Identification

Name
Erythropoietin
Accession Number
DB00016  (BTD00103, BIOD00103, DB08923)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones
Description

Erythropoietin is a 165-amino acid erythropoiesis-stimulating glycoprotein manufactured by recombinant DNA technology. It has a molecular weight of approximately 30,400 daltons and is produced by mammalian cells into which the human erythropoietin gene has been introduced. The product contains the identical amino acid sequence of isolated natural erythropoietin.

Protein structure
Db00016
Protein chemical formula
C815H1317N233O241S5
Protein average weight
18396.1 Da
Sequences
>DB00016 (Erythropoietin) sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Download FASTA Format
Synonyms
  • E.P.O.
  • Epoetin alfa
  • Epoetin alfa rDNA
  • Epoetin alfa, recombinant
  • Epoetin beta
  • Epoetin beta rDNA
  • Epoetin epsilon
  • Epoetin gamma
  • Epoetin gamma rDNA
  • Epoetin kappa
  • Epoetin omega
  • Epoetin theta
  • Epoetin zeta
  • Epoetina dseta
  • Epoétine zêta
  • Epoetinum zeta
  • Erythropoiesis stimulating factor
  • Erythropoietin (human, recombinant)
  • Erythropoietin (recombinant human)
  • ESF
  • SH-polypeptide-72
External IDs
BM 06.019
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AbseamedInjection, solution7000 IU/0.7mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution40000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution4000 IU/0.4mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution2000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution3000 IU/0.3mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution9000 IU/0.9mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution40000 IU/1mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution1000 IU/0.5mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
AbseamedInjection, solution10000 IU/1.0mlIntravenous; SubcutaneousMedice Arzneimittel Pütter Gmb H & Co. Kg2007-08-28Not applicableEu
International/Other Brands
Binocrit (Sandoz) / Epobel (Nobel Ilac Pazarlama ve Sanayii Ltd. STI., Turkey) / Epocept (Lupin pharma) / Epofit (Intas pharma) / Epogin (Chugai) / Eqralys (Hemofarm AD) / Nanokine (Nanogen Pharmaceutical biotechnology, Vietnam)) / Retacrit (Hospira, Inc.) / Silapo (Cell Pharm GmbH)
Categories
UNII
64FS3BFH5W
CAS number
11096-26-7

Pharmacology

Indication

For use in the treatment of symptomatic anaemia associated with chronic renal failure (CRF) in adult and paediatric patients. Also for use in the treatment of anaemia and reduction of transfusion requirements in adult patients receiving chemotherapy for solid tumours, malignant lymphoma or multiple myeloma, and at risk of transfusion as assessed by the patient's general status (e.g. cardiovascular status, pre-existing anaemia at the start of chemotherapy). Also for used to increase the yield of autologous blood from patients in a predonation program. When administered subcutaneously, Epoetin Zeta is equivalent to Epoetin Alfa in terms of clinical effectiveness.

Structured Indications
Pharmacodynamics

Used in the treatment of anemia. Involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.

Mechanism of action

Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization, which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.

TargetActionsOrganism
AErythropoietin receptor
agonist
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

Toxicokinetic results from rats in a 13 week toxicity study after a single subcutaneous dose:

  • 7.37 hours (+/- 0.70) with 500 IU/kg [test 1]
  • 8.63 hours (+/- 2.78) with 2500 IU/kg [test 2]
  • 8.76 hours (+/- 1.46) with 2500 IU/kg [reference dose]
Clearance
  • 20.2 +/- 15.9 mL/h/kg [150 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 23.6 +/- 9.5 mL/h/kg [150 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
  • 9.2 +/- 4.7 mL/h/kg [40,000 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 13.9 +/- 7.6 mL/h/kg [40,000 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
LenalidomideErythropoietin may increase the thrombogenic activities of Lenalidomide.Approved
Nandrolone decanoateNandrolone decanoate may increase the stimulatory activities of Erythropoietin.Approved, Illicit
Nandrolone phenpropionateNandrolone phenpropionate may increase the stimulatory activities of Erythropoietin.Approved, Illicit, Investigational
ThalidomideErythropoietin may increase the thrombogenic activities of Thalidomide.Approved, Investigational, Withdrawn
Food Interactions
Not Available

