Jump to section
IdentificationPharmacologyInteractionsReferencesTrialsEconomicsPropertiesSpectraTaxonomyIdentification
- Name
- Etanercept
- Accession Number
- DB00005 (BTD00052, BIOD00052)
- Type
- Biotech
- Groups
- Approved, Investigational
- Biologic Classification
- Protein Based Therapies
Fusion proteins - Description
Dimeric fusion protein consisting of the extracellular ligand-binding portion of the human 75 kilodalton (p75) tumor necrosis factor receptor (TNFR) linked to the Fc portion of human IgG1. The Fc component of etanercept contains the CH2 domain, the CH3 domain and hinge region, but not the CH1 domain of IgG1. Etanercept is produced by recombinant DNA technology in a Chinese hamster ovary (CHO) mammalian cell expression system. It consists of 934 amino acids.
- Protein structure
- Protein chemical formula
- C2224H3475N621O698S36
- Protein average weight
- 51234.9 Da
- Sequences
> Etanercept Sequence LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format- Synonyms
- Etanercept-szzs
- RHU TNFR:FC
- RHU-TNFR:FC
- TNFR-Immunoadhesin
- External IDs
- CHS-0214 / DWP-422 / ENIA-11 / GP-2015 / GP2015 / GP2015C / HD-203 / HD203 / LBEC-0101 / LBEC0101 / SB-4 / SB4
- Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Brenzys Solution 50 mg Subcutaneous Samsung Bioepis Co., Ltd. 2016-09-13 Not applicable Canada 
Brenzys Solution 50 mg Subcutaneous Samsung Bioepis Co., Ltd. 2016-09-23 Not applicable Canada Enbrel Injection, powder, for solution 10 mg Subcutaneous Pfizer 2000-02-03 Not applicable EU 
Enbrel Solution 50 mg Subcutaneous Immunex Corporation 2005-12-21 Not applicable Canada Enbrel Injection, powder, for solution 50 mg Subcutaneous Pfizer 2000-02-03 Not applicable EU Enbrel Kit Immunex Corporation 2003-01-02 Not applicable US 
Enbrel Injection, solution 25 mg Subcutaneous Pfizer 2000-02-03 Not applicable EU Enbrel Solution 50 mg/mL Subcutaneous Immunex Corporation 2017-09-29 Not applicable US Enbrel Injection, solution 50 mg Subcutaneous Pfizer 2000-02-03 Not applicable EU Enbrel Injection, powder, for solution 25 mg Subcutaneous Pfizer 2000-02-03 Not applicable EU - Mixture Products
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Enbrel Etanercept (25 mg) + Water (1 ml) Kit; Liquid; Powder, for solution Subcutaneous Immunex Corporation 2001-03-14 Not applicable Canada - International/Other Brands
- Davictrel / Enbrel Sureclick / Tunex
- Categories
- Amino Acids, Peptides, and Proteins
- Analgesics
- Analgesics, Non-Narcotic
- Anti-Inflammatory Agents
- Anti-Inflammatory Agents, Non-Steroidal
- Antibodies
- Antineoplastic and Immunomodulating Agents
- Antirheumatic Agents
- Biologics for Rheumatoid Arthritis Treatment
- Blood Proteins
- Central Nervous System Agents
- Disease-modifying Antirheumatic Agents
- Gastrointestinal Agents
- Globulins
- Immunoglobulin G
- Immunoglobulin Isotypes
- Immunoglobulins
- Immunologic Factors
- Immunoproteins
- Immunosuppressive Agents
- Membrane Proteins
- Peripheral Nervous System Agents
- Proteins
- Receptors, Cell Surface
- Receptors, Cytokine
- Receptors, Immunologic
- Receptors, Tumor Necrosis Factor
- Sensory System Agents
- Serum Globulins
- Tumor Necrosis Factor Alpha (TNF-α) Inhibitors
- Tumor Necrosis Factor Blocker
- UNII
- OP401G7OJC
- CAS number
- 185243-69-0
Pharmacology
- Indication
Etanercept is indicated for the treatment of moderately to severely active rheumatoid arthritis in adults and chronic moderate to severe plaque psoriasis in adults. It is also used to manage signs and symptoms of polyarticular idiopathic arthritis in those aged 4 to 17 after insufficient response to one or more disease-modifying anti-rheumatic drugs. Etanercept is also used to improve psoriatic arthritis and ankylosing spondylitis.
- Structured Indications
- Pharmacodynamics
Etanercept binds specifically to tumor necrosis factor (TNF) and thereby modulates biological processes that are induced or regulated by TNF. Such processes or molecules affected include the level of adhesion molecules expressed, as well as serum levels of cytokines and matrix metalloproteinase-3, also known as stromelysin. In animal models, etanarcept has been demonstrated to affect inflammation, such as in murine collagen-induced arthritis.
- Mechanism of action
There are two distinct receptors for TNF (TNFRs), a 55 kilodalton protein (p55) and a 75 kilodalton protein (p75). The biological activity of TNF is dependent upon binding to either cell surface receptor (p75 or p55). Etanercept is a dimeric soluble form of the p75 TNF receptor that can bind to two TNF molecules, thereby effectively removing them from circulation.
TNF is a naturally occurring cytokine that is involved in normal inflammatory and immune responses. Increased levels of TNF are found in tissues and fluids of those with rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis (AS), and plaque psoriasis.
Target Actions Organism ATumor necrosis factor antibodyHuman UTumor necrosis factor receptor superfamily member 1B Not Available Human UHigh affinity immunoglobulin gamma Fc receptor I Not Available Human ULow affinity immunoglobulin gamma Fc region receptor III-A Not Available Human ULow affinity immunoglobulin gamma Fc region receptor II-a Not Available Human ULow affinity immunoglobulin gamma Fc region receptor II-b Not Available Human ULow affinity immunoglobulin gamma Fc region receptor II-c Not Available Human ULymphotoxin-alpha Not Available Human ULow affinity immunoglobulin gamma Fc region receptor III-B Not Available Human UComplement C1s subcomponent Not Available Human UComplement C1r subcomponent Not Available Human UComplement C1q subcomponent subunit A Not Available Human UComplement C1q subcomponent subunit B Not Available Human UComplement C1q subcomponent subunit C Not Available Human - Absorption
Bioavailability following sub-Q administration is approximately 60%. Peak plasma concentrations achieved within 69 hours.
- Volume of distribution
- Not Available
- Protein binding
- Not Available
- Metabolism
- Not Available
- Route of elimination
- Not Available
- Half life
102 +/- 30 hrs in individuals with rheumatoid arthritis and 68 hours in healthy adults.
- Clearance
- 160 +/- 80 mL/hr [RA patients]
- Toxicity
- Not Available
- Affected organisms
- Humans and other mammals
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
Drug Interaction Drug group (4R)-limonene The risk or severity of adverse effects can be increased when Etanercept is combined with (4R)-limonene. Investigational 16-Bromoepiandrosterone The risk or severity of adverse effects can be increased when Etanercept is combined with 16-Bromoepiandrosterone. Investigational 19-norandrostenedione The risk or severity of adverse effects can be increased when Etanercept is combined with 19-norandrostenedione. Experimental, Illicit 5-androstenedione The risk or severity of adverse effects can be increased when Etanercept is combined with 5-androstenedione. Experimental, Illicit Abatacept The risk or severity of infection can be increased when Etanercept is combined with Abatacept. Approved Abciximab Etanercept may increase the anticoagulant activities of Abciximab. Approved Acebutolol Etanercept may decrease the antihypertensive activities of Acebutolol. Approved, Investigational Aceclofenac The risk or severity of adverse effects can be increased when Etanercept is combined with Aceclofenac. Approved, Investigational Acemetacin The risk or severity of adverse effects can be increased when Etanercept is combined with Acemetacin. Approved, Experimental, Investigational Acenocoumarol Etanercept may increase the anticoagulant activities of Acenocoumarol. Approved, Investigational Acetylsalicylic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Acetylsalicylic acid. Approved, Vet Approved Aclarubicin Etanercept may decrease the excretion rate of Aclarubicin which could result in a higher serum level. Investigational Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Etanercept. Approved Adapalene The risk or severity of adverse effects can be increased when Etanercept is combined with Adapalene. Approved Alclofenac The risk or severity of adverse effects can be increased when Etanercept is combined with Alclofenac. Approved, Withdrawn Alclometasone The risk or severity of adverse effects can be increased when Etanercept is combined with Alclometasone. Approved Aldosterone The risk or severity of adverse effects can be increased when Etanercept is combined with Aldosterone. Experimental, Investigational Aldoxorubicin Etanercept may decrease the excretion rate of Aldoxorubicin which could result in a higher serum level. Investigational Alendronic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Alendronic acid. Approved Aliskiren Etanercept may decrease the antihypertensive activities of Aliskiren. Approved, Investigational Alminoprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Alminoprofen. Experimental Alprenolol Etanercept may decrease the antihypertensive activities of Alprenolol. Approved, Withdrawn Alprostadil The therapeutic efficacy of Alprostadil can be decreased when used in combination with Etanercept. Approved, Investigational Amcinonide The risk or severity of adverse effects can be increased when Etanercept is combined with Amcinonide. Approved Amikacin Etanercept may decrease the excretion rate of Amikacin which could result in a higher serum level. Approved, Investigational, Vet Approved Amiloride Etanercept may decrease the antihypertensive activities of Amiloride. Approved Amrubicin Etanercept may decrease the excretion rate of Amrubicin which could result in a higher serum level. Approved, Investigational Anakinra The risk or severity of adverse effects can be increased when Etanercept is combined with Anakinra. Approved Ancrod Etanercept may increase the anticoagulant activities of Ancrod. Approved, Investigational Andrographolide The risk or severity of adverse effects can be increased when Etanercept is combined with Andrographolide. Investigational Androstenedione The risk or severity of adverse effects can be increased when Etanercept is combined with Androstenedione. Experimental, Illicit Anecortave The risk or severity of adverse effects can be increased when Etanercept is combined with Anecortave. Investigational anecortave acetate The risk or severity of adverse effects can be increased when Etanercept is combined with anecortave acetate. Investigational Anisodamine The risk or severity of adverse effects can be increased when Etanercept is combined with Anisodamine. Investigational