You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameEtanercept
Accession NumberDB00005  (BTD00052, BIOD00052)
TypeBiotech
GroupsApproved, Investigational
DescriptionDimeric fusion protein consisting of the extracellular ligand-binding portion of the human 75 kilodalton (p75) tumor necrosis factor receptor (TNFR) linked to the Fc portion of human IgG1. The Fc component of etanercept contains the CH2 domain, the CH3 domain and hinge region, but not the CH1 domain of IgG1. Etanercept is produced by recombinant DNA technology in a Chinese hamster ovary (CHO) mammalian cell expression system. It consists of 934 amino acids
Protein structureDb00005
Related Articles
Protein chemical formulaC2224H3475N621O698S36
Protein average weight51234.9 Da
Sequences
> Etanercept Sequence
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST
YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK
CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS
TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDEPKSC
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
CD120b
p75
p80 TNF-alpha receptor
TNF-R2
Tumor necrosis factor receptor 2
Tumor necrosis factor receptor superfamily member 1B precursor
Tumor necrosis factor receptor type II
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
BrenzysSolution50 mgSubcutaneousSamsung Bioepis Co., Ltd2016-09-23Not applicableCanada
BrenzysSolution50 mgSubcutaneousSamsung Bioepis Co., Ltd2016-09-13Not applicableCanada
EnbrelInjection, powder, for solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelSolution50 mgSubcutaneousImmunex Corporation2005-12-21Not applicableCanada
EnbrelInjection, solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelSolution50 mg/mLSubcutaneousImmunex Corporation2005-11-10Not applicableUs
EnbrelInjection, powder, for solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, powder, for solution25 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, powder, for solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, powder, for solution25 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelSolution25 mg/.5mLSubcutaneousImmunex Corporation2005-11-10Not applicableUs
EnbrelInjection, solution25 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, powder, for solution25 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, powder, for solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelKitImmunex Corporation2003-01-02Not applicableUs
EnbrelInjection, powder, for solution25 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, solution25 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, powder, for solution10 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, powder, for solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, powder, for solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelSolution50 mg/mLSubcutaneousImmunex Corporation2005-10-06Not applicableUs
EnbrelInjection, powder, for solution25 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, solution50 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
EnbrelInjection, solution25 mgSubcutaneousPfizer Limited2000-02-03Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
Enbrel SureclickNot Available
Brand mixtures
NameLabellerIngredients
EnbrelImmunex Corporation
SaltsNot Available
Categories
UNIIOP401G7OJC
CAS number185243-69-0
Pharmacology
IndicationFor treatment of severe active rheumatoid arthritis in adults, severe juvenile idiopathic arthritis, ankylosing spondylitis, and severe plaque psoriasis.
Structured Indications
PharmacodynamicsTumor necrosis factor TNF is a naturally occurring cytokine that is involved in normal inflammatory and immune responses. Elevated levels of TNF are found in tissues and fluids of patients with rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis (AS), and plaque psoriasis. Etanercept binds specifically to tumor necrosis factor (TNF) and blocks its interaction with cell surface TNF receptors.
Mechanism of actionThere are two distinct receptors for TNF (TNFRs), a 55 kilodalton protein (p55) and a 75 kilodalton protein (p75). The biological activity of TNF is dependent upon binding to either cell surface receptor (p75 or p55). Etanercept is a dimeric soluble form of the p75 TNF receptor that can bind to two TNF molecules, thereby effectively removing them from circulation.
TargetKindPharmacological actionActionsOrganismUniProt ID
Tumor necrosis factorProteinyes
antibody
HumanP01375 details
Tumor necrosis factor receptor superfamily member 1BProteinunknownNot AvailableHumanP20333 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Lymphotoxin-alphaProteinunknownNot AvailableHumanP01374 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1s subcomponentProteinunknownNot AvailableHumanP09871 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Related Articles
AbsorptionBioavailability following sub-Q administration is approximately 60%. Peak plasma concentrations achieved within 69 hours.
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half life102 +/- 30 hrs in individuals with rheumatoid arthritis and 68 hours in healthy adults
Clearance
  • 160 +/- 80 mL/hr [RA patients]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
16-BromoepiandrosteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with 16-Bromoepiandrosterone.Investigational
19-norandrostenedioneThe risk or severity of adverse effects can be increased when Etanercept is combined with 19-norandrostenedione.Experimental, Illicit
4-AndrostenedioneThe risk or severity of adverse effects can be increased when Etanercept is combined with 4-Androstenedione.Experimental, Illicit
5-androstenedioneThe risk or severity of adverse effects can be increased when Etanercept is combined with 5-androstenedione.Experimental, Illicit
AbataceptThe risk or severity of adverse effects can be increased when Etanercept is combined with Abatacept.Approved
AbciximabEtanercept may increase the anticoagulant activities of Abciximab.Approved
AcebutololEtanercept may decrease the antihypertensive activities of Acebutolol.Approved
AceclofenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Aceclofenac.Approved
AcenocoumarolEtanercept may increase the anticoagulant activities of Acenocoumarol.Approved
AcetovanilloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Acetovanillone.Investigational
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Acetylsalicylic acid.Approved, Vet Approved
AclarubicinEtanercept may decrease the excretion rate of Aclarubicin which could result in a higher serum level.Investigational
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Etanercept.Approved
AdapaleneThe risk or severity of adverse effects can be increased when Etanercept is combined with Adapalene.Approved
AlclometasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Alclometasone.Approved
AldosteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Aldosterone.Experimental
Alendronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Alendronic acid.Approved
AliskirenEtanercept may decrease the antihypertensive activities of Aliskiren.Approved, Investigational
AlprenololEtanercept may decrease the antihypertensive activities of Alprenolol.Approved, Withdrawn
AlprostadilThe therapeutic efficacy of Alprostadil can be decreased when used in combination with Etanercept.Approved, Investigational
ALT-110The risk or severity of adverse effects can be increased when Etanercept is combined with ALT-110.Investigational
AmcinonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Amcinonide.Approved
AmikacinEtanercept may decrease the excretion rate of Amikacin which could result in a higher serum level.Approved, Vet Approved
AmilorideEtanercept may decrease the antihypertensive activities of Amiloride.Approved
