You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameErythropoietin
Accession NumberDB00016  (BTD00103, BIOD00103)
TypeBiotech
GroupsApproved
DescriptionErythropoietin (as Epoetin alfa) is a 165-amino acid erythropoiesis-stimulating glycoprotein manufactured by recombinant DNA technology. It has a molecular weight of approximately 30,400 daltons and is produced by mammalian cells into which the human erythropoietin gene has been introduced. The product contains the identical amino acid sequence of isolated natural erythropoietin.
Protein structureDb00016
Related Articles
Protein chemical formulaC815H1317N233O241S5
Protein average weight18396.1 Da
Sequences
>DB00016 sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Download FASTA Format
Synonyms
E.P.O.
Epoetin alfa
Epoetin alfa rDNA
Epoetin alfa, recombinant
Epoetin beta
Epoetin beta rDNA
Epoetin epsilon
Epoetin gamma
Epoetin gamma rDNA
Epoetin kappa
Epoetin omega
Erythropoiesis stimulating factor
Erythropoietin (human, recombinant)
Erythropoietin (recombinant human)
ESF
SH-polypeptide-72
External Identifiers
  • BM 06.019
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AbseamedInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution40000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution40000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution40000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution40000 IU/1mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution40000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
BinocritInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution10000 IU/1mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution10000 IU/1mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution40000 IU/1mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution40000 IU/1mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution40000 IU/1mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution40000 IU/1mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution20000 IU/0.5mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BinocritInjection, solution40000 IU/1mlIntravenous; SubcutaneousSandoz Gmb H2007-08-28Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution4000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution3000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution3000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution4000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution3000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution2000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution4000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution2000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
BiopoinInjection, solution2000 IU/0.5mlIntravenous; SubcutaneousTeva Gmb H2009-10-23Not applicableEu
Epoetin Alfa HexalInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution40000 IU/1mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution8000 IU/0.8mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution6000 IU/0.6mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution30000 IU/0.75mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
Epoetin Alfa HexalInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousHexal Ag2007-08-28Not applicableEu
EpogenSolution10000 [iU]/mLIntravenous; SubcutaneousAmgen Inc1994-12-05Not applicableUs
EpogenSolution10000 [iU]/mLIntravenous; SubcutaneousAmgen Inc1993-08-16Not applicableUs
EpogenSolution20000 [iU]/mLIntravenous; SubcutaneousAmgen Inc1997-03-03Not applicableUs
EpogenSolution4000 [iU]/mLIntravenous; SubcutaneousAmgen Inc1993-08-16Not applicableUs
EpogenSolution3000 [iU]/mLIntravenous; SubcutaneousAmgen Inc1990-04-30Not applicableUs
EpogenSolution2000 [iU]/mLIntravenous; SubcutaneousAmgen Inc1989-06-30Not applicableUs
EporatioInjection, solution3000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution4000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution3000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution2000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution5000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution4000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution2000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution2000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution4000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution20000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution3000 IU/0.5mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
