxilThe risk or severity of adverse effects can be increased when Etanercept is combined with Tenofovir disoproxil.Approved, Investigational
TenoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Tenoxicam.Approved
TepoxalinThe risk or severity of adverse effects can be increased when Etanercept is combined with Tepoxalin.Vet Approved
TeriflunomideThe risk or severity of adverse effects can be increased when Etanercept is combined with Teriflunomide.Approved
TertatololEtanercept may decrease the antihypertensive activities of Tertatolol.Experimental
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Etanercept.Investigational
Tiaprofenic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Tiaprofenic acid.Approved
Tiludronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Tiludronic acid.Approved, Investigational, Vet Approved
TimololEtanercept may decrease the antihypertensive activities of Timolol.Approved
TinoridineThe risk or severity of adverse effects can be increased when Etanercept is combined with Tinoridine.Investigational
TixocortolThe risk or severity of adverse effects can be increased when Etanercept is combined with Tixocortol.Approved
TobramycinEtanercept may decrease the excretion rate of Tobramycin which could result in a higher serum level.Approved, Investigational
TocilizumabTocilizumab may increase the immunosuppressive activities of Etanercept.Approved
TofacitinibThe risk or severity of adverse effects can be increased when Etanercept is combined with Tofacitinib.Approved, Investigational
Tolfenamic AcidThe risk or severity of adverse effects can be increased when Etanercept is combined with Tolfenamic Acid.Approved
TolmetinThe risk or severity of adverse effects can be increased when Etanercept is combined with Tolmetin.Approved
TorasemideEtanercept may decrease the diuretic activities of Torasemide.Approved
TrandolaprilThe risk or severity of adverse effects can be increased when Trandolapril is combined with Etanercept.Approved
TranilastThe risk or severity of adverse effects can be increased when Etanercept is combined with Tranilast.Approved, Investigational
TrastuzumabTrastuzumab may increase the neutropenic activities of Etanercept.Approved, Investigational
TravoprostThe therapeutic efficacy of Travoprost can be decreased when used in combination with Etanercept.Approved
TreprostinilThe risk or severity of adverse effects can be increased when Treprostinil is combined with Etanercept.Approved, Investigational
TriamcinoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Triamcinolone.Approved, Vet Approved
TriamtereneEtanercept may decrease the antihypertensive activities of Triamterene.Approved
TribenosideThe risk or severity of adverse effects can be increased when Etanercept is combined with Tribenoside.Experimental
TrichlormethiazideThe therapeutic efficacy of Trichlormethiazide can be decreased when used in combination with Etanercept.Approved, Vet Approved
TriptolideThe risk or severity of adverse effects can be increased when Etanercept is combined with Triptolide.Investigational
TrovafloxacinEtanercept may increase the neuroexcitatory activities of Trovafloxacin.Approved, Investigational, Withdrawn
TroxerutinEtanercept may increase the anticoagulant activities of Troxerutin.Investigational
UlobetasolThe risk or severity of adverse effects can be increased when Etanercept is combined with Ulobetasol.Approved
UnoprostoneThe therapeutic efficacy of Unoprostone can be decreased when used in combination with Etanercept.Approved
ValdecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Valdecoxib.Investigational, Withdrawn
ValrubicinEtanercept may decrease the excretion rate of Valrubicin which could result in a higher serum level.Approved
ValsartanThe risk or severity of adverse effects can be increased when Valsartan is combined with Etanercept.Approved, Investigational
VancomycinThe serum concentration of Vancomycin can be increased when it is combined with Etanercept.Approved
VedolizumabThe risk or severity of infection can be increased when Etanercept is combined with Vedolizumab.Approved
WarfarinEtanercept may increase the anticoagulant activities of Warfarin.Approved
XimelagatranEtanercept may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Etanercept.Approved
ZaltoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Zaltoprofen.Approved, Investigational
ZileutonThe risk or severity of adverse effects can be increased when Etanercept is combined with Zileuton.Approved, Investigational, Withdrawn
ZofenoprilThe risk or severity of adverse effects can be increased when Zofenopril is combined with Etanercept.Experimental
Zoledronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Zoledronic acid.Approved
ZomepiracThe risk or severity of adverse effects can be increased when Etanercept is combined with Zomepirac.Withdrawn
Zoptarelin doxorubicinEtanercept may decrease the excretion rate of Zoptarelin doxorubicin which could result in a higher serum level.Investigational
ZorubicinEtanercept may decrease the excretion rate of Zorubicin which could result in a higher serum level.Experimental
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Etanercept.Approved
Food Interactions
Not Available

References

Synthesis Reference

Timothy D. Osslund, Christi L. Clogston, Shon Lee Crampton, Randal B. Bass, "Crystals of etanercept and methods of making thereof." U.S. Patent US07276477, issued October 02, 2007.