AmrubicinEtanercept may decrease the excretion rate of Amrubicin which could result in a higher serum level.Approved, Investigational
AnakinraThe risk or severity of adverse effects can be increased when Etanercept is combined with Anakinra.Approved
AncrodEtanercept may increase the anticoagulant activities of Ancrod.Investigational
AnecortaveThe risk or severity of adverse effects can be increased when Etanercept is combined with Anecortave.Investigational
AnisodamineThe risk or severity of adverse effects can be increased when Etanercept is combined with Anisodamine.Investigational
annamycinEtanercept may decrease the excretion rate of annamycin which could result in a higher serum level.Investigational
AntipyrineThe risk or severity of adverse effects can be increased when Etanercept is combined with Antipyrine.Approved
Antithrombin III humanEtanercept may increase the anticoagulant activities of Antithrombin III human.Approved
Aop200704Etanercept may decrease the antihypertensive activities of Aop200704.Investigational
ApixabanEtanercept may increase the anticoagulant activities of Apixaban.Approved
ApramycinEtanercept may decrease the excretion rate of Apramycin which could result in a higher serum level.Experimental, Vet Approved
ApremilastThe risk or severity of adverse effects can be increased when Etanercept is combined with Apremilast.Approved, Investigational
ArbekacinEtanercept may decrease the excretion rate of Arbekacin which could result in a higher serum level.Approved
ArdeparinEtanercept may increase the anticoagulant activities of Ardeparin.Approved, Withdrawn
ArgatrobanEtanercept may increase the anticoagulant activities of Argatroban.Approved, Investigational
ArotinololEtanercept may decrease the antihypertensive activities of Arotinolol.Approved
AtenololEtanercept may decrease the antihypertensive activities of Atenolol.Approved
AzapropazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Azapropazone.Withdrawn
AzelastineThe risk or severity of adverse effects can be increased when Etanercept is combined with Azelastine.Approved
Azilsartan medoxomilThe risk or severity of adverse effects can be increased when Azilsartan medoxomil is combined with Etanercept.Approved
BalsalazideEtanercept may increase the nephrotoxic activities of Balsalazide.Approved, Investigational
BcgThe therapeutic efficacy of Bcg can be decreased when used in combination with Etanercept.Investigational
BecaplerminEtanercept may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BeclomethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Beclomethasone.Investigational
Beclomethasone dipropionateThe risk or severity of adverse effects can be increased when Etanercept is combined with Beclomethasone dipropionate.Approved, Investigational
BefunololEtanercept may decrease the antihypertensive activities of Befunolol.Experimental
BelimumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Belimumab.Approved
BenazeprilThe risk or severity of adverse effects can be increased when Benazepril is combined with Etanercept.Approved, Investigational
BendroflumethiazideThe therapeutic efficacy of Bendroflumethiazide can be decreased when used in combination with Etanercept.Approved
BenoxaprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Benoxaprofen.Withdrawn
BeraprostThe therapeutic efficacy of Beraprost can be decreased when used in combination with Etanercept.Investigational
BetamethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Betamethasone.Approved, Vet Approved
BetaxololEtanercept may decrease the antihypertensive activities of Betaxolol.Approved
Betulinic AcidThe risk or severity of adverse effects can be increased when Etanercept is combined with Betulinic Acid.Investigational
BevantololEtanercept may decrease the antihypertensive activities of Bevantolol.Approved
BimatoprostThe therapeutic efficacy of Bimatoprost can be decreased when used in combination with Etanercept.Approved, Investigational
BisoprololEtanercept may decrease the antihypertensive activities of Bisoprolol.Approved
BivalirudinEtanercept may increase the anticoagulant activities of Bivalirudin.Approved, Investigational
BopindololEtanercept may decrease the antihypertensive activities of Bopindolol.Approved
BromfenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Bromfenac.Approved
BucillamineThe risk or severity of adverse effects can be increased when Etanercept is combined with Bucillamine.Investigational
BucindololEtanercept may decrease the antihypertensive activities of Bucindolol.Investigational
BudesonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Budesonide.Approved
BufuralolEtanercept may decrease the antihypertensive activities of Bufuralol.Experimental, Investigational
BumetanideEtanercept may decrease the diuretic activities of Bumetanide.Approved
BupranololEtanercept may decrease the antihypertensive activities of Bupranolol.Approved
CanakinumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Canakinumab.Approved, Investigational
CandesartanThe risk or severity of adverse effects can be increased when Candesartan is combined with Etanercept.Approved
CandoxatrilThe risk or severity of adverse effects can be increased when Candoxatril is combined with Etanercept.Experimental
CaptoprilThe risk or severity of adverse effects can be increased when Captopril is combined with Etanercept.Approved
Carboprost TromethamineThe therapeutic efficacy of Carboprost Tromethamine can be decreased when used in combination with Etanercept.Approved
CarprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Carprofen.Approved, Vet Approved, Withdrawn
CarteololEtanercept may decrease the antihypertensive activities of Carteolol.Approved
CarvedilolEtanercept may decrease the antihypertensive activities of Carvedilol.Approved, Investigational
CastanospermineThe risk or severity of adverse effects can be increased when Etanercept is combined with Castanospermine.Experimental
CDX-110The risk or severity of adverse effects can be increased when Etanercept is combined with CDX-110.Investigational
CelecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Celecoxib.Approved, Investigational
CeliprololEtanercept may decrease the antihypertensive activities of Celiprolol.Approved, Investigational
Certolizumab pegolEtanercept may increase the immunosuppressive activities of Certolizumab pegol.Approved
CertoparinEtanercept may increase the anticoagulant activities of Certoparin.Approved
ChloroquineThe risk or severity of adverse effects can be increased when Etanercept is combined with Chloroquine.Approved, Vet Approved
ChlorothiazideThe therapeutic efficacy of Chlorothiazide can be decreased when used in combination with Etanercept.Approved, Vet Approved
ChlorthalidoneThe therapeutic efficacy of Chlorthalidone can be decreased when used in combination with Etanercept.Approved
CholestyramineCholestyramine can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
CiclesonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Ciclesonide.Approved, Investigational
CilazaprilThe risk or severity of adverse effects can be increased when Cilazapril is combined with Etanercept.Approved
CinoxacinEtanercept may increase the neuroexcitatory activities of Cinoxacin.Approved, Withdrawn
CiprofloxacinEtanercept may increase the neuroexcitatory activities of Ciprofloxacin.Approved, Investigational
Citric AcidEtanercept may increase the anticoagulant activities of Citric Acid.Nutraceutical, Vet Approved
ClobetasolThe risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasol.Investigational
Clobetasol propionateThe risk or severity of adverse effects can be increased when Etanercept is combined with Clobetasol propionate.Approved
ClocortoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Clocortolone.Approved
ClodronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Clodronate.Approved, Investigational, Vet Approved