References

General References
  1. Wizemann V, Rutkowski B, Baldamus C, Scigalla P, Koytchev R: Comparison of the therapeutic effects of epoetin zeta to epoetin alfa in the maintenance phase of renal anaemia treatment. Curr Med Res Opin. 2008 Mar;24(3):625-37. doi: 10.1185/030079908X273264. [PubMed:18208642]
  2. Krivoshiev S, Wizemann V, Czekalski S, Schiller A, Pljesa S, Wolf-Pflugmann M, Siebert-Weigel M, Koytchev R, Bronn A: Therapeutic equivalence of epoetin zeta and alfa, administered subcutaneously, for maintenance treatment of renal anemia. Adv Ther. 2010 Feb;27(2):105-17. doi: 10.1007/s12325-010-0012-y. Epub 2010 Mar 30. [PubMed:20369312]
  3. Brinks V, Hawe A, Basmeleh AH, Joachin-Rodriguez L, Haselberg R, Somsen GW, Jiskoot W, Schellekens H: Quality of original and biosimilar epoetin products. Pharm Res. 2011 Feb;28(2):386-93. doi: 10.1007/s11095-010-0288-2. Epub 2010 Oct 1. [PubMed:20886265]
  4. Link [Link]
External Links
UniProt
P01588
Genbank
X02158
PubChem Substance
46508122
ChEMBL
CHEMBL1201565
Therapeutic Targets Database
DAP000202
PharmGKB
PA10072
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Epoetin_alfa
ATC Codes
B03XA01 — Erythropoietin
AHFS Codes
  • 20:16.00 — Hematopoietic Agents
FDA label
Download (2.73 MB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedNot AvailableAnemias / Chronic Kidney Failure1
1CompletedBasic ScienceRenal Effects1
1CompletedBasic ScienceThere Are no Conditions Under Study. Healthy Volunteers1
1CompletedPreventionParkinson's Disease (PD)1
1CompletedTreatmentAnemias / Chronic Kidney Disease (CKD)1
1CompletedTreatmentCerebral Palsy (CP)1
1CompletedTreatmentChronic Kidney Disease (CKD) / Pulmonary Hypertension (PH) / Sickle Cell Disorders1
1CompletedTreatmentChronic Renal Failure (CRF)1
1CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1
1CompletedTreatmentHypoxic-Ischaemic Encephalopathy1
1TerminatedSupportive CareMalignant Lymphomas / Neutropenias1
1Unknown StatusTreatmentHealthy Volunteers4
1Unknown StatusTreatmentTransplantation, Kidney1
1, 2Active Not RecruitingPreventionAortic Arch Hypoplasia or Interruption / Congenital Heart Disease (CHD) / Hypoplastic Left Heart Syndrome (HLHS) / Transposition of the Great Arteries1
1, 2Active Not RecruitingTreatmentHypoxic-Ischaemic Encephalopathy / Neonatal Asphyxia / Neonatal Encephalopathy1
1, 2CompletedTreatmentAngiogenesis / Burr Hole / Ischemic Attack / Moyamoya Disease / Stroke, Ischemic1
1, 2RecruitingTreatmentAnemias / Cardiovascular Disease (CVD)1
1, 2RecruitingTreatmentCardiac Surgery-CABG and/or Cardiac Valve Replacement1
1, 2Unknown StatusBasic ScienceHealthy Volunteers1
2CompletedPreventionCerebral Palsy (CP) / Developmental Psychomotor Disorders / Intracranial Hemorrhages / Periventricular Leukomalacia1
2CompletedPreventionMyocardial Ischemia1
2CompletedPreventionOptic Neuritis1
2CompletedSupportive CareAnemias / Leukemias / Lymphoproliferative Disorders / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Precancerous Conditions / Unspecified Adult Solid Tumor, Protocol Specific2
2CompletedSupportive CareAnemias / Leukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
2CompletedSupportive CareAnemias / Tiredness / Unspecified Adult Solid Tumor, Protocol Specific2
2CompletedTreatmentAcquired Immune Deficiency Syndrome (AIDS) / Anemias4
2CompletedTreatmentAcute ST Elevation Myocardial Infarction1
2CompletedTreatmentAnemia in End Stage Renal Disease1
2CompletedTreatmentAnemias5
2CompletedTreatmentAnemias / Blood Transfusions / Orthopedic Procedures1
2CompletedTreatmentAnemias / Cancers1