EporatioInjection, solution30000 IU/1.0mlIntravenous; SubcutaneousRatiopharm Gmb H2009-10-29Not applicableEu
Eprex Sterile SolutionSolution20000 unitIntravenous; SubcutaneousJanssen Inc2005-08-24Not applicableCanada
Eprex Sterile SolutionSolution30000 unitIntravenous; SubcutaneousJanssen Inc2007-11-19Not applicableCanada
Eprex Sterile Solution 10000iu/1.0mlSolution10000 unitIntravenous; SubcutaneousJanssen Inc1997-09-19Not applicableCanada
Eprex Sterile Solution 10000iu/mlSolution10000 unitIntravenous; SubcutaneousJanssen Inc1990-12-312014-10-09Canada
Eprex Sterile Solution 1000iu/0.5mlSolution1000 unitIntravenous; SubcutaneousJanssen Inc1997-09-19Not applicableCanada
Eprex Sterile Solution 20000iu/mlSolution20000 unitIntravenous; SubcutaneousJanssen Inc1996-10-022010-04-29Canada
Eprex Sterile Solution 2000iu/0.5mlSolution2000 unitIntravenous; SubcutaneousJanssen Inc1997-09-19Not applicableCanada
Eprex Sterile Solution 2000iu/mlSolution2000 unitIntravenous; SubcutaneousJanssen Inc1992-12-312014-09-25Canada
Eprex Sterile Solution 3000iu/0.3mlSolution3000 unitIntravenous; SubcutaneousJanssen Inc1997-09-19Not applicableCanada
Eprex Sterile Solution 40000iu/mlSolution40000 unitIntravenous; SubcutaneousJanssen Inc1999-12-21Not applicableCanada
Eprex Sterile Solution 4000iu/0.4mlSolution4000 unitIntravenous; SubcutaneousJanssen Inc1997-09-19Not applicableCanada
Eprex Sterile Solution 4000iu/mlSolution4000 unitIntravenous; SubcutaneousJanssen Inc1990-12-312014-10-09Canada
Eprex Sterile Solution 5000iu/0.5mlSolution5000 unitIntravenous; SubcutaneousJanssen Inc2002-07-01Not applicableCanada
Eprex Sterile Solution 6000 Iu/0.6 MlSolution6000 unitIntravenous; SubcutaneousJanssen Inc2001-02-20Not applicableCanada
Eprex Sterile Solution 8000 Iu/0.8 MlSolution8000 unitIntravenous; SubcutaneousJanssen Inc2001-02-20Not applicableCanada
ProcritInjection, solution10000 [iU]/mLIntravenous; SubcutaneousPhysicians Total Care, Inc.1994-08-11Not applicableUs
ProcritInjection, solution40000 [iU]/mLIntravenous; SubcutaneousJanssen Products, LP1989-06-01Not applicableUs
ProcritInjection, solution4000 [iU]/mLIntravenous; SubcutaneousJanssen Products, LP1989-06-01Not applicableUs
ProcritInjection, solution20000 [iU]/mLIntravenous; SubcutaneousPhysicians Total Care, Inc.2008-03-24Not applicableUs
ProcritInjection, solution10000 [iU]/mLIntravenous; SubcutaneousJanssen Products, LP1989-06-01Not applicableUs
ProcritInjection, solution2000 [iU]/mLIntravenous; SubcutaneousJanssen Products, LP1989-06-01Not applicableUs
ProcritInjection, solution40000 [iU]/mLIntravenous; SubcutaneousPhysicians Total Care, Inc.2007-08-13Not applicableUs
ProcritInjection, solution10000 [iU]/mLIntravenous; SubcutaneousJanssen Products, LP1989-06-01Not applicableUs
ProcritInjection, solution3000 [iU]/mLIntravenous; SubcutaneousJanssen Products, LP1989-06-01Not applicableUs
ProcritInjection, solution20000 [iU]/mLIntravenous; SubcutaneousJanssen Products, LP1989-06-01Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
BinocritSandoz
EpoceptLupin pharma
EpofitIntas pharma
EpoginChugai
NanokineNanogen Pharmaceutical biotechnology, Vietnam)
Brand mixturesNot Available
SaltsNot Available
Categories
UNII64FS3BFH5W
CAS number11096-26-7
Pharmacology
IndicationFor treatment of anemia (from renal transplants or certain HIV treatment)
Structured Indications
PharmacodynamicsUsed in the treatment of anemia. Involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of actionBinding of erythropoietin to the erythropoietin receptor leads to receptor dimerization, which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
TargetKindPharmacological actionActionsOrganismUniProt ID
Erythropoietin receptorProteinyes
agonist
HumanP19235 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
Clearance
  • 20.2 +/- 15.9 mL/h/kg [150 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 23.6 +/- 9.5 mL/h/kg [150 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
  • 9.2 +/- 4.7 mL/h/kg [40,000 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 13.9 +/- 7.6 mL/h/kg [40,000 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
LenalidomideErythropoietin may increase the thrombogenic activities of Lenalidomide.Approved
Nandrolone decanoateNandrolone decanoate may increase the stimulatory activities of Erythropoietin.Approved, Illicit
Nandrolone phenpropionateNandrolone phenpropionate may increase the stimulatory activities of Erythropoietin.Approved, Illicit