ClonixinThe risk or severity of adverse effects can be increased when Etanercept is combined with Clonixin.Approved
CloprostenolThe therapeutic efficacy of Cloprostenol can be decreased when used in combination with Etanercept.Vet Approved
ColesevelamColesevelam can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
ColestipolColestipol can cause a decrease in the absorption of Etanercept resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
Cortisone acetateThe risk or severity of adverse effects can be increased when Etanercept is combined with Cortisone acetate.Approved
CurcuminThe risk or severity of adverse effects can be increased when Etanercept is combined with Curcumin.Investigational
CyclophosphamideThe risk or severity of adverse effects can be increased when Etanercept is combined with Cyclophosphamide.Approved, Investigational
CyclosporineEtanercept may increase the nephrotoxic activities of Cyclosporine.Approved, Investigational, Vet Approved
D-LimoneneThe risk or severity of adverse effects can be increased when Etanercept is combined with D-Limonene.Investigational
Dabigatran etexilateEtanercept may increase the anticoagulant activities of Dabigatran etexilate.Approved
DalteparinEtanercept may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidEtanercept may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DaunorubicinEtanercept may decrease the excretion rate of Daunorubicin which could result in a higher serum level.Approved
DeferasiroxThe risk or severity of adverse effects can be increased when Etanercept is combined with Deferasirox.Approved, Investigational
dehydroepiandrosterone sulfateThe risk or severity of adverse effects can be increased when Etanercept is combined with dehydroepiandrosterone sulfate.Investigational
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Etanercept.Approved
DesirudinEtanercept may increase the anticoagulant activities of Desirudin.Approved
DesmopressinThe risk or severity of adverse effects can be increased when Etanercept is combined with Desmopressin.Approved
DesoximetasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Desoximetasone.Approved
Desoxycorticosterone acetateThe risk or severity of adverse effects can be increased when Etanercept is combined with Desoxycorticosterone acetate.Approved
Desoxycorticosterone PivalateThe risk or severity of adverse effects can be increased when Etanercept is combined with Desoxycorticosterone Pivalate.Experimental, Vet Approved
DexamethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Dexamethasone.Approved, Investigational, Vet Approved
Dexamethasone isonicotinateThe risk or severity of adverse effects can be increased when Etanercept is combined with Dexamethasone isonicotinate.Vet Approved
DexketoprofenThe risk or severity of adverse effects can be increased when Dexketoprofen is combined with Etanercept.Approved
DextranEtanercept may increase the anticoagulant activities of Dextran.Approved, Vet Approved
Dextran 40Etanercept may increase the anticoagulant activities of Dextran 40.Approved
Dextran 70Etanercept may increase the anticoagulant activities of Dextran 70.Approved
Dextran 75Etanercept may increase the anticoagulant activities of Dextran 75.Approved
DiclofenacThe risk or severity of adverse effects can be increased when Diclofenac is combined with Etanercept.Approved, Vet Approved
DicoumarolEtanercept may increase the anticoagulant activities of Dicoumarol.Approved
DiflorasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Diflorasone.Approved
DiflunisalThe risk or severity of adverse effects can be increased when Etanercept is combined with Diflunisal.Approved
DifluocortoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Difluocortolone.Approved
DifluprednateThe risk or severity of adverse effects can be increased when Etanercept is combined with Difluprednate.Approved
DigoxinThe serum concentration of Digoxin can be increased when it is combined with Etanercept.Approved
DihydrostreptomycinEtanercept may decrease the excretion rate of Dihydrostreptomycin which could result in a higher serum level.Vet Approved
DinoprostThe therapeutic efficacy of Dinoprost can be decreased when used in combination with Etanercept.Investigational
Dinoprost TromethamineThe therapeutic efficacy of Dinoprost Tromethamine can be decreased when used in combination with Etanercept.Approved, Vet Approved
DinoprostoneThe therapeutic efficacy of Dinoprostone can be decreased when used in combination with Etanercept.Approved
DoxorubicinEtanercept may decrease the excretion rate of Doxorubicin which could result in a higher serum level.Approved, Investigational
DrospirenoneEtanercept may increase the hyperkalemic activities of Drospirenone.Approved
DroxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Droxicam.Approved
DuvelisibThe risk or severity of adverse effects can be increased when Etanercept is combined with Duvelisib.Investigational
E6201The risk or severity of adverse effects can be increased when Etanercept is combined with E6201.Investigational
EbselenThe risk or severity of adverse effects can be increased when Etanercept is combined with Ebselen.Investigational
Edetic AcidEtanercept may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanEtanercept may increase the anticoagulant activities of Edoxaban.Approved
EnalaprilThe risk or severity of adverse effects can be increased when Enalapril is combined with Etanercept.Approved, Vet Approved
EnalaprilatThe risk or severity of adverse effects can be increased when Enalaprilat is combined with Etanercept.Approved
EnoxacinEtanercept may increase the neuroexcitatory activities of Enoxacin.Approved
EnoxaparinEtanercept may increase the anticoagulant activities of Enoxaparin.Approved
EpirizoleThe risk or severity of adverse effects can be increased when Etanercept is combined with Epirizole.Approved
EpirubicinEtanercept may decrease the excretion rate of Epirubicin which could result in a higher serum level.Approved
EplerenoneEtanercept may decrease the antihypertensive activities of Eplerenone.Approved
EpoprostenolThe therapeutic efficacy of Epoprostenol can be decreased when used in combination with Etanercept.Approved
EprosartanThe risk or severity of adverse effects can be increased when Eprosartan is combined with Etanercept.Approved
EquileninThe risk or severity of adverse effects can be increased when Etanercept is combined with Equilenin.Experimental
EquilinThe risk or severity of adverse effects can be increased when Etanercept is combined with Equilin.Approved
EsmololEtanercept may decrease the antihypertensive activities of Esmolol.Approved
EstroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Estrone.Approved
Estrone sulfateThe risk or severity of adverse effects can be increased when Etanercept is combined with Estrone sulfate.Approved
Etacrynic acidEtanercept may decrease the diuretic activities of Etacrynic acid.Approved
Ethyl biscoumacetateEtanercept may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
Etidronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Etidronic acid.Approved
EtodolacThe risk or severity of adverse effects can be increased when Etanercept is combined with Etodolac.Approved, Investigational, Vet Approved
EtofenamateThe risk or severity of adverse effects can be increased when Etanercept is combined with Etofenamate.Approved
EtoricoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Etoricoxib.Approved, Investigational
Evening primrose oilThe risk or severity of adverse effects can be increased when Etanercept is combined with Evening primrose oil.Approved
exisulindThe risk or severity of adverse effects can be increased when Etanercept is combined with exisulind.Investigational
FenbufenThe risk or severity of adverse effects can be increased when Etanercept is combined with Fenbufen.Approved
FenoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Fenoprofen.Approved
FenprostaleneThe therapeutic efficacy of Fenprostalene can be decreased when used in combination with Etanercept.Vet Approved
FingolimodEtanercept may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
FleroxacinEtanercept may increase the neuroexcitatory activities of Fleroxacin.Approved
FloctafenineThe risk or severity of adverse effects can be increased when Floctafenine is combined with Etanercept.Approved, Withdrawn
fluasteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with fluasterone.Investigational
FludrocortisoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fludrocortisone.Approved
FluindioneEtanercept may increase the anticoagulant activities of Fluindione.Investigational
FlumequineEtanercept may increase the neuroexcitatory activities of Flumequine.Withdrawn
FlumethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Flumethasone.Approved, Vet Approved
FlunisolideThe risk or severity of adverse effects can be increased when Etanercept is combined with Flunisolide.Approved, Investigational
FlunixinThe risk or severity of adverse effects can be increased when Etanercept is combined with Flunixin.Vet Approved
Fluocinolone AcetonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluocinolone Acetonide.Approved, Investigational, Vet Approved
FluocinonideThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluocinonide.Approved, Investigational
FluocortoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluocortolone.Approved, Withdrawn
FluorometholoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluorometholone.Approved
FluprednideneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluprednidene.Approved, Withdrawn
FluprednisoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluprednisolone.Approved
FluprostenolThe therapeutic efficacy of Fluprostenol can be decreased when used in combination with Etanercept.Vet Approved
FlurandrenolideThe risk or severity of adverse effects can be increased when Etanercept is combined with Flurandrenolide.Approved
FlurbiprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Flurbiprofen.Approved, Investigational
Fluticasone furoateThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluticasone furoate.Approved
Fluticasone PropionateThe risk or severity of adverse effects can be increased when Etanercept is combined with Fluticasone Propionate.Approved
Folic AcidThe therapeutic efficacy of Folic Acid can be decreased when used in combination with Etanercept.Approved, Nutraceutical, Vet Approved
FondaparinuxEtanercept may increase the anticoagulant activities of Fondaparinux.Investigational
Fondaparinux sodiumEtanercept may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
ForasartanThe risk or severity of adverse effects can be increased when Forasartan is combined with Etanercept.Experimental
FormestaneThe risk or severity of adverse effects can be increased when Etanercept is combined with Formestane.Approved, Investigational, Withdrawn
FosinoprilThe risk or severity of adverse effects can be increased when Fosinopril is combined with Etanercept.Approved
FramycetinEtanercept may decrease the excretion rate of Framycetin which could result in a higher serum level.Approved
FurosemideEtanercept may decrease the diuretic activities of Furosemide.Approved, Vet Approved
G17DTThe risk or severity of adverse effects can be increased when Etanercept is combined with G17DT.Investigational
GabexateEtanercept may increase the anticoagulant activities of Gabexate.Investigational
GarenoxacinEtanercept may increase the neuroexcitatory activities of Garenoxacin.Investigational
GatifloxacinEtanercept may increase the neuroexcitatory activities of Gatifloxacin.Approved, Investigational
GemeprostThe therapeutic efficacy of Gemeprost can be decreased when used in combination with Etanercept.Approved, Withdrawn
GemifloxacinEtanercept may increase the neuroexcitatory activities of Gemifloxacin.Approved, Investigational
GeneticinEtanercept may decrease the excretion rate of Geneticin which could result in a higher serum level.Experimental
GentamicinEtanercept may decrease the excretion rate of Gentamicin which could result in a higher serum level.Approved, Vet Approved
GENTAMICIN C1AEtanercept may decrease the excretion rate of GENTAMICIN C1A which could result in a higher serum level.Experimental
GI-5005The risk or severity of adverse effects can be increased when Etanercept is combined with GI-5005.Investigational
GolimumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Golimumab.Approved
GrepafloxacinEtanercept may increase the neuroexcitatory activities of Grepafloxacin.Withdrawn
HaloperidolThe risk or severity of adverse effects can be increased when Etanercept is combined with Haloperidol.Approved
HE3286The risk or severity of adverse effects can be increased when Etanercept is combined with HE3286.Investigational
HeparinEtanercept may increase the anticoagulant activities of Heparin.Approved, Investigational
HigenamineThe risk or severity of adverse effects can be increased when Etanercept is combined with Higenamine.Investigational
HirulogEtanercept may increase the anticoagulant activities of Hirulog.Experimental
HMPL-004The risk or severity of adverse effects can be increased when Etanercept is combined with HMPL-004.Investigational
HydralazineEtanercept may decrease the antihypertensive activities of Hydralazine.Approved
HydrochlorothiazideThe therapeutic efficacy of Hydrochlorothiazide can be decreased when used in combination with Etanercept.Approved, Vet Approved
HydrocortisoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Hydroflumethiazide can be decreased when used in combination with Etanercept.Approved
Hygromycin BEtanercept may decrease the excretion rate of Hygromycin B which could result in a higher serum level.Vet Approved
IbandronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibandronate.Approved, Investigational
IbuprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibuprofen.Approved
IbuproxamThe risk or severity of adverse effects can be increased when Etanercept is combined with Ibuproxam.Withdrawn
IcatibantThe risk or severity of adverse effects can be increased when Etanercept is combined with Icatibant.Approved
IdarubicinEtanercept may decrease the excretion rate of Idarubicin which could result in a higher serum level.Approved
idraparinuxEtanercept may increase the anticoagulant activities of idraparinux.Investigational
IloprostThe therapeutic efficacy of Iloprost can be decreased when used in combination with Etanercept.Approved, Investigational
ImidaprilThe risk or severity of adverse effects can be increased when Imidapril is combined with Etanercept.Investigational
IndapamideThe therapeutic efficacy of Indapamide can be decreased when used in combination with Etanercept.Approved
IndenololEtanercept may decrease the antihypertensive activities of Indenolol.Withdrawn
IndomethacinThe risk or severity of adverse effects can be increased when Etanercept is combined with Indomethacin.Approved, Investigational
IndoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Indoprofen.Withdrawn
InfliximabEtanercept may increase the immunosuppressive activities of Infliximab.Approved
INGN 201The risk or severity of adverse effects can be increased when Etanercept is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Etanercept is combined with INGN 225.Investigational
INNO-206Etanercept may decrease the excretion rate of INNO-206 which could result in a higher serum level.Investigational
IrbesartanThe risk or severity of adverse effects can be increased when Irbesartan is combined with Etanercept.Approved, Investigational
IsoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Isoxicam.Withdrawn