Annamycin Etanercept may decrease the excretion rate of Annamycin which could result in a higher serum level. Investigational Anthrax immune globulin human The risk or severity of adverse effects can be increased when Etanercept is combined with Anthrax immune globulin human. Approved Antipyrine The risk or severity of adverse effects can be increased when Etanercept is combined with Antipyrine. Approved, Investigational Antithrombin III human Etanercept may increase the anticoagulant activities of Antithrombin III human. Approved Apixaban Etanercept may increase the anticoagulant activities of Apixaban. Approved Apocynin The risk or severity of adverse effects can be increased when Etanercept is combined with Apocynin. Investigational Apramycin Etanercept may decrease the excretion rate of Apramycin which could result in a higher serum level. Experimental, Vet Approved Apremilast The risk or severity of adverse effects can be increased when Etanercept is combined with Apremilast. Approved, Investigational Arbekacin Etanercept may decrease the excretion rate of Arbekacin which could result in a higher serum level. Approved, Investigational Ardeparin Etanercept may increase the anticoagulant activities of Ardeparin. Approved, Investigational, Withdrawn Argatroban Etanercept may increase the anticoagulant activities of Argatroban. Approved, Investigational Arotinolol Etanercept may decrease the antihypertensive activities of Arotinolol. Investigational Atamestane The risk or severity of adverse effects can be increased when Etanercept is combined with Atamestane. Investigational Atenolol Etanercept may decrease the antihypertensive activities of Atenolol. Approved Azapropazone The risk or severity of adverse effects can be increased when Etanercept is combined with Azapropazone. Withdrawn Azelastine The risk or severity of adverse effects can be increased when Etanercept is combined with Azelastine. Approved Azficel-T The risk or severity of adverse effects can be increased when Etanercept is combined with Azficel-T. Approved, Investigational Azilsartan medoxomil The risk or severity of adverse effects can be increased when Azilsartan medoxomil is combined with Etanercept. Approved, Investigational Azosemide The therapeutic efficacy of Azosemide can be decreased when used in combination with Etanercept. Investigational Bacillus calmette-guerin substrain connaught live antigen The risk or severity of adverse effects can be increased when Etanercept is combined with Bacillus calmette-guerin substrain connaught live antigen. Approved, Investigational Bacillus calmette-guerin substrain tice live antigen The risk or severity of adverse effects can be increased when Etanercept is combined with Bacillus calmette-guerin substrain tice live antigen. Approved Balsalazide Etanercept may increase the nephrotoxic activities of Balsalazide. Approved, Investigational BCG vaccine The therapeutic efficacy of BCG vaccine can be decreased when used in combination with Etanercept. Investigational Becaplermin Etanercept may increase the anticoagulant activities of Becaplermin. Approved, Investigational Beclomethasone dipropionate The risk or severity of adverse effects can be increased when Etanercept is combined with Beclomethasone dipropionate. Approved, Investigational Befunolol Etanercept may decrease the antihypertensive activities of Befunolol. Experimental Bekanamycin Etanercept may decrease the excretion rate of Bekanamycin which could result in a higher serum level. Experimental Belimumab The risk or severity of adverse effects can be increased when Etanercept is combined with Belimumab. Approved Benazepril The risk or severity of adverse effects can be increased when Etanercept is combined with Benazepril. Approved, Investigational Bendazac The risk or severity of adverse effects can be increased when Etanercept is combined with Bendazac. Experimental Bendroflumethiazide The therapeutic efficacy of Bendroflumethiazide can be decreased when used in combination with Etanercept. Approved Benorilate The risk or severity of adverse effects can be increased when Etanercept is combined with Benorilate. Experimental Benoxaprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Benoxaprofen. Withdrawn Benzydamine The risk or severity of adverse effects can be increased when Etanercept is combined with Benzydamine. Approved Beraprost The therapeutic efficacy of Beraprost can be decreased when used in combination with Etanercept. Investigational Betamethasone The risk or severity of adverse effects can be increased when Etanercept is combined with Betamethasone. Approved, Vet Approved Betaxolol Etanercept may decrease the antihypertensive activities of Betaxolol. Approved, Investigational Betrixaban The risk or severity of bleeding can be increased when Betrixaban is combined with Etanercept. Approved, Investigational Bevantolol Etanercept may decrease the antihypertensive activities of Bevantolol. Approved Bevonium The risk or severity of adverse effects can be increased when Etanercept is combined with Bevonium. Experimental Bimatoprost The therapeutic efficacy of Bimatoprost can be decreased when used in combination with Etanercept. Approved, Investigational Bisoprolol Etanercept may decrease the antihypertensive activities of Bisoprolol. Approved Bivalirudin Etanercept may increase the anticoagulant activities of Bivalirudin. Approved, Investigational Bopindolol Etanercept may decrease the antihypertensive activities of Bopindolol. Approved Bromfenac The risk or severity of adverse effects can be increased when Bromfenac is combined with Etanercept. Approved Bucillamine The risk or severity of adverse effects can be increased when Etanercept is combined with Bucillamine. Investigational Bucindolol Etanercept may decrease the antihypertensive activities of Bucindolol. Investigational Budesonide The risk or severity of adverse effects can be increased when Etanercept is combined with Budesonide. Approved Bufexamac The risk or severity of adverse effects can be increased when Etanercept is combined with Bufexamac. Approved, Experimental Bufuralol Etanercept may decrease the antihypertensive activities of Bufuralol. Experimental, Investigational Bumadizone The risk or severity of adverse effects can be increased when Etanercept is combined with Bumadizone. Experimental Bumetanide The therapeutic efficacy of Bumetanide can be decreased when used in combination with Etanercept. Approved Bupranolol Etanercept may decrease the antihypertensive activities of Bupranolol. Approved Canakinumab The risk or severity of infection and neutropenia can be increased when Etanercept is combined with Canakinumab. Approved, Investigational Candesartan The risk or severity of adverse effects can be increased when Candesartan is combined with Etanercept. Experimental Candesartan cilexetil The risk or severity of adverse effects can be increased when Candesartan cilexetil is combined with Etanercept. Approved Candoxatril The risk or severity of adverse effects can be increased when Etanercept is combined with Candoxatril. Experimental Captopril The risk or severity of adverse effects can be increased when Etanercept is combined with Captopril. Approved Carbaspirin calcium The risk or severity of adverse effects can be increased when Etanercept is combined with Carbaspirin calcium. Experimental, Investigational Carboprost Tromethamine The therapeutic efficacy of Carboprost Tromethamine can be decreased when used in combination with Etanercept. Approved Carprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Carprofen. Approved, Vet Approved, Withdrawn Carteolol Etanercept may decrease the antihypertensive activities of Carteolol. Approved Carvedilol Etanercept may decrease the antihypertensive activities of Carvedilol. Approved, Investigational Castanospermine The risk or severity of adverse effects can be increased when Etanercept is combined with Castanospermine. Experimental Celecoxib The risk or severity of adverse effects can be increased when Etanercept is combined with Celecoxib. Approved, Investigational Celiprolol Etanercept may decrease the antihypertensive activities of Celiprolol. Approved, Investigational Certolizumab pegol The risk or severity of infection can be increased when Etanercept is combined with Certolizumab pegol. Approved Certoparin Etanercept may increase the anticoagulant activities of Certoparin. Approved, Investigational Chloroquine The risk or severity of adverse effects can be increased when Etanercept is combined with Chloroquine. Approved, Investigational, Vet Approved Chlorothiazide The therapeutic efficacy of Chlorothiazide can be decreased when used in combination with Etanercept. Approved, Vet Approved Chlorthalidone The therapeutic efficacy of Chlorthalidone can be decreased when used in combination with Etanercept. Approved Cholestyramine Cholestyramine can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy. Approved, Investigational Choline magnesium trisalicylate The risk or severity of adverse effects can be increased when Etanercept is combined with Choline magnesium trisalicylate. Approved Ciclesonide The risk or severity of adverse effects can be increased when Etanercept is combined with Ciclesonide. Approved, Investigational Cilazapril The risk or severity of adverse effects can be increased when Etanercept is combined with Cilazapril. Approved Cinoxacin Etanercept may increase the neuroexcitatory activities of Cinoxacin. Approved, Investigational, Withdrawn Citric Acid Etanercept may increase the anticoagulant activities of Citric Acid. Approved, Nutraceutical, Vet Approved Clobetasol The risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasol. Approved, Investigational Clobetasol propionate The risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasol propionate. Approved Clobetasone The risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasone. Approved Clocortolone The risk or severity of adverse effects can be increased when Etanercept is combined with Clocortolone. Approved Clodronic Acid The risk or severity of adverse effects can be increased when Etanercept is combined with Clodronic Acid. Approved, Investigational, Vet Approved Clonixin The risk or severity of adverse effects can be increased when Etanercept is combined with Clonixin. Approved Cloprostenol The therapeutic efficacy of Cloprostenol can be decreased when used in combination with Etanercept. Vet Approved Cloranolol Etanercept may decrease the antihypertensive activities of Cloranolol. Experimental