ThalidomideErythropoietin may increase the thrombogenic activities of Thalidomide.Approved, Investigational, Withdrawn
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General ReferencesNot Available
External Links
ATC CodesB03XA01
AHFS Codes
  • 20:16.00
PDB Entries
FDA labelDownload (2.73 MB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous; Subcutaneous1000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous10000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous2000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous20000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous3000 IU/0.3ml
Injection, solutionIntravenous; Subcutaneous30000 IU/0.75ml
Injection, solutionIntravenous; Subcutaneous4000 IU/0.4ml
Injection, solutionIntravenous; Subcutaneous40000 IU/1ml
Injection, solutionIntravenous; Subcutaneous40000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous5000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous6000 IU/0.6ml
Injection, solutionIntravenous; Subcutaneous7000 IU/0.7ml
Injection, solutionIntravenous; Subcutaneous8000 IU/0.8ml
Injection, solutionIntravenous; Subcutaneous9000 IU/0.9ml
Injection, solutionIntravenous; Subcutaneous10000 IU/1ml
SolutionIntravenous; Subcutaneous10000 [iU]/mL
SolutionIntravenous; Subcutaneous2000 [iU]/mL
SolutionIntravenous; Subcutaneous20000 [iU]/mL
SolutionIntravenous; Subcutaneous3000 [iU]/mL
SolutionIntravenous; Subcutaneous4000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous2000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous20000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous3000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous30000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous4000 IU/0.5ml
SolutionIntravenous; Subcutaneous20000 unit
SolutionIntravenous; Subcutaneous30000 unit
SolutionIntravenous; Subcutaneous10000 unit
SolutionIntravenous; Subcutaneous1000 unit
SolutionIntravenous; Subcutaneous2000 unit
SolutionIntravenous; Subcutaneous3000 unit
SolutionIntravenous; Subcutaneous40000 unit
SolutionIntravenous; Subcutaneous4000 unit
SolutionIntravenous; Subcutaneous5000 unit
SolutionIntravenous; Subcutaneous6000 unit
SolutionIntravenous; Subcutaneous8000 unit
Injection, solutionIntravenous; Subcutaneous10000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous2000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous20000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous3000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous4000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous40000 [iU]/mL
Prices
Unit descriptionCostUnit
Epogen 40000 unit/ml Solution 1 Box Contains Ten 1ml Vials6852.3USD box
Epogen 20000 unit/ml Solution 1 Box Contains Ten 1ml Vials3157.44USD box
Epogen 10000 unit/ml Solution 1 Box Contains Ten 1ml Vials1578.72USD box
Procrit 40000 unit/ml vial767.03USD vial
Procrit 10000 unit/ml vial710.87USD vial
Epogen 40000 unit/ml vial640.37USD ml
Procrit 20000 unit/ml vial388.97USD ml
Procrit 20000 unit/ml Solution378.14USD ml
Procrit 10000 unit/ml Solution 2ml Vial358.02USD vial
Epogen 10000 unit/ml Solution 2ml Vial315.74USD vial
Epogen 20000 unit/ml vial303.6USD ml
Epogen 10000 unit/ml vial151.8USD ml
Procrit 4000 unit/ml vial74.17USD vial
Epogen 4000 unit/ml vial61.34USD vial
Procrit 3000 unit/ml vial55.63USD vial
Epogen 3000 unit/ml vial47.53USD vial
Procrit 2000 unit/ml vial37.09USD vial
Epogen 2000 unit/ml vial34.14USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339047 No1997-05-272014-05-27Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point53 °CArakawa, T. et al., Biosci. Biotechnol. Biochem. 65:1321-1327 (2001)
isoelectric point8.75Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Identical protein binding
Specific Function:
Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling.
Gene Name:
EPOR
Uniprot ID:
P19235
Molecular Weight:
55064.725 Da
References
  1. LaMontagne KR, Butler J, Marshall DJ, Tullai J, Gechtman Z, Hall C, Meshaw A, Farrell FX: Recombinant epoetins do not stimulate tumor growth in erythropoietin receptor-positive breast carcinoma models. Mol Cancer Ther. 2006 Feb;5(2):347-55. [PubMed:16505108 ]
  2. Kokhaei P, Abdalla AO, Hansson L, Mikaelsson E, Kubbies M, Haselbeck A, Jernberg-Wiklund H, Mellstedt H, Osterborg A: Expression of erythropoietin receptor and in vitro functional effects of epoetins in B-cell malignancies. Clin Cancer Res. 2007 Jun 15;13(12):3536-44. [PubMed:17575216 ]
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23