US07276477
General References
  1. Link [Link]
  2. Link [Link]
External Links
UniProt
P20333
Genbank
M32315
KEGG Drug
D00742
KEGG Compound
C07897
PubChem Substance
46506732
ChEMBL
CHEMBL1201572
Therapeutic Targets Database
DNC000605
PharmGKB
PA449515
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Etanercept
ATC Codes
L04AB01 — Etanercept
AHFS Codes
  • 92:36.00 — Disease-modifying Antirheumatic Agents

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedTreatmentInclusion Body Myositis (IBM)1
1CompletedNot AvailableHealthy Volunteers1
1CompletedBasic ScienceBioequivalence / Phase 11
1CompletedBasic ScienceHealthy Volunteers2
1CompletedHealth Services ResearchAlzheimer's Disease (AD)1
1CompletedOtherHealthy Volunteers1
1CompletedTreatmentAcute and Chronic Inflammation / Autoimmune Diseases / Disorder of Pleura and Pleural Cavity / Disorder of Synovium / Felty's Syndrome / Rheumatoid Arthritis / Rheumatoid Nodules / Sjögren's Syndrome1
1CompletedTreatmentDermatomyositis1
1CompletedTreatmentHealthy Men and Women1
1CompletedTreatmentHealthy Volunteers4
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
1CompletedTreatmentPsoriasis1
1CompletedTreatmentRheumatoid Arthritis1
1CompletedTreatmentTumors1
1Not Yet RecruitingPreventionSubarachnoid Hemorrhage, Aneurysmal1
1RecruitingTreatmentPsoriatic plaque1
1RecruitingTreatmentRheumatoid Arthritis1
1TerminatedTreatmentBone destruction / One to five years postmenopausal / Osteopenia / Rheumatoid Arthritis1
1Unknown StatusNot AvailableRheumatoid Arthritis1
1, 2CompletedTreatmentAdenocarcinomas / Neoplasms, Pancreatic1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)1
1, 2CompletedTreatmentDe Novo Myelodysplastic Syndromes / Previously Treated Myelodysplastic Syndromes / Secondary Myelodysplastic Syndromes1
1, 2CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
1, 2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1, 2CompletedTreatmentObliterative Bronchiolitis / Pneumonia / Respiratory Distress Syndrome, Adult1
1, 2CompletedTreatmentPsoriasis1
1, 2Not Yet RecruitingTreatmentAutoimmune Diseases / Diabetes Mellitus (DM) / Diabetes, Diabetes Mellitus Type 1 / Hypoglycemia1
1, 2Not Yet RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
1, 2Not Yet RecruitingTreatmentPlaque Psoriasis1
1, 2RecruitingOtherRheumatoid Arthritis1
1, 2RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
1, 2WithdrawnTreatmentDiabetes, Diabetes Mellitus Type 11
2Active Not RecruitingPreventionGraft Versus Host Disease (GVHD)1
2Active Not RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
2Active Not RecruitingTreatmentLichen Planus (LP)1
2Active Not RecruitingTreatmentLupus Erythematosus, Chronic Cutaneous / Lupus Erythematosus, Cutaneous / Lupus Erythematosus, Discoid1
2Active Not RecruitingTreatmentMucocutaneous Lymph Node Syndrome1
2CompletedOtherRheumatoid Arthritis1
2CompletedTreatmentAccelerated Phase Chronic Myelogenous Leukemia / Blastic Phase Chronic Myelogenous Leukemia / Childhood Acute Lymphoblastic Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission / Childhood Chronic Myelogenous Leukemia / Childhood Myelodysplastic Syndromes / Chronic Phase Chronic Myelogenous Leukemia / De Novo Myelodysplastic Syndromes / Disseminated Neuroblastoma / Juvenile Myelomonocytic Leukemia / Previously Treated Childhood Rhabdomyosarcoma / Previously Treated Myelodysplastic Syndromes / Pulmonary Complications / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Rhabdomyosarcoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Neuroblastoma / Recurrent Wilms Tumor and Other Childhood Kidney Tumors / Recurrent/Refractory Childhood Hodgkin Lymphoma / Relapsing Chronic Myelogenous Leukemia / Secondary Acute Myeloid Leukemia / Secondary Myelodysplastic Syndromes1