Clostridium tetani toxoid antigen (formaldehyde inactivated) The risk or severity of adverse effects can be increased when Etanercept is combined with Clostridium tetani toxoid antigen (formaldehyde inactivated). Approved Colesevelam Colesevelam can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy. Approved Colestipol Colestipol can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy. Approved Cortexolone 17α-propionate The risk or severity of adverse effects can be increased when Etanercept is combined with Cortexolone 17α-propionate. Investigational Corticosterone The risk or severity of adverse effects can be increased when Etanercept is combined with Corticosterone. Experimental Cortisone acetate The risk or severity of adverse effects can be increased when Etanercept is combined with Cortisone acetate. Approved, Investigational Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) The risk or severity of adverse effects can be increased when Etanercept is combined with Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated). Approved Curcumin The risk or severity of adverse effects can be increased when Etanercept is combined with Curcumin. Approved, Investigational Cyclopenthiazide The therapeutic efficacy of Cyclopenthiazide can be decreased when used in combination with Etanercept. Experimental Cyclophosphamide The risk or severity of adverse effects can be increased when Etanercept is combined with Cyclophosphamide. Approved, Investigational Cyclosporine Etanercept may increase the nephrotoxic activities of Cyclosporine. Approved, Investigational, Vet Approved Dabigatran etexilate Etanercept may increase the anticoagulant activities of Dabigatran etexilate. Approved Dalteparin Etanercept may increase the anticoagulant activities of Dalteparin. Approved Danaparoid Etanercept may increase the anticoagulant activities of Danaparoid. Approved, Withdrawn Darexaban Etanercept may increase the anticoagulant activities of Darexaban. Investigational Daunorubicin Etanercept may decrease the excretion rate of Daunorubicin which could result in a higher serum level. Approved Deferasirox The risk or severity of adverse effects can be increased when Etanercept is combined with Deferasirox. Approved, Investigational Deflazacort The risk or severity of adverse effects can be increased when Etanercept is combined with Deflazacort. Approved, Investigational Delapril The risk or severity of adverse effects can be increased when Etanercept is combined with Delapril. Experimental Denosumab The risk or severity of adverse effects can be increased when Denosumab is combined with Etanercept. Approved Desirudin Etanercept may increase the anticoagulant activities of Desirudin. Approved Desmopressin The risk or severity of adverse effects can be increased when Etanercept is combined with Desmopressin. Approved Desonide The risk or severity of adverse effects can be increased when Etanercept is combined with Desonide. Approved, Investigational Desoximetasone The risk or severity of adverse effects can be increased when Etanercept is combined with Desoximetasone. Approved Desoxycorticosterone acetate The risk or severity of adverse effects can be increased when Etanercept is combined with Desoxycorticosterone acetate. Approved Desoxycorticosterone Pivalate The risk or severity of adverse effects can be increased when Etanercept is combined with Desoxycorticosterone Pivalate. Experimental, Vet Approved Dexamethasone The risk or severity of adverse effects can be increased when Etanercept is combined with Dexamethasone. Approved, Investigational, Vet Approved Dexamethasone isonicotinate The risk or severity of adverse effects can be increased when Etanercept is combined with Dexamethasone isonicotinate. Vet Approved Dexketoprofen The risk or severity of adverse effects can be increased when Dexketoprofen is combined with Etanercept. Approved, Investigational Dextran Etanercept may increase the anticoagulant activities of Dextran. Approved, Investigational, Vet Approved Dibekacin Etanercept may decrease the excretion rate of Dibekacin which could result in a higher serum level. Experimental Dibotermin alfa The risk or severity of adverse effects can be increased when Etanercept is combined with Dibotermin alfa. Approved, Investigational Diclofenac The risk or severity of adverse effects can be increased when Diclofenac is combined with Etanercept. Approved, Vet Approved Dicoumarol Etanercept may increase the anticoagulant activities of Dicoumarol. Approved Difenpiramide The risk or severity of adverse effects can be increased when Etanercept is combined with Difenpiramide. Experimental Diflorasone The risk or severity of adverse effects can be increased when Etanercept is combined with Diflorasone. Approved Diflunisal The risk or severity of adverse effects can be increased when Etanercept is combined with Diflunisal. Approved, Investigational Difluocortolone The risk or severity of adverse effects can be increased when Etanercept is combined with Difluocortolone. Approved, Investigational, Withdrawn Difluprednate The risk or severity of adverse effects can be increased when Etanercept is combined with Difluprednate. Approved Digoxin The serum concentration of Digoxin can be increased when it is combined with Etanercept. Approved Dihydrostreptomycin Etanercept may decrease the excretion rate of Dihydrostreptomycin which could result in a higher serum level. Investigational, Vet Approved Dinoprost The therapeutic efficacy of Dinoprost can be decreased when used in combination with Etanercept. Investigational Dinoprost Tromethamine The therapeutic efficacy of Dinoprost Tromethamine can be decreased when used in combination with Etanercept. Approved, Vet Approved Dinoprostone The therapeutic efficacy of Dinoprostone can be decreased when used in combination with Etanercept. Approved Doxorubicin Etanercept may decrease the excretion rate of Doxorubicin which could result in a higher serum level. Approved, Investigational Drospirenone Etanercept may increase the hyperkalemic activities of Drospirenone. Approved Droxicam The risk or severity of adverse effects can be increased when Etanercept is combined with Droxicam. Withdrawn Duvelisib The risk or severity of adverse effects can be increased when Etanercept is combined with Duvelisib. Investigational E-6201 The risk or severity of adverse effects can be increased when Etanercept is combined with E-6201. Investigational Edetic Acid Etanercept may increase the anticoagulant activities of Edetic Acid. Approved, Vet Approved Edoxaban Etanercept may increase the anticoagulant activities of Edoxaban. Approved Enalapril The risk or severity of adverse effects can be increased when Etanercept is combined with Enalapril. Approved, Vet Approved Enalaprilat The risk or severity of adverse effects can be increased when Etanercept is combined with Enalaprilat. Approved Enoxacin Etanercept may increase the neuroexcitatory activities of Enoxacin. Approved, Investigational Enoxaparin Etanercept may increase the anticoagulant activities of Enoxaparin. Approved Enprostil The therapeutic efficacy of Enprostil can be decreased when used in combination with Etanercept. Experimental Epanolol Etanercept may decrease the antihypertensive activities of Epanolol. Experimental Epirizole The risk or severity of adverse effects can be increased when Etanercept is combined with Epirizole. Approved Epirubicin Etanercept may decrease the excretion rate of Epirubicin which could result in a higher serum level. Approved Epitizide The therapeutic efficacy of Epitizide can be decreased when used in combination with Etanercept. Experimental Eplerenone Etanercept may decrease the antihypertensive activities of Eplerenone. Approved Epoprostenol The therapeutic efficacy of Epoprostenol can be decreased when used in combination with Etanercept. Approved Eprosartan The risk or severity of adverse effects can be increased when Eprosartan is combined with Etanercept. Approved Equilenin The risk or severity of adverse effects can be increased when Etanercept is combined with Equilenin. Experimental Equilin The risk or severity of adverse effects can be increased when Etanercept is combined with Equilin. Approved Esmolol Etanercept may decrease the antihypertensive activities of Esmolol. Approved Estrone The risk or severity of adverse effects can be increased when Etanercept is combined with Estrone. Approved Estrone sulfate The risk or severity of adverse effects can be increased when Etanercept is combined with Estrone sulfate. Approved Etacrynic acid The therapeutic efficacy of Etacrynic acid can be decreased when used in combination with Etanercept. Approved, Investigational Ethenzamide The risk or severity of adverse effects can be increased when Etanercept is combined with Ethenzamide. Experimental Ethyl biscoumacetate Etanercept may increase the anticoagulant activities of Ethyl biscoumacetate. Withdrawn Etidronic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Etidronic acid. Approved Etodolac The risk or severity of adverse effects can be increased when Etanercept is combined with Etodolac. Approved, Investigational, Vet Approved Etofenamate The risk or severity of adverse effects can be increased when Etanercept is combined with Etofenamate. Approved, Investigational Etoricoxib The risk or severity of adverse effects can be increased when Etanercept is combined with Etoricoxib. Approved, Investigational Evening primrose oil The risk or severity of adverse effects can be increased when Etanercept is combined with Evening primrose oil. Approved, Investigational Exisulind The risk or severity of adverse effects can be increased when Etanercept is combined with Exisulind. Investigational Felbinac The risk or severity of adverse effects can be increased when Etanercept is combined with Felbinac. Experimental Fenbufen The risk or severity of adverse effects can be increased when Etanercept is combined with Fenbufen. Approved Fenoprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Fenoprofen. Approved Fenprostalene The therapeutic efficacy of Fenprostalene can be decreased when used in combination with Etanercept. Vet Approved Fentiazac The risk or severity of adverse effects can be increased when Etanercept is combined with Fentiazac. Experimental Feprazone The risk or severity of adverse effects can be increased when Etanercept is combined with Feprazone. Experimental Ferulic acid Etanercept may increase the anticoagulant activities of Ferulic acid. Experimental Fimasartan