2CompletedTreatmentAnemias / Cancers / Leukemia, Lymphocytic / Leukemia, Lymphocytic, Chronic / Neoplasms / Quality of Life1
2CompletedTreatmentAnemias / Cancer treatment / Cancers1
2CompletedTreatmentAnemias / Chronic Kidney Disease (CKD)1
2CompletedTreatmentAnemias / Chronic Kidney Disease (CKD) / Chronic Renal Failure (CRF)1
2CompletedTreatmentAnemias / Chronic Renal Insufficiency1
2CompletedTreatmentAnemias / Critical Illness1
2CompletedTreatmentAnemias / End Stage Renal Disease (ESRD)1
2CompletedTreatmentAnemias / Kidney Diseases1
2CompletedTreatmentAnemias / Neoplasms3
2CompletedTreatmentAnemias / Renal Failure, Chronic1
2CompletedTreatmentAnemias / Cancer treatment1
2CompletedTreatmentAneurysmal Subarachnoid Hemorrhage1
2CompletedTreatmentBeta-Thalassemia1
2CompletedTreatmentCerebral Palsy (CP)1
2CompletedTreatmentFriedreich's Ataxia2
2CompletedTreatmentHead and Neck Carcinoma1
2CompletedTreatmentMalignant Neoplasm of Pancreas1
2CompletedTreatmentMoods Disorders1
2CompletedTreatmentMyelodysplastic Syndrome1
2CompletedTreatmentMyelodysplastic Syndromes3
2CompletedTreatmentMyocardial Infarction (MI)1
2CompletedTreatmentPreterm Infants1
2CompletedTreatmentRenal Failure1
2Not Yet RecruitingTreatmentAngiogenesis / Stroke, Ischemic1
2Not Yet RecruitingTreatmentInfants, Premature1
2RecruitingHealth Services ResearchDiabetic Chronic Ulcers1
2RecruitingPreventionNeonatal Anemia1
2RecruitingTreatmentAnemias1
2RecruitingTreatmentAnemias / Chronic Renal Failure (CRF) / Dialysis therapy1
2RecruitingTreatmentAnemias / Congenital Heart Disease (CHD) / Cyanosis / Cyanotic Congenital Heart Disease1
2RecruitingTreatmentAnemias / Dialysis-dependent Chronic Kidney Disease1
2RecruitingTreatmentBipolar Disorder (BD) / Cognitive Impairments1
2RecruitingTreatmentCognitive Impairments / Depression, Bipolar / Electroconvulsive Therapy / Unipolar Depression1
2RecruitingTreatmentErectile Dysfunction (ED) / Prostate Cancer1
2RecruitingTreatmentInfants, Premature1
2TerminatedPreventionBrain Injury / Erythropoietin / Infants, Premature / Intraventricular Hemorrhage / Neurodevelopmental Outcomes / Periventricular Leukomalacia / Randomized Clinical Trial1
2TerminatedTreatmentAgeing / Anemias / Hemoglobins2
2TerminatedTreatmentAging / Anemias1
2TerminatedTreatmentAnemias2
2TerminatedTreatmentAnemias / Cancers / Epoetin Alfa1
2TerminatedTreatmentAnemias / Cancers / Neoplasms1
2TerminatedTreatmentAnemias / Human Immunodeficiency Virus (HIV)1
2TerminatedTreatmentAnemias / Rheumatoid Arthritis1
2TerminatedTreatmentAnemias / Surgery, Arthroscopy1
2TerminatedTreatmentEnd Stage Renal Disease (ESRD)1
2TerminatedTreatmentLeukemias1
2TerminatedTreatmentMyelodysplastic Syndromes1
2TerminatedTreatmentMyelodysplastic Syndromes (MDS)1
2TerminatedTreatmentStrokes1
2Unknown StatusTreatmentAcute Myocardial Infarction (AMI)1
2Unknown StatusTreatmentAnemias1
2Unknown StatusTreatmentAnemias / Myelodysplastic Syndromes1
2Unknown StatusTreatmentMultiple Sclerosis (Primary or Secondary Progressive Phase)1
2Unknown StatusTreatmentNewborn Infants1
2Unknown StatusTreatmentTrauma, Multiple1
2WithdrawnPreventionCancers1
2WithdrawnPreventionTraumatic Brain Injury (TBI)1
2WithdrawnTreatmentAnemias1
2WithdrawnTreatmentAnemias / Myelodysplastic Syndromes1
2WithdrawnTreatmentAnemias / Rheumatoid Arthritis1
2WithdrawnTreatmentHuman Immunodeficiency Virus (HIV) Infections / Neuropathy1
2WithdrawnTreatmentStrokes1
2, 3CompletedTreatmentAnemias / Blood Transfusions / Orthopedic Procedures1
2, 3CompletedTreatmentBlood Transfusions / Blood Transfusions, Autologous / Cardiovascular Surgical Procedures / Mammaplasty / Orthopedic Procedures1