2CompletedTreatmentAlzheimer's Disease (AD)1
2CompletedTreatmentArthritis, Juvenile Rheumatoid / Uveitis1
2CompletedTreatmentAsthma Bronchial1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
2CompletedTreatmentGraft Versus Host Disease (GVHD)2
2CompletedTreatmentGraft Versus Host Disease (GVHD) / Immune System Disorders1
2CompletedTreatmentGranulomatosis With Polyangiitis / Vasculitis1
2CompletedTreatmentHealthy Volunteers / Inflammatory Reaction1
2CompletedTreatmentHealthy Volunteers / Rheumatoid Arthritis1
2CompletedTreatmentHidradenitis Suppurativa (HS)1
2CompletedTreatmentHistiocytosis, Langerhans-Cell1
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
2CompletedTreatmentLeukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2CompletedTreatmentLung Injury, Acute / Obliterative Bronchiolitis / Respiratory Distress Syndrome, Adult1
2CompletedTreatmentPemphigus Vulgaris (PV)1
2CompletedTreatmentPersistent Knee Joint Synovitis1
2CompletedTreatmentPsoriasis1
2CompletedTreatmentPulmonary Fibrosis1
2CompletedTreatmentRheumatoid Arthritis2
2CompletedTreatmentSjögren's Syndrome1
2CompletedTreatmentTemporomandibular Joint Disorders1
2CompletedTreatmentTransplanted Kidney Ischemia Reperfusion Injury1
2CompletedTreatmentVitiligo1
2RecruitingTreatmentAnkylosing Spondylitis (AS)1
2RecruitingTreatmentDiabetes, Diabetes Mellitus Type 1 / Transplant, Kidney1
2SuspendedTreatmentPrimary Systemic Amyloidosis1
2TerminatedTreatmentEnd Stage Renal Disease (ESRD)1
2TerminatedTreatmentLeukemias1
2TerminatedTreatmentLichen Planus (LP)1
2TerminatedTreatmentMyalgic Encephalomyelitis (ME)1
2TerminatedTreatmentNephritis, Lupus1
2TerminatedTreatmentRheumatoid Arthritis1
2TerminatedTreatmentVesicular Stomatitis1
2Unknown StatusTreatmentAnkylosing Spondylitis (AS)1
2Unknown StatusTreatmentDiscoid Lupus Erythematosus (DLE)1
2Unknown StatusTreatmentModerate to Severe Active Axial Spondyloarthritis1
2Unknown StatusTreatmentSpondyloarthritis1
2, 3CompletedTreatmentAcute Exacerbation of Chronic Obstructive Pulmonary Disease1
2, 3CompletedTreatmentGranulomatosis With Polyangiitis1
2, 3CompletedTreatmentLumbosacral Radiculopathy1
2, 3CompletedTreatmentMetabolic Syndromes1
2, 3RecruitingTreatmentAnkylosing Spondylitis (AS) / Arthritis / Bone Diseases / Joint ankylosis / Musculoskeletal Disorders / Spinal Diseases / Spondylarthritis / Spondylarthropathy / Spondylitis1
2, 3TerminatedDiagnosticBone Cancer / Lung Cancers / Neoplasms Metastasis / Prostate Cancer1
2, 3TerminatedTreatmentDermatomyositis1
2, 3WithdrawnTreatmentChronic Idiopathic Urticaria1
3Active Not RecruitingTreatmentJuvenile Idiopahtic Arthritis1
3Active Not RecruitingTreatmentPlaque Psoriasis1
3Active Not RecruitingTreatmentPlaque Psoriasis / Psoriasis1
3Active Not RecruitingTreatmentPsoriasis2
3Active Not RecruitingTreatmentPsoriatic Arthritis1
3Active Not RecruitingTreatmentRheumatoid Arthritis2
3CompletedPreventionPsoriasis / Psoriatic Arthritis1