The risk or severity of adverse effects can be increased when Fimasartan is combined with Etanercept. Approved, Investigational Fingolimod Etanercept may increase the immunosuppressive activities of Fingolimod. Approved, Investigational Fleroxacin Etanercept may increase the neuroexcitatory activities of Fleroxacin. Approved Floctafenine The risk or severity of adverse effects can be increased when Floctafenine is combined with Etanercept. Approved, Withdrawn Fluasterone The risk or severity of adverse effects can be increased when Etanercept is combined with Fluasterone. Investigational Fludrocortisone The risk or severity of adverse effects can be increased when Etanercept is combined with Fludrocortisone. Approved, Investigational Fluindione Etanercept may increase the anticoagulant activities of Fluindione. Approved, Investigational Flumequine Etanercept may increase the neuroexcitatory activities of Flumequine. Withdrawn Flumethasone The risk or severity of adverse effects can be increased when Etanercept is combined with Flumethasone. Approved, Vet Approved Flunisolide The risk or severity of adverse effects can be increased when Etanercept is combined with Flunisolide. Approved, Investigational Flunixin The risk or severity of adverse effects can be increased when Etanercept is combined with Flunixin. Vet Approved Flunoxaprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Flunoxaprofen. Experimental Fluocinolone Acetonide The risk or severity of adverse effects can be increased when Etanercept is combined with Fluocinolone Acetonide. Approved, Investigational, Vet Approved Fluocinonide The risk or severity of adverse effects can be increased when Etanercept is combined with Fluocinonide. Approved, Investigational Fluocortolone The risk or severity of adverse effects can be increased when Etanercept is combined with Fluocortolone. Approved, Withdrawn Fluorometholone The risk or severity of adverse effects can be increased when Etanercept is combined with Fluorometholone. Approved, Investigational Fluprednidene The risk or severity of adverse effects can be increased when Etanercept is combined with Fluprednidene. Approved, Withdrawn Fluprednisolone The risk or severity of adverse effects can be increased when Etanercept is combined with Fluprednisolone. Approved Fluprostenol The therapeutic efficacy of Fluprostenol can be decreased when used in combination with Etanercept. Vet Approved Flurandrenolide The risk or severity of adverse effects can be increased when Etanercept is combined with Flurandrenolide. Approved Flurbiprofen The risk or severity of adverse effects can be increased when Flurbiprofen is combined with Etanercept. Approved, Investigational Fluticasone furoate The risk or severity of adverse effects can be increased when Etanercept is combined with Fluticasone furoate. Approved Fluticasone propionate The risk or severity of adverse effects can be increased when Etanercept is combined with Fluticasone propionate. Approved Folic Acid The therapeutic efficacy of Folic Acid can be decreased when used in combination with Etanercept. Approved, Nutraceutical, Vet Approved Fondaparinux Etanercept may increase the anticoagulant activities of Fondaparinux. Approved, Investigational Fondaparinux sodium Etanercept may increase the anticoagulant activities of Fondaparinux sodium. Approved, Investigational Forasartan The risk or severity of adverse effects can be increased when Forasartan is combined with Etanercept. Experimental Formestane The risk or severity of adverse effects can be increased when Etanercept is combined with Formestane. Approved, Investigational, Withdrawn Fosinopril The risk or severity of adverse effects can be increased when Etanercept is combined with Fosinopril. Approved Framycetin Etanercept may decrease the excretion rate of Framycetin which could result in a higher serum level. Approved Furosemide The therapeutic efficacy of Furosemide can be decreased when used in combination with Etanercept. Approved, Vet Approved G17DT The risk or severity of adverse effects can be increased when Etanercept is combined with G17DT. Investigational Gabexate Etanercept may increase the anticoagulant activities of Gabexate. Investigational Garenoxacin Etanercept may increase the neuroexcitatory activities of Garenoxacin. Investigational Gatifloxacin Etanercept may increase the neuroexcitatory activities of Gatifloxacin. Approved, Investigational Gemeprost The therapeutic efficacy of Gemeprost can be decreased when used in combination with Etanercept. Approved, Withdrawn Gemifloxacin Etanercept may increase the neuroexcitatory activities of Gemifloxacin. Approved, Investigational Geneticin Etanercept may decrease the excretion rate of Geneticin which could result in a higher serum level. Experimental Gentamicin Etanercept may decrease the excretion rate of Gentamicin which could result in a higher serum level. Approved, Vet Approved GENTAMICIN C1A Etanercept may decrease the excretion rate of GENTAMICIN C1A which could result in a higher serum level. Experimental GI-5005 The risk or severity of adverse effects can be increased when Etanercept is combined with GI-5005. Investigational Golimumab The risk or severity of adverse effects can be increased when Etanercept is combined with Golimumab. Approved GPX-150 Etanercept may decrease the excretion rate of GPX-150 which could result in a higher serum level. Investigational Grepafloxacin Etanercept may increase the neuroexcitatory activities of Grepafloxacin. Approved, Investigational, Withdrawn Guacetisal The risk or severity of adverse effects can be increased when Etanercept is combined with Guacetisal. Experimental Halcinonide The risk or severity of adverse effects can be increased when Etanercept is combined with Halcinonide. Approved, Investigational, Withdrawn Haloperidol The risk or severity of adverse effects can be increased when Etanercept is combined with Haloperidol. Approved HE3286 The risk or severity of adverse effects can be increased when Etanercept is combined with HE3286. Investigational Heparin Etanercept may increase the anticoagulant activities of Heparin. Approved, Investigational Hepatitis A Vaccine The risk or severity of adverse effects can be increased when Etanercept is combined with Hepatitis A Vaccine. Approved Hepatitis B Vaccine (Recombinant) The risk or severity of adverse effects can be increased when Etanercept is combined with Hepatitis B Vaccine (Recombinant). Approved, Withdrawn Higenamine The risk or severity of adverse effects can be increased when Etanercept is combined with Higenamine. Investigational Human rabies virus immune globulin The risk or severity of adverse effects can be increased when Etanercept is combined with Human rabies virus immune globulin. Approved Hydralazine Etanercept may decrease the antihypertensive activities of Hydralazine. Approved Hydrochlorothiazide The therapeutic efficacy of Hydrochlorothiazide can be decreased when used in combination with Etanercept. Approved, Vet Approved Hydrocortisone The risk or severity of adverse effects can be increased when Etanercept is combined with Hydrocortisone. Approved, Vet Approved Hydroflumethiazide The therapeutic efficacy of Hydroflumethiazide can be decreased when used in combination with Etanercept. Approved, Investigational Hygromycin B Etanercept may decrease the excretion rate of Hygromycin B which could result in a higher serum level. Vet Approved Ibandronate The risk or severity of adverse effects can be increased when Etanercept is combined with Ibandronate. Approved, Investigational Ibuprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Ibuprofen. Approved Ibuproxam The risk or severity of adverse effects can be increased when Etanercept is combined with Ibuproxam. Withdrawn Icatibant The risk or severity of adverse effects can be increased when Etanercept is combined with Icatibant. Approved, Investigational Idarubicin Etanercept may decrease the excretion rate of Idarubicin which could result in a higher serum level. Approved Idraparinux Etanercept may increase the anticoagulant activities of Idraparinux. Investigational Iloprost The therapeutic efficacy of Iloprost can be decreased when used in combination with Etanercept. Approved, Investigational Imidapril The risk or severity of adverse effects can be increased when Etanercept is combined with Imidapril. Investigational Imidazole salicylate The risk or severity of adverse effects can be increased when Etanercept is combined with Imidazole salicylate. Experimental Indapamide The therapeutic efficacy of Indapamide can be decreased when used in combination with Etanercept. Approved Indenolol Etanercept may decrease the antihypertensive activities of Indenolol. Withdrawn Indobufen The risk or severity of adverse effects can be increased when Etanercept is combined with Indobufen. Investigational Indomethacin The risk or severity of adverse effects can be increased when Etanercept is combined with Indomethacin. Approved, Investigational Indoprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Indoprofen. Withdrawn Infliximab Etanercept may increase the immunosuppressive activities of Infliximab. Approved INGN 201 The risk or severity of adverse effects can be increased when Etanercept is combined with INGN 201. Investigational INGN 225 The risk or severity of adverse effects can be increased when Etanercept is combined with INGN 225. Investigational Irbesartan The risk or severity of adverse effects can be increased when Irbesartan is combined with Etanercept. Approved, Investigational Isepamicin Etanercept may decrease the excretion rate of Isepamicin which could result in a higher serum level. Experimental Isoxicam The risk or severity of adverse effects can be increased when Etanercept is combined with Isoxicam. Withdrawn Istaroxime The risk or severity of adverse effects can be increased when Etanercept is combined with Istaroxime. Investigational Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated) The risk or severity of adverse effects can be increased when Etanercept is combined with Japanese encephalitis virus strain sa 14-14-2 antigen (formaldehyde inactivated). Approved Kanamycin Etanercept may decrease the excretion rate of Kanamycin which could result in a higher serum level. Approved, Investigational, Vet Approved Kebuzone The risk or severity of adverse effects can be increased when Etanercept is combined with Kebuzone. Experimental Ketoprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Ketoprofen. Approved, Vet Approved