IstaroximeThe risk or severity of adverse effects can be increased when Etanercept is combined with Istaroxime.Investigational
KanamycinEtanercept may decrease the excretion rate of Kanamycin which could result in a higher serum level.Approved, Vet Approved
KebuzoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Kebuzone.Experimental
KetoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Ketoprofen.Approved, Vet Approved
KetorolacThe risk or severity of adverse effects can be increased when Ketorolac is combined with Etanercept.Approved
LabetalolEtanercept may decrease the antihypertensive activities of Labetalol.Approved
LatanoprostThe therapeutic efficacy of Latanoprost can be decreased when used in combination with Etanercept.Approved, Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Etanercept is combined with Leflunomide.Approved, Investigational
LepirudinEtanercept may increase the anticoagulant activities of Lepirudin.Approved
LevobunololEtanercept may decrease the antihypertensive activities of Levobunolol.Approved
LevofloxacinEtanercept may increase the neuroexcitatory activities of Levofloxacin.Approved, Investigational
LimaprostThe therapeutic efficacy of Limaprost can be decreased when used in combination with Etanercept.Approved
LisinoprilThe risk or severity of adverse effects can be increased when Lisinopril is combined with Etanercept.Approved, Investigational
LisofyllineThe risk or severity of adverse effects can be increased when Etanercept is combined with Lisofylline.Investigational
LithiumThe serum concentration of Lithium can be increased when it is combined with Etanercept.Approved
LomefloxacinEtanercept may increase the neuroexcitatory activities of Lomefloxacin.Approved
LornoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Lornoxicam.Approved
LosartanThe risk or severity of adverse effects can be increased when Losartan is combined with Etanercept.Approved
LoxoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Loxoprofen.Approved
LubiprostoneThe therapeutic efficacy of Lubiprostone can be decreased when used in combination with Etanercept.Approved, Investigational
LumiracoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Lumiracoxib.Approved, Investigational
LuprostiolThe therapeutic efficacy of Luprostiol can be decreased when used in combination with Etanercept.Vet Approved
Magnesium salicylateThe risk or severity of adverse effects can be increased when Etanercept is combined with Magnesium salicylate.Approved
MasoprocolThe risk or severity of adverse effects can be increased when Etanercept is combined with Masoprocol.Approved
ME-609The risk or severity of adverse effects can be increased when Etanercept is combined with ME-609.Investigational
Meclofenamic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Meclofenamic acid.Approved, Vet Approved
MedrysoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Medrysone.Approved
Mefenamic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Mefenamic acid.Approved
MelengestrolThe risk or severity of adverse effects can be increased when Etanercept is combined with Melengestrol.Vet Approved
MeloxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Meloxicam.Approved, Vet Approved
MesalazineEtanercept may increase the nephrotoxic activities of Mesalazine.Approved
MetamizoleThe risk or severity of adverse effects can be increased when Etanercept is combined with Metamizole.Withdrawn
MethotrexateThe serum concentration of Methotrexate can be increased when it is combined with Etanercept.Approved
MethyclothiazideThe therapeutic efficacy of Methyclothiazide can be decreased when used in combination with Etanercept.Approved
MethylprednisoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Methylprednisolone.Approved, Vet Approved
MetipranololEtanercept may decrease the antihypertensive activities of Metipranolol.Approved
MetolazoneThe therapeutic efficacy of Metolazone can be decreased when used in combination with Etanercept.Approved
MetoprololEtanercept may decrease the antihypertensive activities of Metoprolol.Approved, Investigational
MetrizamideEtanercept may decrease the excretion rate of Metrizamide which could result in a higher serum level.Approved
MisoprostolThe therapeutic efficacy of Misoprostol can be decreased when used in combination with Etanercept.Approved
MizoribineThe risk or severity of adverse effects can be increased when Etanercept is combined with Mizoribine.Investigational
MoexiprilThe risk or severity of adverse effects can be increased when Moexipril is combined with Etanercept.Approved
MometasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Mometasone.Approved, Vet Approved
MorniflumateThe risk or severity of adverse effects can be increased when Morniflumate is combined with Etanercept.Approved
MoxifloxacinEtanercept may increase the neuroexcitatory activities of Moxifloxacin.Approved, Investigational
Mycophenolate mofetilThe risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolate mofetil.Approved, Investigational
Mycophenolic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Mycophenolic acid.Approved
NabumetoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Nabumetone.Approved
NadololEtanercept may decrease the antihypertensive activities of Nadolol.Approved
NadroparinEtanercept may increase the anticoagulant activities of Nadroparin.Approved
NafamostatEtanercept may increase the anticoagulant activities of Nafamostat.Investigational
NaftifineThe risk or severity of adverse effects can be increased when Etanercept is combined with Naftifine.Approved
Nalidixic AcidEtanercept may increase the neuroexcitatory activities of Nalidixic Acid.Approved
NaproxenThe risk or severity of adverse effects can be increased when Etanercept is combined with Naproxen.Approved, Vet Approved
NatalizumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Natalizumab.Approved, Investigational
NCX 1022The risk or severity of adverse effects can be increased when Etanercept is combined with NCX 1022.Investigational
NCX 4016The risk or severity of adverse effects can be increased when Etanercept is combined with NCX 4016.Investigational
NeamineEtanercept may decrease the excretion rate of Neamine which could result in a higher serum level.Experimental
NemonoxacinEtanercept may increase the neuroexcitatory activities of Nemonoxacin.Investigational
NeomycinEtanercept may decrease the excretion rate of Neomycin which could result in a higher serum level.Approved, Vet Approved
NepafenacThe risk or severity of adverse effects can be increased when Etanercept is combined with Nepafenac.Approved
NetilmicinEtanercept may decrease the excretion rate of Netilmicin which could result in a higher serum level.Approved
Niflumic AcidThe risk or severity of adverse effects can be increased when Etanercept is combined with Niflumic Acid.Approved
NimesulideThe risk or severity of adverse effects can be increased when Etanercept is combined with Nimesulide.Approved, Withdrawn
NitroaspirinThe risk or severity of adverse effects can be increased when Etanercept is combined with Nitroaspirin.Investigational
NorfloxacinEtanercept may increase the neuroexcitatory activities of Norfloxacin.Approved
OfloxacinEtanercept may increase the neuroexcitatory activities of Ofloxacin.Approved
Oleoyl estroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Oleoyl estrone.Investigational
OlmesartanThe risk or severity of adverse effects can be increased when Olmesartan is combined with Etanercept.Approved, Investigational
OlopatadineThe risk or severity of adverse effects can be increased when Etanercept is combined with Olopatadine.Approved
OlsalazineEtanercept may increase the nephrotoxic activities of Olsalazine.Approved