3CompletedSupportive CareAnorexic / Cachexia / Unspecified Adult Solid Tumor, Protocol Specific1
3CompletedTreatmentActive Rheumatoid Arthritis1
3CompletedTreatmentAcute Graft Versus Host Disease1
3CompletedTreatmentAnkylosing Spondylitis (AS)6
3CompletedTreatmentChronic Plaque Psoriasis1
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
3CompletedTreatmentIdiopathic Pneumonia Syndrome / Pneumonia1
3CompletedTreatmentInflammatory Reaction / Psoriasis1
3CompletedTreatmentJuvenile Idiopathic Arthritis (JIA)1
3CompletedTreatmentModerate to Severe Plaque Psoriasis1
3CompletedTreatmentPalmoplantaris Pustulosis1
3CompletedTreatmentPediatric Plaque Psoriasis1
3CompletedTreatmentPlaque Psoriasis2
3CompletedTreatmentPolymyalgia Rheumatica1
3CompletedTreatmentPsoriasis11
3CompletedTreatmentPsoriasis / Psoriatic Arthritis1
3CompletedTreatmentPsoriatic Arthritis / Rheumatoid Arthritis1
3CompletedTreatmentProphylaxis of Rheumatic fever / Psoriatic Arthritis / Rheumatoid Arthritis1
3CompletedTreatmentRheumatoid Arthritis14
3Not Yet RecruitingTreatmentStevens Johnson Syndrome / Toxic Epidermal Necrolyses1
3RecruitingTreatmentChronic Severe Plaque-type Psoriasis1
3RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
3RecruitingTreatmentJuvenile Idiopathic Arthritis (JIA)1
3RecruitingTreatmentPlaque Psoriasis / Psoriasis1
3SuspendedTreatmentRheumatoid Arthritis1
3TerminatedTreatmentArthritis, Juvenile Rheumatoid1
3TerminatedTreatmentRheumatoid Arthritis1
3WithdrawnTreatmentPlaque-Type Psoriasis1
4Active Not RecruitingTreatmentAnkylosing Spondylitis (AS)1
4Active Not RecruitingTreatmentAnkylosing Spondylitis (AS) / Inflammatory Reaction1
4Active Not RecruitingTreatmentPlaque Psoriasis1
4Active Not RecruitingTreatmentSpondyloarthritis1
4CompletedNot AvailableAnkylosing Spondylitis (AS)3
4CompletedNot AvailableArthritis / Rheumatoid1
4CompletedNot AvailableInflammatory Reaction / Rheumatoid Arthritis1
4CompletedNot AvailablePsoriasis1
4CompletedNot AvailablePsoriatic Arthritis / Rheumatoid Arthritis1
4CompletedNot AvailableRheumatoid Arthritis2
4CompletedPreventionAnkylosing Spondylitis (AS) / Recurrences1
4CompletedTreatmentActive Rheumatoid Arthritis / Rheumatoid Arthritis1
4CompletedTreatmentAnkylosing Spondylitis (AS)6
4CompletedTreatmentAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Spondylarthropathy1
4CompletedTreatmentArthritis, Juvenile Rheumatoid / Juvenile Chronic Polyarthritis / Juvenile Idiopathic Arthritis (JIA)1
4CompletedTreatmentCardiovascular Disease, Rheumatoid Arthritis / Rheumatoid Arthritis1
4CompletedTreatmentMelanoma / Non-Melanoma Skin Cancer (NMSC) / Psoriasis1
4CompletedTreatmentNail Psoriasis / Plaque Psoriasis1
4CompletedTreatmentPlaque Psoriasis2
4CompletedTreatmentPlaque Psoriasis / Psoriasis1
4CompletedTreatmentPlaque Psoriasis / Rheumatoid Arthritis1
4CompletedTreatmentPsoriasis10
4CompletedTreatmentPsoriasis Vulgaris1
4CompletedTreatmentPsoriasis, Moderate to Severe1
4CompletedTreatmentPsoriasis / Psoriatic Arthritis1
4CompletedTreatmentPsoriatic Arthritis3
4CompletedTreatmentRheumatoid Arthritis20
4CompletedTreatmentSpondylarthropathies, Enthesitis1
4CompletedTreatmentSpondyloarthritis, Axial1
4CompletedTreatmentSpondyloarthropathies1
4Enrolling by InvitationBasic ScienceRheumatoid Arthritis1
4Not Yet RecruitingTreatmentAnkylosing Spondylitis (AS)1
4Not Yet RecruitingTreatmentRheumatoid Arthritis1