Ketorolac The risk or severity of adverse effects can be increased when Ketorolac is combined with Etanercept. Approved Labetalol Etanercept may decrease the antihypertensive activities of Labetalol. Approved Landiolol Etanercept may decrease the antihypertensive activities of Landiolol. Investigational Latanoprost The therapeutic efficacy of Latanoprost can be decreased when used in combination with Etanercept. Approved, Investigational Latanoprostene Bunod The therapeutic efficacy of Latanoprostene Bunod can be decreased when used in combination with Etanercept. Approved, Investigational Leflunomide The risk or severity of adverse effects can be increased when Etanercept is combined with Leflunomide. Approved, Investigational Lepirudin Etanercept may increase the anticoagulant activities of Lepirudin. Approved Letaxaban Etanercept may increase the anticoagulant activities of Letaxaban. Investigational Levobunolol Etanercept may decrease the antihypertensive activities of Levobunolol. Approved Levofloxacin Etanercept may increase the neuroexcitatory activities of Levofloxacin. Approved, Investigational Limaprost The therapeutic efficacy of Limaprost can be decreased when used in combination with Etanercept. Approved, Investigational Lisinopril The risk or severity of adverse effects can be increased when Etanercept is combined with Lisinopril. Approved, Investigational Lisofylline The risk or severity of adverse effects can be increased when Etanercept is combined with Lisofylline. Investigational Lithium The serum concentration of Lithium can be increased when it is combined with Etanercept. Approved Lonazolac The risk or severity of adverse effects can be increased when Etanercept is combined with Lonazolac. Experimental Lornoxicam The risk or severity of adverse effects can be increased when Etanercept is combined with Lornoxicam. Approved, Investigational Losartan The risk or severity of adverse effects can be increased when Losartan is combined with Etanercept. Approved Loteprednol The risk or severity of adverse effects can be increased when Etanercept is combined with Loteprednol. Approved Loxoprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Loxoprofen. Approved, Investigational Lubiprostone The therapeutic efficacy of Lubiprostone can be decreased when used in combination with Etanercept. Approved, Investigational Lumiracoxib The risk or severity of adverse effects can be increased when Etanercept is combined with Lumiracoxib. Approved, Investigational Luprostiol The therapeutic efficacy of Luprostiol can be decreased when used in combination with Etanercept. Vet Approved Magnesium salicylate The risk or severity of adverse effects can be increased when Etanercept is combined with Magnesium salicylate. Approved Masoprocol The risk or severity of adverse effects can be increased when Etanercept is combined with Masoprocol. Approved, Investigational ME-609 The risk or severity of adverse effects can be increased when Etanercept is combined with ME-609. Investigational Meclofenamic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Meclofenamic acid. Approved, Vet Approved Medrysone The risk or severity of adverse effects can be increased when Etanercept is combined with Medrysone. Approved Mefenamic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Mefenamic acid. Approved Melagatran Etanercept may increase the anticoagulant activities of Melagatran. Experimental Melengestrol The risk or severity of adverse effects can be increased when Etanercept is combined with Melengestrol. Vet Approved Meloxicam The risk or severity of adverse effects can be increased when Etanercept is combined with Meloxicam. Approved, Vet Approved Mepindolol Etanercept may decrease the antihypertensive activities of Mepindolol. Experimental Mesalazine Etanercept may increase the nephrotoxic activities of Mesalazine. Approved Metamizole The risk or severity of adverse effects can be increased when Etanercept is combined with Metamizole. Approved, Investigational, Withdrawn Methotrexate The serum concentration of Methotrexate can be increased when it is combined with Etanercept. Approved Methyclothiazide The therapeutic efficacy of Methyclothiazide can be decreased when used in combination with Etanercept. Approved Methylprednisolone The risk or severity of adverse effects can be increased when Etanercept is combined with Methylprednisolone. Approved, Vet Approved Metipranolol Etanercept may decrease the antihypertensive activities of Metipranolol. Approved Metolazone The therapeutic efficacy of Metolazone can be decreased when used in combination with Etanercept. Approved Metoprolol Etanercept may decrease the antihypertensive activities of Metoprolol. Approved, Investigational Metrizamide Etanercept may decrease the excretion rate of Metrizamide which could result in a higher serum level. Approved Micronomicin Etanercept may decrease the excretion rate of Micronomicin which could result in a higher serum level. Experimental Mifamurtide The therapeutic efficacy of Mifamurtide can be decreased when used in combination with Etanercept. Approved, Experimental Misoprostol The therapeutic efficacy of Misoprostol can be decreased when used in combination with Etanercept. Approved Mizoribine The risk or severity of adverse effects can be increased when Etanercept is combined with Mizoribine. Investigational Moexipril The risk or severity of adverse effects can be increased when Etanercept is combined with Moexipril. Approved Mofebutazone The risk or severity of adverse effects can be increased when Etanercept is combined with Mofebutazone. Experimental Mometasone The risk or severity of adverse effects can be increased when Etanercept is combined with Mometasone. Approved, Vet Approved Morniflumate The risk or severity of adverse effects can be increased when Morniflumate is combined with Etanercept. Approved Mycophenolate mofetil The risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolate mofetil. Approved, Investigational Mycophenolic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolic acid. Approved Nabumetone The risk or severity of adverse effects can be increased when Etanercept is combined with Nabumetone. Approved Nadolol Etanercept may decrease the antihypertensive activities of Nadolol. Approved Nadroparin Etanercept may increase the anticoagulant activities of Nadroparin. Approved, Investigational Nafamostat Etanercept may increase the anticoagulant activities of Nafamostat. Approved, Investigational Naftifine The risk or severity of adverse effects can be increased when Etanercept is combined with Naftifine. Approved Nalidixic Acid Etanercept may increase the neuroexcitatory activities of Nalidixic Acid. Approved, Investigational Naproxen The risk or severity of adverse effects can be increased when Etanercept is combined with Naproxen. Approved, Vet Approved Natalizumab The risk or severity of adverse effects can be increased when Etanercept is combined with Natalizumab. Approved, Investigational NCX 1022 The risk or severity of adverse effects can be increased when Etanercept is combined with NCX 1022. Investigational Neamine Etanercept may decrease the excretion rate of Neamine which could result in a higher serum level. Experimental Nebivolol Etanercept may decrease the antihypertensive activities of Nebivolol. Approved, Investigational Nemonoxacin Etanercept may increase the neuroexcitatory activities of Nemonoxacin. Investigational Neomycin Etanercept may decrease the excretion rate of Neomycin which could result in a higher serum level. Approved, Vet Approved Nepafenac The risk or severity of adverse effects can be increased when Nepafenac is combined with Etanercept. Approved, Investigational Netilmicin Etanercept may decrease the excretion rate of Netilmicin which could result in a higher serum level. Approved, Investigational Nifenazone The risk or severity of adverse effects can be increased when Etanercept is combined with Nifenazone. Experimental Niflumic Acid The risk or severity of adverse effects can be increased when Etanercept is combined with Niflumic Acid. Approved Nimesulide The risk or severity of adverse effects can be increased when Etanercept is combined with Nimesulide. Approved, Investigational, Withdrawn Nitroaspirin The risk or severity of adverse effects can be increased when Etanercept is combined with Nitroaspirin. Investigational Norfloxacin Etanercept may increase the neuroexcitatory activities of Norfloxacin. Approved Ocrelizumab Ocrelizumab may increase the immunosuppressive activities of Etanercept. Approved, Investigational Oleoyl-estrone The risk or severity of adverse effects can be increased when Etanercept is combined with Oleoyl-estrone. Investigational Olmesartan The risk or severity of adverse effects can be increased when Olmesartan is combined with Etanercept. Approved, Investigational Olopatadine The risk or severity of adverse effects can be increased when Etanercept is combined with Olopatadine. Approved Olsalazine Etanercept may increase the nephrotoxic activities of Olsalazine. Approved Omacetaxine mepesuccinate The risk or severity of bleeding can be increased when Etanercept is combined with Omacetaxine mepesuccinate. Approved, Investigational Omapatrilat The risk or severity of adverse effects can be increased when Etanercept is combined with Omapatrilat. Investigational Orgotein The risk or severity of adverse effects can be increased when Etanercept is combined with Orgotein. Vet Approved Otamixaban Etanercept may increase the anticoagulant activities of Otamixaban. Investigational Oxaprozin The risk or severity of adverse effects can be increased when Etanercept is combined with Oxaprozin. Approved Oxolinic acid Etanercept may increase the neuroexcitatory activities of Oxolinic acid. Experimental Oxprenolol Etanercept may decrease the antihypertensive activities of Oxprenolol. Approved Oxyphenbutazone The risk or severity of adverse effects can be increased when Etanercept is combined with Oxyphenbutazone. Approved, Withdrawn Pamidronate The risk or severity of adverse effects can be increased when Etanercept is combined with Pamidronate. Approved Paramethasone The risk or severity of adverse effects can be increased when Etanercept is combined with Paramethasone. Approved Parecoxib The risk or severity of adverse effects can be increased when Etanercept is combined with Parecoxib. Approved Paromomycin Etanercept may decrease the excretion rate of Paromomycin which could result in a higher serum level. Approved, Investigational