2, 3CompletedTreatmentBlood Transfusions / Blood Transfusions, Autologous / Cardiovascular Surgical Procedures / Orthopedic Procedures1
2, 3CompletedTreatmentInfant, Low Birth Weight / Infant, Small for Gestational Age / Infants, Premature / Neonatal Anemia / Newborn Infants1
2, 3CompletedTreatmentPerinatal Asphyxia1
2, 3TerminatedTreatmentNerve Compression Syndromes1
2, 3Unknown StatusTreatmentMalaria, Cerebral1
2, 3WithdrawnTreatmentTraumatic Brain Injury (TBI)1
3Active Not RecruitingTreatmentAnemias / Chronic Myelomonocytic Leukemia / De Novo Myelodysplastic Syndrome / Myelodysplastic Syndrome / Previously Treated Myelodysplastic Syndromes1
3Active Not RecruitingTreatmentAnemias / End Stage Renal Disease (ESRD)1
3Active Not RecruitingTreatmentExtreme Prematurity1
3CompletedDiagnosticAnemias1
3CompletedPreventionAnemias / Left Ventricular Hypertrophy / Renal Failure1
3CompletedSupportive CareAcute Myelogenous Leukaemia (AML) / Leukemias / Myelodysplastic Syndrome1
3CompletedSupportive CareAdenocarcinoma of the Cervix / Adenosquamous carcinoma of the cervix / Anemias / Cervical Squamous Cell Carcinoma / Radiation Toxicity / Stage IIB Cervical Cancer / Stage III Cervical Cancer / Stage IVA Cervical Cancer / Therapeutic Agent Toxicity1
3CompletedSupportive CareAnemias / Cancer, Breast / Chronic Myeloproliferative Disorders / Drug/Agent Toxicity by Tissue/Organ / Leukemias / Lung Cancers / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Precancerous Conditions / Small Intestine Cancer / Unspecified Adult Solid Tumor, Protocol Specific1
3CompletedSupportive CareAnemias / Leukemias / Lymphoproliferative Disorders / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Precancerous Conditions / Unspecified Adult Solid Tumor, Protocol Specific1
3CompletedSupportive CareAnemias / Leukemias / Lymphoproliferative Disorders / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Precancerous/Nonmalignant Condition / Unspecified Adult Solid Tumor, Protocol Specific1
3CompletedSupportive CareAnemias / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm1
3CompletedSupportive CareAnemias / Prostate Cancer / Tiredness1
3CompletedTreatmentAnemias16
3CompletedTreatmentAnemias / Blood Transfusions, Autologous / Orthopedic Procedures1
3CompletedTreatmentAnemias / Blood Transfusions / Orthopedic Procedures1
3CompletedTreatmentAnemias / Cancer, Breast / Cancer, Ovarian / Esophagus Cancer / Malignant Lymphomas / Multiple Myeloma (MM) / Neoplasms / Prostate Cancer / Small Cell Lung Carcinoma1
3CompletedTreatmentAnemias / Cancers / Neoplasms1
3CompletedTreatmentAnemias / Cancer treatment / Cancers1
3CompletedTreatmentAnemias / Chronic Kidney Disease (CKD)1
3CompletedTreatmentAnemias / Chronic Kidney Disease (CKD) / Chronic Renal Failure (CRF)2
3CompletedTreatmentAnemias / Head and Neck Carcinoma1
3CompletedTreatmentAnemias / Hodgkins Disease (HD) / Leukemias / Non-Hodgkin's Lymphoma (NHL)1
3CompletedTreatmentAnemias / Kidney Failure,Chronic1
3CompletedTreatmentAnemias / Multiple Myeloma (MM)1
3CompletedTreatmentAnemias / Myelodysplastic Syndromes1
3CompletedTreatmentAnemias / Neoplasms1
3CompletedTreatmentAnemias / Neoplasms, Breast / Quality of Life1
3CompletedTreatmentAnemias / Renal Diseases1
3CompletedTreatmentAnemias / Thrombosis, Venous1
3CompletedTreatmentAngioplasty, Transluminal, Percutaneous Coronary / Myocardial Infarction (MI)1
3CompletedTreatmentCancer, Breast1
3CompletedTreatmentCarcinoma NOS / Prostate1
3CompletedTreatmentChronic Hepatitis C Infection1
3CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection1