Omacetaxine mepesuccinateThe risk or severity of adverse effects can be increased when Etanercept is combined with Omacetaxine mepesuccinate.Approved
OmapatrilatThe risk or severity of adverse effects can be increased when Omapatrilat is combined with Etanercept.Investigational
OrgoteinThe risk or severity of adverse effects can be increased when Etanercept is combined with Orgotein.Vet Approved
OtamixabanEtanercept may increase the anticoagulant activities of Otamixaban.Investigational
OxaprozinThe risk or severity of adverse effects can be increased when Etanercept is combined with Oxaprozin.Approved
OxprenololEtanercept may decrease the antihypertensive activities of Oxprenolol.Approved
OxyphenbutazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Oxyphenbutazone.Withdrawn
PamidronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Pamidronate.Approved
ParamethasoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Paramethasone.Approved
ParecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Parecoxib.Approved
ParomomycinEtanercept may decrease the excretion rate of Paromomycin which could result in a higher serum level.Approved, Investigational
PazufloxacinEtanercept may increase the neuroexcitatory activities of Pazufloxacin.Investigational
PefloxacinEtanercept may increase the neuroexcitatory activities of Pefloxacin.Approved
PenbutololEtanercept may decrease the antihypertensive activities of Penbutolol.Approved, Investigational
Pentosan PolysulfateEtanercept may increase the anticoagulant activities of Pentosan Polysulfate.Approved
PerindoprilThe risk or severity of adverse effects can be increased when Perindopril is combined with Etanercept.Approved
PhenindioneEtanercept may increase the anticoagulant activities of Phenindione.Approved
PhenprocoumonEtanercept may increase the anticoagulant activities of Phenprocoumon.Approved
PhenylbutazoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Phenylbutazone.Approved, Vet Approved
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Etanercept.Approved, Investigational
PindololEtanercept may decrease the antihypertensive activities of Pindolol.Approved
PirarubicinEtanercept may decrease the excretion rate of Pirarubicin which could result in a higher serum level.Investigational
PiretanideEtanercept may decrease the diuretic activities of Piretanide.Experimental
PirfenidoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Pirfenidone.Investigational
PiroxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Piroxicam.Approved, Investigational
PlicamycinEtanercept may decrease the excretion rate of Plicamycin which could result in a higher serum level.Approved, Withdrawn
PolythiazideThe therapeutic efficacy of Polythiazide can be decreased when used in combination with Etanercept.Approved
PractololEtanercept may decrease the antihypertensive activities of Practolol.Approved
PralatrexateThe serum concentration of Pralatrexate can be increased when it is combined with Etanercept.Approved
PrasteroneThe risk or severity of adverse effects can be increased when Etanercept is combined with Prasterone.Approved, Nutraceutical
PrednicarbateThe risk or severity of adverse effects can be increased when Etanercept is combined with Prednicarbate.Approved
PrednisoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Prednisolone.Approved, Vet Approved
PrednisoneThe risk or severity of adverse effects can be increased when Etanercept is combined with Prednisone.Approved, Vet Approved
PregnenoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Pregnenolone.Experimental
ProbenecidThe serum concentration of Etanercept can be increased when it is combined with Probenecid.Approved
PropacetamolThe risk or severity of adverse effects can be increased when Etanercept is combined with Propacetamol.Approved
PropranololEtanercept may decrease the antihypertensive activities of Propranolol.Approved, Investigational
Prostaglandin B2The therapeutic efficacy of Prostaglandin B2 can be decreased when used in combination with Etanercept.Experimental
Prostaglandin D2The therapeutic efficacy of Prostaglandin D2 can be decreased when used in combination with Etanercept.Experimental, Investigational
Prostaglandin G2The therapeutic efficacy of Prostaglandin G2 can be decreased when used in combination with Etanercept.Experimental
ProstaleneThe therapeutic efficacy of Prostalene can be decreased when used in combination with Etanercept.Vet Approved
Protein CEtanercept may increase the anticoagulant activities of Protein C.Approved
Protein S humanEtanercept may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeEtanercept may increase the anticoagulant activities of Protocatechualdehyde.Approved
PrulifloxacinEtanercept may increase the neuroexcitatory activities of Prulifloxacin.Investigational
PTC299The risk or severity of adverse effects can be increased when Etanercept is combined with PTC299.Investigational
PuromycinEtanercept may decrease the excretion rate of Puromycin which could result in a higher serum level.Experimental
QuinaprilThe risk or severity of adverse effects can be increased when Quinapril is combined with Etanercept.Approved, Investigational
QuinethazoneThe therapeutic efficacy of Quinethazone can be decreased when used in combination with Etanercept.Approved
Rabies vaccineThe risk or severity of adverse effects can be increased when Etanercept is combined with Rabies vaccine.Approved
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Etanercept.Approved
RamiprilThe risk or severity of adverse effects can be increased when Ramipril is combined with Etanercept.Approved
RescinnamineThe risk or severity of adverse effects can be increased when Rescinnamine is combined with Etanercept.Approved
ResveratrolThe risk or severity of adverse effects can be increased when Etanercept is combined with Resveratrol.Experimental, Investigational
ReviparinEtanercept may increase the anticoagulant activities of Reviparin.Approved
RibostamycinEtanercept may decrease the excretion rate of Ribostamycin which could result in a higher serum level.Approved
RilonaceptThe risk or severity of adverse effects can be increased when Etanercept is combined with Rilonacept.Approved
RimexoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Rimexolone.Approved
RisedronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Risedronate.Approved, Investigational
RituximabThe risk or severity of adverse effects can be increased when Etanercept is combined with Rituximab.Approved
RivaroxabanEtanercept may increase the anticoagulant activities of Rivaroxaban.Approved
RofecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Rofecoxib.Investigational, Withdrawn
RoflumilastRoflumilast may increase the immunosuppressive activities of Etanercept.Approved
RosoxacinEtanercept may increase the neuroexcitatory activities of Rosoxacin.Approved
SacubitrilThe risk or severity of adverse effects can be increased when Sacubitril is combined with Etanercept.Approved
SalicylamideThe risk or severity of adverse effects can be increased when Etanercept is combined with Salicylamide.Approved
Salicylic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Salicylic acid.Approved, Vet Approved
SalsalateThe risk or severity of adverse effects can be increased when Etanercept is combined with Salsalate.Approved
SaprisartanThe risk or severity of adverse effects can be increased when Saprisartan is combined with Etanercept.Experimental
SaralasinThe risk or severity of adverse effects can be increased when Saralasin is combined with Etanercept.Investigational
SeratrodastThe risk or severity of adverse effects can be increased when Etanercept is combined with Seratrodast.Approved, Investigational
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Etanercept.Approved
SisomicinEtanercept may decrease the excretion rate of Sisomicin which could result in a higher serum level.Investigational