Parthenolide The risk or severity of adverse effects can be increased when Etanercept is combined with Parthenolide. Approved, Investigational Pazufloxacin Etanercept may increase the neuroexcitatory activities of Pazufloxacin. Investigational Pefloxacin Etanercept may increase the neuroexcitatory activities of Pefloxacin. Approved Penbutolol Etanercept may decrease the antihypertensive activities of Penbutolol. Approved, Investigational Pentaerythritol Tetranitrate Etanercept may increase the anticoagulant activities of Pentaerythritol Tetranitrate. Approved Pentosan Polysulfate Etanercept may increase the anticoagulant activities of Pentosan Polysulfate. Approved Perindopril The risk or severity of adverse effects can be increased when Etanercept is combined with Perindopril. Approved Phenindione Etanercept may increase the anticoagulant activities of Phenindione. Approved, Investigational Phenprocoumon Etanercept may increase the anticoagulant activities of Phenprocoumon. Approved, Investigational Phenylbutazone The risk or severity of adverse effects can be increased when Etanercept is combined with Phenylbutazone. Approved, Vet Approved Pimecrolimus The risk or severity of adverse effects can be increased when Pimecrolimus is combined with Etanercept. Approved, Investigational Pindolol Etanercept may decrease the antihypertensive activities of Pindolol. Approved, Investigational Pipemidic acid Etanercept may increase the neuroexcitatory activities of Pipemidic acid. Experimental Pirarubicin Etanercept may decrease the excretion rate of Pirarubicin which could result in a higher serum level. Investigational Piretanide The therapeutic efficacy of Piretanide can be decreased when used in combination with Etanercept. Approved Pirfenidone The risk or severity of adverse effects can be increased when Etanercept is combined with Pirfenidone. Approved, Investigational Piromidic acid Etanercept may increase the neuroexcitatory activities of Piromidic acid. Experimental Piroxicam The risk or severity of adverse effects can be increased when Etanercept is combined with Piroxicam. Approved, Investigational Pirprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Pirprofen. Experimental Pitolisant The risk or severity of adverse effects can be increased when Etanercept is combined with Pitolisant. Approved, Investigational Platelet Activating Factor Etanercept may decrease the antihypertensive activities of Platelet Activating Factor. Experimental Plazomicin Etanercept may decrease the excretion rate of Plazomicin which could result in a higher serum level. Investigational Plicamycin Etanercept may decrease the excretion rate of Plicamycin which could result in a higher serum level. Approved, Investigational, Withdrawn Polythiazide The therapeutic efficacy of Polythiazide can be decreased when used in combination with Etanercept. Approved Practolol Etanercept may decrease the antihypertensive activities of Practolol. Approved Pralatrexate The serum concentration of Pralatrexate can be increased when it is combined with Etanercept. Approved, Investigational Pranoprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Pranoprofen. Experimental, Investigational Prasterone The risk or severity of adverse effects can be increased when Etanercept is combined with Prasterone. Approved, Investigational, Nutraceutical Prasterone sulfate The risk or severity of adverse effects can be increased when Etanercept is combined with Prasterone sulfate. Investigational Prednicarbate The risk or severity of adverse effects can be increased when Etanercept is combined with Prednicarbate. Approved, Investigational Prednisolone The risk or severity of adverse effects can be increased when Etanercept is combined with Prednisolone. Approved, Vet Approved Prednisone The risk or severity of adverse effects can be increased when Etanercept is combined with Prednisone. Approved, Vet Approved Pregnenolone The risk or severity of adverse effects can be increased when Etanercept is combined with Pregnenolone. Approved, Experimental, Investigational Probenecid The serum concentration of Etanercept can be increased when it is combined with Probenecid. Approved, Investigational Proglumetacin The risk or severity of adverse effects can be increased when Etanercept is combined with Proglumetacin. Experimental Propacetamol The risk or severity of adverse effects can be increased when Etanercept is combined with Propacetamol. Approved, Investigational Propranolol Etanercept may decrease the antihypertensive activities of Propranolol. Approved, Investigational Propyphenazone The risk or severity of adverse effects can be increased when Etanercept is combined with Propyphenazone. Experimental Proquazone The risk or severity of adverse effects can be increased when Etanercept is combined with Proquazone. Experimental Prostaglandin B2 The therapeutic efficacy of Prostaglandin B2 can be decreased when used in combination with Etanercept. Experimental Prostaglandin G2 The therapeutic efficacy of Prostaglandin G2 can be decreased when used in combination with Etanercept. Experimental Prostalene The therapeutic efficacy of Prostalene can be decreased when used in combination with Etanercept. Vet Approved Protein C Etanercept may increase the anticoagulant activities of Protein C. Approved Protein S human Etanercept may increase the anticoagulant activities of Protein S human. Approved Protocatechualdehyde Etanercept may increase the anticoagulant activities of Protocatechualdehyde. Approved Prulifloxacin Etanercept may increase the neuroexcitatory activities of Prulifloxacin. Investigational PTC299 The risk or severity of adverse effects can be increased when Etanercept is combined with PTC299. Investigational Puromycin Etanercept may decrease the excretion rate of Puromycin which could result in a higher serum level. Experimental Quinapril The risk or severity of adverse effects can be increased when Etanercept is combined with Quinapril. Approved, Investigational Quinethazone The therapeutic efficacy of Quinethazone can be decreased when used in combination with Etanercept. Approved Rabies virus inactivated antigen, A The risk or severity of adverse effects can be increased when Etanercept is combined with Rabies virus inactivated antigen, A. Approved, Investigational Rabies virus inactivated antigen, A The therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Etanercept. Approved, Investigational Ramipril The risk or severity of adverse effects can be increased when Etanercept is combined with Ramipril. Approved Rescinnamine The risk or severity of adverse effects can be increased when Etanercept is combined with Rescinnamine. Approved Resveratrol The risk or severity of adverse effects can be increased when Etanercept is combined with Resveratrol. Approved, Experimental, Investigational Reviparin Etanercept may increase the anticoagulant activities of Reviparin. Approved, Investigational Ribostamycin Etanercept may decrease the excretion rate of Ribostamycin which could result in a higher serum level. Approved, Investigational Rilonacept The risk or severity of adverse effects can be increased when Etanercept is combined with Rilonacept. Approved, Investigational Rimexolone The risk or severity of adverse effects can be increased when Etanercept is combined with Rimexolone. Approved Rindopepimut The risk or severity of adverse effects can be increased when Etanercept is combined with Rindopepimut. Investigational Risedronate The risk or severity of adverse effects can be increased when Etanercept is combined with Risedronate. Approved, Investigational Rituximab The risk or severity of adverse effects can be increased when Etanercept is combined with Rituximab. Approved Rivaroxaban Etanercept may increase the anticoagulant activities of Rivaroxaban. Approved Rofecoxib The risk or severity of adverse effects can be increased when Etanercept is combined with Rofecoxib. Approved, Investigational, Withdrawn Roflumilast Roflumilast may increase the immunosuppressive activities of Etanercept. Approved Rosoxacin Etanercept may increase the neuroexcitatory activities of Rosoxacin. Approved, Investigational Rotavirus Vaccine The risk or severity of adverse effects can be increased when Etanercept is combined with Rotavirus Vaccine. Approved Rubella virus vaccine The risk or severity of adverse effects can be increased when Etanercept is combined with Rubella virus vaccine. Approved, Investigational Rufloxacin Etanercept may increase the neuroexcitatory activities of Rufloxacin. Experimental Sabarubicin Etanercept may decrease the excretion rate of Sabarubicin which could result in a higher serum level. Investigational Sacubitril The risk or severity of adverse effects can be increased when Sacubitril is combined with Etanercept. Approved Salicylamide The risk or severity of adverse effects can be increased when Etanercept is combined with Salicylamide. Approved Salicylic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Salicylic acid. Approved, Investigational, Vet Approved Salmonella typhi ty2 vi polysaccharide antigen The risk or severity of adverse effects can be increased when Etanercept is combined with Salmonella typhi ty2 vi polysaccharide antigen. Approved Salmonella typhi ty21a live antigen The risk or severity of adverse effects can be increased when Etanercept is combined with Salmonella typhi ty21a live antigen. Approved Salsalate The risk or severity of adverse effects can be increased when Etanercept is combined with Salsalate. Approved Saprisartan The risk or severity of adverse effects can be increased when Saprisartan is combined with Etanercept. Experimental Saralasin The risk or severity of adverse effects can be increased when Saralasin is combined with Etanercept. Investigational Sarilumab Sarilumab may increase the immunosuppressive activities of Etanercept. Approved, Investigational Semapimod The risk or severity of adverse effects can be increased when Etanercept is combined with Semapimod. Investigational Seratrodast The risk or severity of adverse effects can be increased when Etanercept is combined with Seratrodast. Approved Serrapeptase The risk or severity of adverse effects can be increased when Etanercept is combined with Serrapeptase. Investigational Sipuleucel-T The therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Etanercept. Approved, Investigational Sisomicin Etanercept may decrease the excretion rate of Sisomicin which could result in a higher serum level. Investigational Sitafloxacin