3CompletedTreatmentChronic Kidney Disease (CKD) / Chronic Renal Failure (CRF)2
3CompletedTreatmentCongestive Heart Failure (CHF) / Renal Insufficiency,Chronic1
3CompletedTreatmentHepatitis C, Chronic1
3CompletedTreatmentHip Fractures1
3CompletedTreatmentLung Cancers1
3CompletedTreatmentMyelodysplastic Syndromes1
3CompletedTreatmentPredialysis Patients1
3CompletedTreatmentRectal Neoplasms / Stomach Neoplasms1
3CompletedTreatmentRenal Failure1
3CompletedTreatmentTraumatic Brain Injury (TBI)1
3Not Yet RecruitingTreatmentHypoxic-Ischaemic Encephalopathy1
3Not Yet RecruitingTreatmentMyelodysplastic Syndromes1
3RecruitingTreatmentAnemia in Incident Dialysis Patients1
3RecruitingTreatmentAnemias1
3RecruitingTreatmentAnemias / Aortic Valve Stenosis1
3RecruitingTreatmentCKD Anemia in Stable Dialysis Patients1
3RecruitingTreatmentCerebral Palsy (CP) / Infants, Premature / Intracranial Hemorrhages / Periventricular Leukomalacia1
3RecruitingTreatmentHypoxic-Ischaemic Encephalopathy1
3RecruitingTreatmentIntraventricular Hemorrhage of Prematurity1
3RecruitingTreatmentNeonatal Asphyxia / Neonatal Encephalopathy1
3RecruitingTreatmentOptic Nerve Diseases1
3SuspendedTreatmentSpinal Cord Injuries (SCI)1
3TerminatedTreatmentAnemias5
3TerminatedTreatmentAnemias / Cancers1
3TerminatedTreatmentAnemias / Chemotherapy, Adjuvant / Hemoglobins / Neoplasms, Breast / Quality of Life1
3TerminatedTreatmentAnemias / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lung Cancers1
3TerminatedTreatmentAnemias / Myelodysplastic Syndromes1
3TerminatedTreatmentAnemias / Neoplasms1
3TerminatedTreatmentDrug Resistance / Kidney Failure,Chronic1
3TerminatedTreatmentGastrointestinal Cancers / Rectal Carcinoma1
3TerminatedTreatmentHead and Neck Carcinoma1
3Unknown StatusPreventionAcute Renal Failure (ARF)1
3Unknown StatusPreventionChronic Kidney Insufficiency / Diabetes1
3Unknown StatusSupportive CareAnemias / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Unspecified Adult Solid Tumor, Protocol Specific1
3Unknown StatusTreatmentCervix Cancer1
3WithdrawnTreatmentAnemias / Blood Transfusions / Orthopedic Procedures1
4CompletedNot AvailableAnemias1
4CompletedNot AvailableAnemias / Neoplasms2
4CompletedNot AvailablePure Red Cell Aplasia1
4CompletedBasic ScienceHypertensive / Thrombosis1
4CompletedPreventionOther and unspecified effects of high altitude1
4CompletedPreventionPatients Receiving a Kidney From a Non-Heart-Beating Donor1
4CompletedSupportive CareAnemias / Cancer, Breast / Tiredness1
4CompletedSupportive CareAnemias / Cervical Cancers1
4CompletedTreatmentAnemias9
4CompletedTreatmentAnemias / Cancer treatment / Cancers1
4CompletedTreatmentAnemias / Chronic Kidney Disease (CKD)1
4CompletedTreatmentAnemias / Chronic Renal Anemia1
4CompletedTreatmentAnemias / Chronic Renal Failure (CRF)1
4CompletedTreatmentAnemias / Erythrocyte Transfusion / Renal Dialysis / Renal Insufficiency,Chronic1
4CompletedTreatmentAnemias / Human Immunodeficiency Virus (HIV) Infections1
4CompletedTreatmentAnemias / Neoplasms2
4CompletedTreatmentAnemias / Cancer treatment1
4CompletedTreatmentAntineoplastic Chemotherapy Induced Anemia1
4CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection1
4CompletedTreatmentChronic Renal Failure (CRF)1
4CompletedTreatmentDelayed Graft Function1
4CompletedTreatmentOsteoarthritis (OA)1
4Not Yet RecruitingPreventionAnemias / Atherosclerosis / Cardiovascular / CKD1
4RecruitingTreatmentAnemias1
4RecruitingTreatmentAnemias / Hematopoietic Stem Cell Transplantation (HSCT) / Malignant Lymphomas1
4RecruitingTreatmentAutoimmune Encephalitis1
4RecruitingTreatmentMyelodysplastic Syndromes1