4RecruitingBasic ScienceRheumatoid Arthritis1
4RecruitingTreatmentAnkylosing Spondylitis (AS)1
4RecruitingTreatmentPancreatitis, Chronic; Diabetes; Transplant1
4RecruitingTreatmentRheumatoid Arthritis6
4TerminatedTreatmentAnkylosing Spondylitis (AS)1
4TerminatedTreatmentModerate to Severe Rheumatoid Arthritis1
4TerminatedTreatmentPsoriasis1
4TerminatedTreatmentRheumatoid Arthritis3
4TerminatedTreatmentRheumatoid Arthritis / Vascular Inflammation1
4Unknown StatusBasic ScienceAbsolute Number, Density of Immune Infiltrate and Dendritic Cells and Inflammatory Cytokines Expression Pattern / Psoriasis, Moderate to Severe1
4Unknown StatusScreeningAnkylosing Spondylitis (AS) / Rheumatoid Arthritis1
4Unknown StatusTreatmentAnkylosing Spondylitis (AS) / Hypertensive / Psoriatic Arthritis / Rheumatoid Arthritis1
4Unknown StatusTreatmentArthritis / Rheumatoid Arthritis1
4Unknown StatusTreatmentJuvenile Idiopathic Arthritis (JIA)1
4Unknown StatusTreatmentMyocardial Infarction (MI)1
4Unknown StatusTreatmentPsoriasis2
4Unknown StatusTreatmentRheumatoid Arthritis2
4WithdrawnNot AvailablePediatric Psoriasis1
4WithdrawnBasic ScienceRheumatoid Arthritis1
4WithdrawnTreatmentPlaque Psoriasis1
4WithdrawnTreatmentRheumatoid Arthritis1
Not AvailableActive Not RecruitingNot AvailablePsoriasis1
Not AvailableActive Not RecruitingTreatmentPsoriasis1
Not AvailableCompletedNot AvailableAnkylosing Spondylitis (AS)3
Not AvailableCompletedNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableCompletedNot AvailableArthritis, Juvenile Rheumatoid1
Not AvailableCompletedNot AvailableAtherosclerosis / Atopic Dermatitis (AD) / Psoriasis1
Not AvailableCompletedNot AvailableHidradenitis Suppurativa (HS)1
Not AvailableCompletedNot AvailableHuman Immunodeficiency Virus (HIV) Infections1
Not AvailableCompletedNot AvailableInflammatory Bowel Diseases (IBD) / Psoriasis1
Not AvailableCompletedNot AvailableInflammatory Reaction / Psoriasis1
Not AvailableCompletedNot AvailableJuvenile Idiopathic Arthritis (JIA)1
Not AvailableCompletedNot AvailablePregnancy1
Not AvailableCompletedNot AvailablePsoriasis3
Not AvailableCompletedNot AvailablePsoriasis / Psoriatic Arthritis / Skin Diseases, Papulosquamous2
Not AvailableCompletedNot AvailablePsoriatic Arthritis1
Not AvailableCompletedNot AvailableRheumatoid Arthritis12
Not AvailableCompletedNot AvailableRhupus Syndrome, Etanercept1
Not AvailableCompletedNot AvailableSpondyloarthritis / Ultrasonography1
Not AvailableCompletedHealth Services ResearchCongenital Hypoplastic Anemia1
Not AvailableCompletedPreventionInguinal Hernias / Postoperative pain1
Not AvailableCompletedTreatmentAsthma Bronchial1
Not AvailableCompletedTreatmentMetabolic Syndromes2
Not AvailableCompletedTreatmentPsoriasis1
Not AvailableCompletedTreatmentRheumatoid Arthritis1
Not AvailableEnrolling by InvitationNot AvailablePsoriasis Arthritis / Rheumatoid Arthritis1
Not AvailableNot Yet RecruitingNot AvailableRheumatoid Arthritis1
Not AvailableRecruitingNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableRecruitingNot AvailablePlaque Psoriasis / Psoriatic Arthritis / Rheumatoid Arthritis / Spondyloarthritis, Axial1
Not AvailableRecruitingNot AvailablePsoriasis1
Not AvailableRecruitingNot AvailableRheumatoid Arthritis3
Not AvailableRecruitingNot AvailableRheumatoid Arthritis / Spondyloarthritis, Axial1