Etanercept may increase the neuroexcitatory activities of Sitafloxacin. Experimental, Investigational Sodium phosphate Sodium phosphate may increase the nephrotoxic activities of Etanercept. Approved Sotalol Etanercept may decrease the antihypertensive activities of Sotalol. Approved SP1049C Etanercept may decrease the excretion rate of SP1049C which could result in a higher serum level. Investigational Sparfloxacin Etanercept may increase the neuroexcitatory activities of Sparfloxacin. Approved, Investigational Spectinomycin Etanercept may decrease the excretion rate of Spectinomycin which could result in a higher serum level. Approved, Investigational, Vet Approved Spirapril The risk or severity of adverse effects can be increased when Etanercept is combined with Spirapril. Approved Spironolactone Etanercept may decrease the antihypertensive activities of Spironolactone. Approved SRP 299 The risk or severity of adverse effects can be increased when Etanercept is combined with SRP 299. Investigational SRT501 The risk or severity of adverse effects can be increased when Etanercept is combined with SRT501. Investigational Streptomycin Etanercept may decrease the excretion rate of Streptomycin which could result in a higher serum level. Approved, Vet Approved Streptozocin Etanercept may decrease the excretion rate of Streptozocin which could result in a higher serum level. Approved, Investigational Sulfasalazine The risk or severity of adverse effects can be increased when Etanercept is combined with Sulfasalazine. Approved Sulindac The risk or severity of adverse effects can be increased when Etanercept is combined with Sulindac. Approved, Investigational Sulodexide Etanercept may increase the anticoagulant activities of Sulodexide. Approved, Investigational Sulprostone The therapeutic efficacy of Sulprostone can be decreased when used in combination with Etanercept. Investigational Suprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Suprofen. Approved, Withdrawn Suxibuzone The risk or severity of adverse effects can be increased when Etanercept is combined with Suxibuzone. Experimental Tacrolimus Tacrolimus may increase the immunosuppressive activities of Etanercept. Approved, Investigational Tafluprost The therapeutic efficacy of Tafluprost can be decreased when used in combination with Etanercept. Approved Talinolol Etanercept may decrease the antihypertensive activities of Talinolol. Investigational Talniflumate The risk or severity of adverse effects can be increased when Talniflumate is combined with Etanercept. Approved Tarenflurbil The risk or severity of adverse effects can be increased when Etanercept is combined with Tarenflurbil. Investigational Tasosartan The risk or severity of adverse effects can be increased when Tasosartan is combined with Etanercept. Approved Tecemotide The risk or severity of adverse effects can be increased when Etanercept is combined with Tecemotide. Investigational Technetium Tc-99m etidronate The risk or severity of adverse effects can be increased when Etanercept is combined with Technetium Tc-99m etidronate. Approved Technetium Tc-99m medronate The risk or severity of adverse effects can be increased when Etanercept is combined with Technetium Tc-99m medronate. Approved Telmisartan The risk or severity of adverse effects can be increased when Telmisartan is combined with Etanercept. Approved, Investigational Temafloxacin Etanercept may increase the neuroexcitatory activities of Temafloxacin. Withdrawn Temocapril The risk or severity of adverse effects can be increased when Etanercept is combined with Temocapril. Experimental, Investigational Tenidap The risk or severity of adverse effects can be increased when Etanercept is combined with Tenidap. Experimental Tenofovir disoproxil The risk or severity of adverse effects can be increased when Etanercept is combined with Tenofovir disoproxil. Approved, Investigational Tenoxicam The risk or severity of adverse effects can be increased when Etanercept is combined with Tenoxicam. Approved Tepoxalin The risk or severity of adverse effects can be increased when Etanercept is combined with Tepoxalin. Vet Approved Teriflunomide The risk or severity of adverse effects can be increased when Etanercept is combined with Teriflunomide. Approved Tertatolol Etanercept may decrease the antihypertensive activities of Tertatolol. Experimental TG4010 The risk or severity of adverse effects can be increased when Etanercept is combined with TG4010. Investigational Tiaprofenic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Tiaprofenic acid. Approved Tiludronic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Tiludronic acid. Approved, Investigational, Vet Approved Timolol Etanercept may decrease the antihypertensive activities of Timolol. Approved Tinoridine The risk or severity of adverse effects can be increased when Etanercept is combined with Tinoridine. Investigational Tixocortol The risk or severity of adverse effects can be increased when Etanercept is combined with Tixocortol. Approved, Withdrawn Tobramycin Etanercept may decrease the excretion rate of Tobramycin which could result in a higher serum level. Approved, Investigational Tocilizumab Tocilizumab may increase the immunosuppressive activities of Etanercept. Approved Tofacitinib The risk or severity of adverse effects can be increased when Etanercept is combined with Tofacitinib. Approved, Investigational Tolfenamic Acid The risk or severity of adverse effects can be increased when Etanercept is combined with Tolfenamic Acid. Approved, Investigational Tolmetin The risk or severity of adverse effects can be increased when Etanercept is combined with Tolmetin. Approved Torasemide The therapeutic efficacy of Torasemide can be decreased when used in combination with Etanercept. Approved Trandolapril The risk or severity of adverse effects can be increased when Etanercept is combined with Trandolapril. Approved Tranilast The risk or severity of adverse effects can be increased when Etanercept is combined with Tranilast. Approved, Investigational Trastuzumab Trastuzumab may increase the neutropenic activities of Etanercept. Approved, Investigational Travoprost The therapeutic efficacy of Travoprost can be decreased when used in combination with Etanercept. Approved Treprostinil The risk or severity of adverse effects can be increased when Treprostinil is combined with Etanercept. Approved, Investigational Triamcinolone The risk or severity of adverse effects can be increased when Etanercept is combined with Triamcinolone. Approved, Vet Approved Triamterene Etanercept may decrease the antihypertensive activities of Triamterene. Approved Tribenoside The risk or severity of adverse effects can be increased when Etanercept is combined with Tribenoside. Experimental Trichlormethiazide The therapeutic efficacy of Trichlormethiazide can be decreased when used in combination with Etanercept. Approved, Vet Approved Triptolide The risk or severity of adverse effects can be increased when Etanercept is combined with Triptolide. Investigational Trovafloxacin Etanercept may increase the neuroexcitatory activities of Trovafloxacin. Approved, Investigational, Withdrawn Troxerutin Etanercept may increase the anticoagulant activities of Troxerutin. Investigational Ulobetasol The risk or severity of adverse effects can be increased when Etanercept is combined with Ulobetasol. Approved Unoprostone The therapeutic efficacy of Unoprostone can be decreased when used in combination with Etanercept. Approved, Investigational Valdecoxib The risk or severity of adverse effects can be increased when Etanercept is combined with Valdecoxib. Approved, Investigational, Withdrawn Valrubicin Etanercept may decrease the excretion rate of Valrubicin which could result in a higher serum level. Approved Valsartan The risk or severity of adverse effects can be increased when Valsartan is combined with Etanercept. Approved, Investigational Vancomycin The serum concentration of Vancomycin can be increased when it is combined with Etanercept. Approved Varicella Zoster Vaccine (Live/Attenuated) The risk or severity of adverse effects can be increased when Etanercept is combined with Varicella Zoster Vaccine (Live/Attenuated). Approved Vedolizumab The risk or severity of infection can be increased when Etanercept is combined with Vedolizumab. Approved Warfarin Etanercept may increase the anticoagulant activities of Warfarin. Approved Ximelagatran Etanercept may increase the anticoagulant activities of Ximelagatran. Approved, Investigational, Withdrawn Yellow Fever Vaccine The risk or severity of adverse effects can be increased when Etanercept is combined with Yellow Fever Vaccine. Approved, Investigational Zaltoprofen The risk or severity of adverse effects can be increased when Etanercept is combined with Zaltoprofen. Approved, Investigational Zileuton The risk or severity of adverse effects can be increased when Etanercept is combined with Zileuton. Approved, Investigational, Withdrawn Zofenopril The risk or severity of adverse effects can be increased when Etanercept is combined with Zofenopril. Experimental Zoledronic acid The risk or severity of adverse effects can be increased when Etanercept is combined with Zoledronic acid. Approved Zomepirac The risk or severity of adverse effects can be increased when Etanercept is combined with Zomepirac. Withdrawn Zoptarelin doxorubicin Etanercept may decrease the excretion rate of Zoptarelin doxorubicin which could result in a higher serum level. Investigational Zorubicin Etanercept may decrease the excretion rate of Zorubicin which could result in a higher serum level. Experimental - Food Interactions
- Not Available
References
- Synthesis Reference
Timothy D. Osslund, Christi L. Clogston, Shon Lee Crampton, Randal B. Bass, "Crystals of etanercept and methods of making thereof." U.S. Patent US07276477, issued October 02, 2007.
US07276477- General References
- External Links
- UniProt
- P20333
- Genbank
- M32315
- KEGG Drug
- D00742
- KEGG Compound
- C07897
- PubChem Substance
- 46506732
- ChEMBL
- CHEMBL1201572
- Therapeutic Targets Database
- DNC000605
- PharmGKB
- PA449515
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Etanercept
- ATC Codes
- L04AB01 — Etanercept
- AHFS Codes
- 92:36.00 — Disease-modifying Antirheumatic Agents
Clinical Trials
- Clinical Trials
Pharmacoeconomics
- Manufacturers
- Amgen Inc. + Wyeth + Takeda
- Packagers
- Amgen Inc.
- Boehringer Ingelheim Ltd.
- DSM Corp.
- Immunex Corp.
- Physicians Total Care Inc.