SotalolEtanercept may decrease the antihypertensive activities of Sotalol.Approved
SP1049CEtanercept may decrease the excretion rate of SP1049C which could result in a higher serum level.Investigational
SparfloxacinEtanercept may increase the neuroexcitatory activities of Sparfloxacin.Approved
SpectinomycinEtanercept may decrease the excretion rate of Spectinomycin which could result in a higher serum level.Approved, Vet Approved
SpiraprilThe risk or severity of adverse effects can be increased when Spirapril is combined with Etanercept.Approved
SpironolactoneEtanercept may decrease the antihypertensive activities of Spironolactone.Approved
SRP 299The risk or severity of adverse effects can be increased when Etanercept is combined with SRP 299.Investigational
SRT501The risk or severity of adverse effects can be increased when Etanercept is combined with SRT501.Investigational
StreptomycinEtanercept may decrease the excretion rate of Streptomycin which could result in a higher serum level.Approved, Vet Approved
StreptozocinEtanercept may decrease the excretion rate of Streptozocin which could result in a higher serum level.Approved
SulfasalazineEtanercept may increase the nephrotoxic activities of Sulfasalazine.Approved
SulindacThe risk or severity of adverse effects can be increased when Etanercept is combined with Sulindac.Approved
SulodexideEtanercept may increase the anticoagulant activities of Sulodexide.Approved, Investigational
SulprostoneThe therapeutic efficacy of Sulprostone can be decreased when used in combination with Etanercept.Investigational
SuprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Suprofen.Approved, Withdrawn
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Etanercept.Approved, Investigational
TacrolimusEtanercept may increase the nephrotoxic activities of Tacrolimus.Approved, Investigational
TafluprostThe therapeutic efficacy of Tafluprost can be decreased when used in combination with Etanercept.Approved
TalniflumateThe risk or severity of adverse effects can be increased when Talniflumate is combined with Etanercept.Approved
TasosartanThe risk or severity of adverse effects can be increased when Tasosartan is combined with Etanercept.Approved
Technetium tc 99m etidronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Technetium tc 99m etidronate.Approved
Technetium Tc-99m MedronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Technetium Tc-99m Medronate.Approved
TelmisartanThe risk or severity of adverse effects can be increased when Telmisartan is combined with Etanercept.Approved, Investigational
TemafloxacinEtanercept may increase the neuroexcitatory activities of Temafloxacin.Withdrawn
TemocaprilThe risk or severity of adverse effects can be increased when Temocapril is combined with Etanercept.Experimental, Investigational
TenofovirThe risk or severity of adverse effects can be increased when Etanercept is combined with Tenofovir.Approved, Investigational
TenoxicamThe risk or severity of adverse effects can be increased when Etanercept is combined with Tenoxicam.Approved
TepoxalinThe risk or severity of adverse effects can be increased when Etanercept is combined with Tepoxalin.Vet Approved
TeriflunomideThe risk or severity of adverse effects can be increased when Etanercept is combined with Teriflunomide.Approved
TG4010The risk or severity of adverse effects can be increased when Etanercept is combined with TG4010.Investigational
Tiaprofenic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Tiaprofenic acid.Approved
TiludronateThe risk or severity of adverse effects can be increased when Etanercept is combined with Tiludronate.Approved, Vet Approved
TimololEtanercept may decrease the antihypertensive activities of Timolol.Approved
TinoridineThe risk or severity of adverse effects can be increased when Etanercept is combined with Tinoridine.Investigational
TixocortolThe risk or severity of adverse effects can be increased when Etanercept is combined with Tixocortol.Approved
TobramycinEtanercept may decrease the excretion rate of Tobramycin which could result in a higher serum level.Approved, Investigational
TocilizumabTocilizumab may increase the immunosuppressive activities of Etanercept.Approved
TofacitinibThe risk or severity of adverse effects can be increased when Etanercept is combined with Tofacitinib.Approved, Investigational
Tolfenamic AcidThe risk or severity of adverse effects can be increased when Etanercept is combined with Tolfenamic Acid.Approved
TolmetinThe risk or severity of adverse effects can be increased when Etanercept is combined with Tolmetin.Approved
TorasemideEtanercept may decrease the diuretic activities of Torasemide.Approved
TrandolaprilThe risk or severity of adverse effects can be increased when Trandolapril is combined with Etanercept.Approved
TranilastThe risk or severity of adverse effects can be increased when Etanercept is combined with Tranilast.Approved, Investigational
TrastuzumabTrastuzumab may increase the neutropenic activities of Etanercept.Approved, Investigational
TravoprostThe therapeutic efficacy of Travoprost can be decreased when used in combination with Etanercept.Approved
TreprostinilThe risk or severity of adverse effects can be increased when Treprostinil is combined with Etanercept.Approved, Investigational
TriamcinoloneThe risk or severity of adverse effects can be increased when Etanercept is combined with Triamcinolone.Approved, Vet Approved
TriamtereneEtanercept may decrease the antihypertensive activities of Triamterene.Approved
TrichlormethiazideThe therapeutic efficacy of Trichlormethiazide can be decreased when used in combination with Etanercept.Approved, Vet Approved
Trisalicylate-cholineThe risk or severity of adverse effects can be increased when Etanercept is combined with Trisalicylate-choline.Approved
TrovafloxacinEtanercept may increase the neuroexcitatory activities of Trovafloxacin.Approved, Withdrawn
UnoprostoneThe therapeutic efficacy of Unoprostone can be decreased when used in combination with Etanercept.Approved
ValdecoxibThe risk or severity of adverse effects can be increased when Etanercept is combined with Valdecoxib.Investigational, Withdrawn
ValrubicinEtanercept may decrease the excretion rate of Valrubicin which could result in a higher serum level.Approved
ValsartanThe risk or severity of adverse effects can be increased when Valsartan is combined with Etanercept.Approved, Investigational
VancomycinThe serum concentration of Vancomycin can be increased when it is combined with Etanercept.Approved
VedolizumabThe risk or severity of adverse effects can be increased when Etanercept is combined with Vedolizumab.Approved
WarfarinEtanercept may increase the anticoagulant activities of Warfarin.Approved
XimelagatranEtanercept may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
Ym150Etanercept may increase the anticoagulant activities of Ym150.Investigational
ZaltoprofenThe risk or severity of adverse effects can be increased when Etanercept is combined with Zaltoprofen.Approved
ZileutonThe risk or severity of adverse effects can be increased when Etanercept is combined with Zileuton.Approved, Investigational, Withdrawn
Zoledronic acidThe risk or severity of adverse effects can be increased when Etanercept is combined with Zoledronic acid.Approved
ZomepiracThe risk or severity of adverse effects can be increased when Etanercept is combined with Zomepirac.Withdrawn
ZorubicinEtanercept may decrease the excretion rate of Zorubicin which could result in a higher serum level.Experimental
Food InteractionsNot Available
References
Synthesis Reference

Timothy D. Osslund, Christi L. Clogston, Shon Lee Crampton, Randal B. Bass, “Crystals of etanercept and methods of making thereof.” U.S. Patent US07276477, issued October 02, 2007.