Not AvailableRecruitingNot AvailableRheumatoid Arthritis / Spondyloarthropathies1
Not AvailableRecruitingScreeningAnkylosing Spondylitis (AS)1
Not AvailableRecruitingTreatmentKnee Osteoarthritis (Knee OA)2
Not AvailableTerminatedNot AvailableAnkylosing Spondylitis (AS) / Rheumatoid Arthritis1
Not AvailableTerminatedPreventionBMI >30 kg/m2 / Hyperlipidemias / Hypertensive / Metabolic Syndromes / Psoriasis1
Not AvailableUnknown StatusNot AvailableScleritis / Uveitis1
Not AvailableUnknown StatusTreatmentBehcet's Syndrome / Uveal Disease1
Not AvailableUnknown StatusTreatmentDrug hypersensitivity reaction1
Not AvailableUnknown StatusTreatmentPsoriasis1
Not AvailableWithdrawnNot AvailableRheumatoid Arthritis1
Not AvailableWithdrawnTreatmentChronic Regional Pain Syndrome / CRP1

Pharmacoeconomics

Manufacturers
  • Amgen Inc. + Wyeth + Takeda
Packagers
Dosage forms
FormRouteStrength
Injection, powder, for solutionSubcutaneous10 mg
Injection, powder, for solutionSubcutaneous25 mg
Injection, powder, for solutionSubcutaneous50 mg
Injection, solutionSubcutaneous25 mg
Injection, solutionSubcutaneous50 mg
Kit
Kit; liquid; powder, for solutionSubcutaneous
SolutionSubcutaneous25 mg/.5mL
SolutionSubcutaneous50 mg
SolutionSubcutaneous50 mg/mL
SolutionSubcutaneous25 mg
Prices
Unit descriptionCostUnit
Enbrel (1 Box = 1 Kit = Four 50 mg Syringes) 3.92ml Box2033.14USD box
Enbrel SureClick (1 Box Contains Four 50 mg Prefilled Autoinjectors)2033.14USD box
Enbrel 4 25 mg Kit (1 Box = 1 Kit = Four 25 mg Vials)1016.57USD box
Enbrel 50 mg/ml sureclick syr488.74USD syringe
Enbrel 25 mg kit250.37USD each
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2476934No2009-06-162023-02-27Canada
CA2123593No2000-03-142013-09-14Canada
US7276477No2007-10-022024-07-29Us
US36755No2000-06-272012-10-23Us

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.529Not Available
isoelectric point7.89Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Tumor necrosis factor receptor binding
Specific Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct ac...
Gene Name
TNF
Uniprot ID
P01375
Uniprot Name
Tumor necrosis factor
Molecular Weight
25644.15 Da
References
  1. Park YC, Burkitt V, Villa AR, Tong L, Wu H: Structural basis for self-association and receptor recognition of human TRAF2. Nature. 1999 Apr 8;398(6727):533-8. [PubMed:10206649]
  2. Sandborn WJ, Hanauer SB: Antitumor necrosis factor therapy for inflammatory bowel disease: a review of agents, pharmacology, clinical results, and safety. Inflamm Bowel Dis. 1999 May;5(2):119-33. [PubMed:10338381]
  3. Grell M, Zimmermann G, Gottfried E, Chen CM, Grunwald U, Huang DC, Wu Lee YH, Durkop H, Engelmann H, Scheurich P, Wajant H, Strasser A: Induction of cell death by tumour necrosis factor (TNF) receptor 2, CD40 and CD30: a role for TNF-R1 activation by endogenous membrane-anchored TNF. EMBO J. 1999 Jun 1;18(11):3034-43. [PubMed:10357816]
  4. Moreland LW: Inhibitors of tumor necrosis factor: new treatment options for rheumatoid arthritis. Cleve Clin J Med. 1999 Jun;66(6):367-74. [PubMed:10375846]
  5. Calabrese LH: Rheumatoid arthritis and primary care: the case for early diagnosis and treatment. J Am Osteopath Assoc. 1999 Jun;99(6):313-21. [PubMed:10405518]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Ubiquitin protein ligase binding
Specific Function
Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 ...