4TerminatedPreventionContrast Induced Nephropathy (CIN)1
4TerminatedTreatmentAnemias6
4TerminatedTreatmentAnemias / Cancer treatment / Cancers1
4TerminatedTreatmentAnemias / Chronic Renal Insufficiency1
4TerminatedTreatmentAnemias / Hepatitis C Virus (HCV) / Human Immunodeficiency Virus (HIV) Infections / Neutropenias1
4TerminatedTreatmentAnemias / Kidney Diseases1
4TerminatedTreatmentAnemias / Renal Failure, Chronic Renal Failure1
4TerminatedTreatmentSubarachnoid Hemorrhage1
4TerminatedTreatmentMaintenance of surgical hemostasis therapy1
4Unknown StatusPreventionDiabetic Nephropathies1
4Unknown StatusTreatmentAcute Myocardial Infarction (AMI)1
4Unknown StatusTreatmentChronic Hepatitis C Virus (HCV) Infection1
4Unknown StatusTreatmentHeart Failure, Unspecified1
Not AvailableCompletedNot AvailableAnemia, Neoplasms1
Not AvailableCompletedNot AvailableAnemias1
Not AvailableCompletedNot AvailableChronic Renal Failure (CRF)1
Not AvailableCompletedBasic ScienceInsulin Sensitivity1
Not AvailableCompletedPreventionMyocardial Ischemic Reperfusion Injury1
Not AvailableCompletedSupportive CareAnemias / Multiple Myeloma (MM) / Multiple Myeloma and Plasma Cell Neoplasm / Plasma Cell Neoplasms1
Not AvailableCompletedSupportive CareMultiple Myeloma (MM)1
Not AvailableCompletedTreatmentAnemias / Infant, Low Birth Weight1
Not AvailableCompletedTreatmentBlood Transfusions1
Not AvailableCompletedTreatmentCardiovascular Disease (CVD) / Chronic Diseases / Kidney Diseases1
Not AvailableCompletedTreatmentCerebral Palsy (CP)1
Not AvailableCompletedTreatmentCrohn's Disease (CD)1
Not AvailableCompletedTreatmentCytopenias / Human Immunodeficiency Virus (HIV) Infections8
Not AvailableCompletedTreatmentDiabetes, Diabetes Mellitus Type 1 / Hypoglycemia1
Not AvailableCompletedTreatmentLeukemias1
Not AvailableNot Yet RecruitingNot AvailableTraumatic Brain Injury (TBI)1
Not AvailableRecruitingNot AvailableAllogenic Transfusion / Hip Arthroplasty / Knee Replacement Surgery / Perioperative Anaemia1
Not AvailableRecruitingNot AvailableAnemias / Endometrial Diseases1
Not AvailableRecruitingPreventionAcute Kidney Injury (AKI) / Cardiac Diseases / General Surgery1
Not AvailableTerminatedTreatmentAnemias1
Not AvailableTerminatedTreatmentIron-Deficiency Anemias1
Not AvailableUnknown StatusNot AvailableAnemias / Renal Failure Chronic1
Not AvailableUnknown StatusBasic ScienceIron Metabolism Disorders1
Not AvailableUnknown StatusScreeningRetinopathy of Prematurity1
Not AvailableUnknown StatusSupportive CareAnemias / Unspecified Adult Solid Tumor, Protocol Specific1
Not AvailableWithdrawnSupportive CareTiredness / Unspecified Adult Solid Tumor, Protocol Specific1
Not AvailableWithdrawnTreatmentAnemias1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous; Subcutaneous1000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous10000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous2000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous20000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous3000 IU/0.3ml
Injection, solutionIntravenous; Subcutaneous30000 IU/0.75ml
Injection, solutionIntravenous; Subcutaneous4000 IU/0.4ml
Injection, solutionIntravenous; Subcutaneous40000 IU/1ml
Injection, solutionIntravenous; Subcutaneous40000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous5000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous6000 IU/0.6ml
Injection, solutionIntravenous; Subcutaneous7000 IU/0.7ml
Injection, solutionIntravenous; Subcutaneous8000 IU/0.8ml
Injection, solutionIntravenous; Subcutaneous9000 IU/0.9ml
Injection, solutionIntravenous; Subcutaneous10000 IU/1ml