- Vetter Pharma Fertigung GmbH and Co. KG
- Dosage forms
Form Route Strength Injection, powder, for solution Subcutaneous 10 mg Injection, powder, for solution Subcutaneous 25 mg Injection, powder, for solution Subcutaneous 50 mg Injection, solution Subcutaneous 25 mg Injection, solution Subcutaneous 50 mg Kit Kit; liquid; powder, for solution Subcutaneous Solution Subcutaneous 25 mg/.5mL Solution Subcutaneous 50 mg Solution Subcutaneous 50 mg/mL Solution Subcutaneous 25 mg - Prices
Unit description Cost Unit Enbrel (1 Box = 1 Kit = Four 50 mg Syringes) 3.92ml Box 2033.14USD box Enbrel SureClick (1 Box Contains Four 50 mg Prefilled Autoinjectors) 2033.14USD box Enbrel 4 25 mg Kit (1 Box = 1 Kit = Four 25 mg Vials) 1016.57USD box Enbrel 50 mg/ml sureclick syr 488.74USD syringe Enbrel 25 mg kit 250.37USD each DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
Patent Number Pediatric Extension Approved Expires (estimated) CA2476934 No 2009-06-16 2023-02-27 Canada CA2123593 No 2000-03-14 2013-09-14 Canada US7276477 No 2007-10-02 2024-07-29 US US36755 No 2000-06-27 2012-10-23 US
Properties
- State
- Liquid
- Experimental Properties
Property Value Source melting point (°C) 71 °C (whole mAb) Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000) hydrophobicity -0.529 Not Available isoelectric point 7.89 Not Available
Taxonomy
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Targets
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Yes
- Actions
- Antibody
- General Function
- Tumor necrosis factor receptor binding
- Specific Function
- Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct ac...
- Gene Name
- TNF
- Uniprot ID
- P01375
- Uniprot Name
- Tumor necrosis factor
- Molecular Weight
- 25644.15 Da
References
- Park YC, Burkitt V, Villa AR, Tong L, Wu H: Structural basis for self-association and receptor recognition of human TRAF2. Nature. 1999 Apr 8;398(6727):533-8. [PubMed:10206649]
- Sandborn WJ, Hanauer SB: Antitumor necrosis factor therapy for inflammatory bowel disease: a review of agents, pharmacology, clinical results, and safety. Inflamm Bowel Dis. 1999 May;5(2):119-33. [PubMed:10338381]
- Grell M, Zimmermann G, Gottfried E, Chen CM, Grunwald U, Huang DC, Wu Lee YH, Durkop H, Engelmann H, Scheurich P, Wajant H, Strasser A: Induction of cell death by tumour necrosis factor (TNF) receptor 2, CD40 and CD30: a role for TNF-R1 activation by endogenous membrane-anchored TNF. EMBO J. 1999 Jun 1;18(11):3034-43. [PubMed:10357816]
- Moreland LW: Inhibitors of tumor necrosis factor: new treatment options for rheumatoid arthritis. Cleve Clin J Med. 1999 Jun;66(6):367-74. [PubMed:10375846]
- Calabrese LH: Rheumatoid arthritis and primary care: the case for early diagnosis and treatment. J Am Osteopath Assoc. 1999 Jun;99(6):313-21. [PubMed:10405518]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Ubiquitin protein ligase binding
- Specific Function
- Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 ...
- Gene Name
- TNFRSF1B
- Uniprot ID
- P20333
- Uniprot Name
- Tumor necrosis factor receptor superfamily member 1B
- Molecular Weight
- 48290.85 Da
References
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Receptor signaling protein activity
- Specific Function
- High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
- Gene Name
- FCGR1A
- Uniprot ID
- P12314
- Uniprot Name
- High affinity immunoglobulin gamma Fc receptor I
- Molecular Weight
- 42631.525 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Not Available
- Specific Function
- Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
- Gene Name
- FCGR3A
- Uniprot ID
- P08637
- Uniprot Name
- Low affinity immunoglobulin gamma Fc region receptor III-A
- Molecular Weight
- 29088.895 Da
References
- Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442]
- Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Not Available
- Specific Function
- Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
- Gene Name
- FCGR2A
- Uniprot ID
- P12318
- Uniprot Name
- Low affinity immunoglobulin gamma Fc region receptor II-a
- Molecular Weight
- 35000.42 Da
References
- Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442]
- Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Not Available
- Specific Function
- Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
- Gene Name
- FCGR2B
- Uniprot ID
- P31994
- Uniprot Name
- Low affinity immunoglobulin gamma Fc region receptor II-b
- Molecular Weight
- 34043.355 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Transmembrane signaling receptor activity
- Specific Function
- Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
- Gene Name
- FCGR2C
- Uniprot ID
- P31995
- Uniprot Name
- Low affinity immunoglobulin gamma Fc region receptor II-c
- Molecular Weight
- 35577.96 Da
References
- Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083]
- Ranheim EA, Kipps TJ: Tumor necrosis factor-alpha facilitates induction of CD80 (B7-1) and CD54 on human B cells by activated T cells: complex regulation by IL-4, IL-10, and CD40L. Cell Immunol. 1995 Apr 1;161(2):226-35. [PubMed:7535196]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Receptor binding
- Specific Function
- Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes a...
- Gene Name
- LTA
- Uniprot ID
- P01374
- Uniprot Name
- Lymphotoxin-alpha
- Molecular Weight
- 22296.57 Da
References
- Johnson CJ, Reilly KM, Murray KM: Etanercept in juvenile rheumatoid arthritis. Ann Pharmacother. 2001 Apr;35(4):464-71. [PubMed:11302411]
- Pennica D, Lam VT, Mize NK, Weber RF, Lewis M, Fendly BM, Lipari MT, Goeddel DV: Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation. J Biol Chem. 1992 Oct 15;267(29):21172-8. [PubMed:1328224]
- Gudbrandsdottir S, Larsen R, Sorensen LK, Nielsen S, Hansen MB, Svenson M, Bendtzen K, Muller K: TNF and LT binding capacities in the plasma of arthritis patients: effect of etanercept treatment in juvenile idiopathic arthritis. Clin Exp Rheumatol. 2004 Jan-Feb;22(1):118-24. [PubMed:15005015]
- Buch MH, Conaghan PG, Quinn MA, Bingham SJ, Veale D, Emery P: True infliximab resistance in rheumatoid arthritis: a role for lymphotoxin alpha? Ann Rheum Dis. 2004 Oct;63(10):1344-6. Epub 2004 Mar 19. [PubMed:15033655]
- Kang CP, Lee KW, Yoo DH, Kang C, Bae SC: The influence of a polymorphism at position -857 of the tumour necrosis factor alpha gene on clinical response to etanercept therapy in rheumatoid arthritis. Rheumatology (Oxford). 2005 Apr;44(4):547-52. Epub 2005 Feb 3. [PubMed:15695296]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Not Available
- Specific Function
- Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
- Gene Name
- FCGR3B
- Uniprot ID
- O75015
- Uniprot Name
- Low affinity immunoglobulin gamma Fc region receptor III-B
- Molecular Weight
- 26215.64 Da
References
- Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083]
- Ozgocmen S, Godekmerdan A, Ozkurt-Zengin F: Acute-phase response, clinical measures and disease activity in ankylosing spondylitis. Joint Bone Spine. 2007 May;74(3):249-53. Epub 2007 Mar 5. [PubMed:17387033]
- Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442]
- Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Serine-type endopeptidase activity
- Specific Function
- C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
- Gene Name
- C1S
- Uniprot ID
- P09871
- Uniprot Name
- Complement C1s subcomponent
- Molecular Weight
- 76683.905 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Serine-type peptidase activity
- Specific Function
- C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
- Gene Name
- C1R
- Uniprot ID
- P00736
- Uniprot Name
- Complement C1r subcomponent
- Molecular Weight
- 80118.04 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Not Available
- Specific Function
- C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
- Gene Name
- C1QA
- Uniprot ID
- P02745
- Uniprot Name
- Complement C1q subcomponent subunit A
- Molecular Weight
- 26016.47 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Not Available
- Specific Function
- C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
- Gene Name
- C1QB
- Uniprot ID
- P02746
- Uniprot Name
- Complement C1q subcomponent subunit B
- Molecular Weight
- 26721.62 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Not Available
- Specific Function
- C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
- Gene Name
- C1QC
- Uniprot ID
- P02747
- Uniprot Name
- Complement C1q subcomponent subunit C
- Molecular Weight
- 25773.56 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Enzymes
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- Actions
- Inhibitor
- General Function
- Prostaglandin-endoperoxide synthase activity
- Specific Function
- Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and...
- Gene Name
- PTGS2
- Uniprot ID
- P35354
- Uniprot Name
- Prostaglandin G/H synthase 2
- Molecular Weight
- 68995.625 Da
References
- Bawolak MT, Touzin K, Moreau ME, Desormeaux A, Adam A, Marceau F: Cardiovascular expression of inflammatory signaling molecules, the kinin B1 receptor and COX2, in the rabbit: effects of LPS, anti-inflammatory and anti-hypertensive drugs. Regul Pept. 2008 Feb 7;146(1-3):157-68. Epub 2007 Sep 14. [PubMed:17931716]
- Genovese T, Mazzon E, Crisafulli C, Di Paola R, Muia C, Bramanti P, Cuzzocrea S: Immunomodulatory effects of etanercept in an experimental model of spinal cord injury. J Pharmacol Exp Ther. 2006 Mar;316(3):1006-16. Epub 2005 Nov 22. [PubMed:16303916]
Drug created on June 13, 2005 07:24 / Updated on May 21, 2018 17:38