Gene Name
TNFRSF1B
Uniprot ID
P20333
Uniprot Name
Tumor necrosis factor receptor superfamily member 1B
Molecular Weight
48290.85 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442]
  2. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442]
  2. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083]
  2. Ranheim EA, Kipps TJ: Tumor necrosis factor-alpha facilitates induction of CD80 (B7-1) and CD54 on human B cells by activated T cells: complex regulation by IL-4, IL-10, and CD40L. Cell Immunol. 1995 Apr 1;161(2):226-35. [PubMed:7535196]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor binding
Specific Function
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes a...
Gene Name
LTA
Uniprot ID
P01374
Uniprot Name
Lymphotoxin-alpha
Molecular Weight
22296.57 Da
References
  1. Johnson CJ, Reilly KM, Murray KM: Etanercept in juvenile rheumatoid arthritis. Ann Pharmacother. 2001 Apr;35(4):464-71. [PubMed:11302411]
  2. Pennica D, Lam VT, Mize NK, Weber RF, Lewis M, Fendly BM, Lipari MT, Goeddel DV: Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation. J Biol Chem. 1992 Oct 15;267(29):21172-8. [PubMed:1328224]
  3. Gudbrandsdottir S, Larsen R, Sorensen LK, Nielsen S, Hansen MB, Svenson M, Bendtzen K, Muller K: TNF and LT binding capacities in the plasma of arthritis patients: effect of etanercept treatment in juvenile idiopathic arthritis. Clin Exp Rheumatol. 2004 Jan-Feb;22(1):118-24. [PubMed:15005015]
  4. Buch MH, Conaghan PG, Quinn MA, Bingham SJ, Veale D, Emery P: True infliximab resistance in rheumatoid arthritis: a role for lymphotoxin alpha? Ann Rheum Dis. 2004 Oct;63(10):1344-6. Epub 2004 Mar 19. [PubMed:15033655]
  5. Kang CP, Lee KW, Yoo DH, Kang C, Bae SC: The influence of a polymorphism at position -857 of the tumour necrosis factor alpha gene on clinical response to etanercept therapy in rheumatoid arthritis. Rheumatology (Oxford). 2005 Apr;44(4):547-52. Epub 2005 Feb 3. [PubMed:15695296]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083]
  2. Ozgocmen S, Godekmerdan A, Ozkurt-Zengin F: Acute-phase response, clinical measures and disease activity in ankylosing spondylitis. Joint Bone Spine. 2007 May;74(3):249-53. Epub 2007 Mar 5. [PubMed:17387033]
  3. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442]
  4. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Prostaglandin-endoperoxide synthase activity
Specific Function
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and...
Gene Name
PTGS2
Uniprot ID
P35354
Uniprot Name
Prostaglandin G/H synthase 2
Molecular Weight
68995.625 Da
References
  1. Bawolak MT, Touzin K, Moreau ME, Desormeaux A, Adam A, Marceau F: Cardiovascular expression of inflammatory signaling molecules, the kinin B1 receptor and COX2, in the rabbit: effects of LPS, anti-inflammatory and anti-hypertensive drugs. Regul Pept. 2008 Feb 7;146(1-3):157-68. Epub 2007 Sep 14. [PubMed:17931716]
  2. Genovese T, Mazzon E, Crisafulli C, Di Paola R, Muia C, Bramanti P, Cuzzocrea S: Immunomodulatory effects of etanercept in an experimental model of spinal cord injury. J Pharmacol Exp Ther. 2006 Mar;316(3):1006-16. Epub 2005 Nov 22. [PubMed:16303916]

Drug created on June 13, 2005 07:24 / Updated on November 19, 2017 20:34