SolutionIntravenous; Subcutaneous10000 [iU]/mL
SolutionIntravenous; Subcutaneous2000 [iU]/mL
SolutionIntravenous; Subcutaneous20000 [iU]/mL
SolutionIntravenous; Subcutaneous3000 [iU]/mL
SolutionIntravenous; Subcutaneous4000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous2000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous20000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous3000 IU/0.5ml
Injection, solutionIntravenous; Subcutaneous30000 IU/1.0ml
Injection, solutionIntravenous; Subcutaneous4000 IU/0.5ml
SolutionIntravenous; Subcutaneous20000 unit
SolutionIntravenous; Subcutaneous30000 unit
SolutionIntravenous; Subcutaneous10000 unit
SolutionIntravenous; Subcutaneous1000 unit
SolutionIntravenous; Subcutaneous2000 unit
SolutionIntravenous; Subcutaneous3000 unit
SolutionIntravenous; Subcutaneous40000 unit
SolutionIntravenous; Subcutaneous4000 unit
SolutionIntravenous; Subcutaneous5000 unit
SolutionIntravenous; Subcutaneous6000 unit
SolutionIntravenous; Subcutaneous8000 unit
Injection, solutionIntravenous; Subcutaneous10000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous2000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous20000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous3000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous4000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous40000 [iU]/mL
Injection, solutionIntravenous; Subcutaneous1000 IU/0.3ml
Injection, solutionIntravenous; Subcutaneous2000 IU/0.6ml
Injection, solutionIntravenous; Subcutaneous3000 IU/0.9ml
Prices
Unit descriptionCostUnit
Epogen 40000 unit/ml Solution 1 Box Contains Ten 1ml Vials6852.3USD box
Epogen 20000 unit/ml Solution 1 Box Contains Ten 1ml Vials3157.44USD box
Epogen 10000 unit/ml Solution 1 Box Contains Ten 1ml Vials1578.72USD box
Procrit 40000 unit/ml vial767.03USD vial
Procrit 10000 unit/ml vial710.87USD vial
Epogen 40000 unit/ml vial640.37USD ml
Procrit 20000 unit/ml vial388.97USD ml
Procrit 20000 unit/ml Solution378.14USD ml
Procrit 10000 unit/ml Solution 2ml Vial358.02USD vial
Epogen 10000 unit/ml Solution 2ml Vial315.74USD vial
Epogen 20000 unit/ml vial303.6USD ml
Epogen 10000 unit/ml vial151.8USD ml
Procrit 4000 unit/ml vial74.17USD vial
Epogen 4000 unit/ml vial61.34USD vial
Procrit 3000 unit/ml vial55.63USD vial
Epogen 3000 unit/ml vial47.53USD vial
Procrit 2000 unit/ml vial37.09USD vial
Epogen 2000 unit/ml vial34.14USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339047No1997-05-272014-05-27Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)53 °CArakawa, T. et al., Biosci. Biotechnol. Biochem. 65:1321-1327 (2001)
isoelectric point8.75Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Identical protein binding
Specific Function
Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In som...
Gene Name
EPOR
Uniprot ID
P19235
Uniprot Name
Erythropoietin receptor
Molecular Weight
55064.725 Da
References
  1. LaMontagne KR, Butler J, Marshall DJ, Tullai J, Gechtman Z, Hall C, Meshaw A, Farrell FX: Recombinant epoetins do not stimulate tumor growth in erythropoietin receptor-positive breast carcinoma models. Mol Cancer Ther. 2006 Feb;5(2):347-55. [PubMed:16505108]
  2. Kokhaei P, Abdalla AO, Hansson L, Mikaelsson E, Kubbies M, Haselbeck A, Jernberg-Wiklund H, Mellstedt H, Osterborg A: Expression of erythropoietin receptor and in vitro functional effects of epoetins in B-cell malignancies. Clin Cancer Res. 2007 Jun 15;13(12):3536-44. [PubMed:17575216]
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Drug created on June 13, 2005 07:24 / Updated on November 19, 2017 20:33