US07276477
General References
  1. Link [Link]
  2. Link [Link]
External Links
ATC CodesL04AB01
AHFS Codes
  • 92:00.00
PDB Entries
FDA labelNot Available
MSDSNot Available
Pharmacoeconomics
Manufacturers
  • Amgen Inc. + Wyeth + Takeda
Packagers
Dosage forms
FormRouteStrength
Injection, powder, for solutionSubcutaneous10 mg
Injection, powder, for solutionSubcutaneous25 mg
Injection, powder, for solutionSubcutaneous50 mg
Injection, solutionSubcutaneous25 mg
Injection, solutionSubcutaneous50 mg
Kit
Kit; liquid; powder, for solutionSubcutaneous
SolutionSubcutaneous25 mg/.5mL
SolutionSubcutaneous50 mg
SolutionSubcutaneous50 mg/mL
Prices
Unit descriptionCostUnit
Enbrel (1 Box = 1 Kit = Four 50 mg Syringes) 3.92ml Box2033.14USD box
Enbrel SureClick (1 Box Contains Four 50 mg Prefilled Autoinjectors)2033.14USD box
Enbrel 4 25 mg Kit (1 Box = 1 Kit = Four 25 mg Vials)1016.57USD box
Enbrel 50 mg/ml sureclick syr488.74USD syringe
Enbrel 25 mg kit250.37USD each
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2123593 No2000-03-142013-09-14Canada
CA2476934 No2009-06-162023-02-27Canada
US36755 No2000-06-272012-10-23Us
US7276477 No2007-10-022024-07-29Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.529Not Available
isoelectric point7.89Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Tumor necrosis factor receptor binding
Specific Function:
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs ...
Gene Name:
TNF
Uniprot ID:
P01375
Molecular Weight:
25644.15 Da
References
  1. Park YC, Burkitt V, Villa AR, Tong L, Wu H: Structural basis for self-association and receptor recognition of human TRAF2. Nature. 1999 Apr 8;398(6727):533-8. [PubMed:10206649 ]
  2. Sandborn WJ, Hanauer SB: Antitumor necrosis factor therapy for inflammatory bowel disease: a review of agents, pharmacology, clinical results, and safety. Inflamm Bowel Dis. 1999 May;5(2):119-33. [PubMed:10338381 ]
  3. Grell M, Zimmermann G, Gottfried E, Chen CM, Grunwald U, Huang DC, Wu Lee YH, Durkop H, Engelmann H, Scheurich P, Wajant H, Strasser A: Induction of cell death by tumour necrosis factor (TNF) receptor 2, CD40 and CD30: a role for TNF-R1 activation by endogenous membrane-anchored TNF. EMBO J. 1999 Jun 1;18(11):3034-43. [PubMed:10357816 ]
  4. Moreland LW: Inhibitors of tumor necrosis factor: new treatment options for rheumatoid arthritis. Cleve Clin J Med. 1999 Jun;66(6):367-74. [PubMed:10375846 ]
  5. Calabrese LH: Rheumatoid arthritis and primary care: the case for early diagnosis and treatment. J Am Osteopath Assoc. 1999 Jun;99(6):313-21. [PubMed:10405518 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Ubiquitin protein ligase binding
Specific Function:
Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by ant...
Gene Name:
TNFRSF1B
Uniprot ID:
P20333
Molecular Weight:
48290.85 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
  2. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
  2. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083 ]
  2. Ranheim EA, Kipps TJ: Tumor necrosis factor-alpha facilitates induction of CD80 (B7-1) and CD54 on human B cells by activated T cells: complex regulation by IL-4, IL-10, and CD40L. Cell Immunol. 1995 Apr 1;161(2):226-35. [PubMed:7535196 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor binding
Specific Function:
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
Gene Name:
LTA
Uniprot ID:
P01374
Molecular Weight:
22296.57 Da
References
  1. Johnson CJ, Reilly KM, Murray KM: Etanercept in juvenile rheumatoid arthritis. Ann Pharmacother. 2001 Apr;35(4):464-71. [PubMed:11302411 ]
  2. Pennica D, Lam VT, Mize NK, Weber RF, Lewis M, Fendly BM, Lipari MT, Goeddel DV: Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation. J Biol Chem. 1992 Oct 15;267(29):21172-8. [PubMed:1328224 ]
  3. Gudbrandsdottir S, Larsen R, Sorensen LK, Nielsen S, Hansen MB, Svenson M, Bendtzen K, Muller K: TNF and LT binding capacities in the plasma of arthritis patients: effect of etanercept treatment in juvenile idiopathic arthritis. Clin Exp Rheumatol. 2004 Jan-Feb;22(1):118-24. [PubMed:15005015 ]
  4. Buch MH, Conaghan PG, Quinn MA, Bingham SJ, Veale D, Emery P: True infliximab resistance in rheumatoid arthritis: a role for lymphotoxin alpha? Ann Rheum Dis. 2004 Oct;63(10):1344-6. Epub 2004 Mar 19. [PubMed:15033655 ]
  5. Kang CP, Lee KW, Yoo DH, Kang C, Bae SC: The influence of a polymorphism at position -857 of the tumour necrosis factor alpha gene on clinical response to etanercept therapy in rheumatoid arthritis. Rheumatology (Oxford). 2005 Apr;44(4):547-52. Epub 2005 Feb 3. [PubMed:15695296 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Hart SP, Ross JA, Ross K, Haslett C, Dransfield I: Molecular characterization of the surface of apoptotic neutrophils: implications for functional downregulation and recognition by phagocytes. Cell Death Differ. 2000 May;7(5):493-503. [PubMed:10800083 ]
  2. Ozgocmen S, Godekmerdan A, Ozkurt-Zengin F: Acute-phase response, clinical measures and disease activity in ankylosing spondylitis. Joint Bone Spine. 2007 May;74(3):249-53. Epub 2007 Mar 5. [PubMed:17387033 ]
  3. Criswell LA, Lum RF, Turner KN, Woehl B, Zhu Y, Wang J, Tiwari HK, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL Jr: The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept. Arthritis Rheum. 2004 Sep;50(9):2750-6. [PubMed:15457442 ]
  4. Hughes LB, Criswell LA, Beasley TM, Edberg JC, Kimberly RP, Moreland LW, Seldin MF, Bridges SL: Genetic risk factors for infection in patients with early rheumatoid arthritis. Genes Immun. 2004 Dec;5(8):641-7. [PubMed:15526004 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inhibitor
General Function:
Prostaglandin-endoperoxide synthase activity
Specific Function:
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and in pathological conditions, such as in cancer. PTGS2 is responsible for production of inflammatory prostaglandins. Up-regulation of PTGS2 is also associated with increased cell adhesion, p...
Gene Name:
PTGS2
Uniprot ID:
P35354
Molecular Weight:
68995.625 Da
References
  1. Bawolak MT, Touzin K, Moreau ME, Desormeaux A, Adam A, Marceau F: Cardiovascular expression of inflammatory signaling molecules, the kinin B1 receptor and COX2, in the rabbit: effects of LPS, anti-inflammatory and anti-hypertensive drugs. Regul Pept. 2008 Feb 7;146(1-3):157-68. Epub 2007 Sep 14. [PubMed:17931716 ]
  2. Genovese T, Mazzon E, Crisafulli C, Di Paola R, Muia C, Bramanti P, Cuzzocrea S: Immunomodulatory effects of etanercept in an experimental model of spinal cord injury. J Pharmacol Exp Ther. 2006 Mar;316(3):1006-16. Epub 2005 Nov 22. [PubMed:16303916 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23