Drotrecogin alfa
Identification
- Name
- Drotrecogin alfa
- Accession Number
- DB00055 (BTD00068, BIOD00068)
- Type
- Biotech
- Groups
- Approved, Investigational, Withdrawn
- Biologic Classification
- Protein Based Therapies
Other protein based therapies - Description
Drotrecogin alfa is activated human protein C that is synthesized by recombinant DNA technology. It is a glycoprotein of approximately 55 kilodalton molecular weight, consisting of a heavy chain and a light chain linked by a disulfide bond. Drotrecogin alfa was withdrawn from the market after a major study indicated that it was not effective in improving outcomes in patients with sepsis.
- Protein structure
- Protein chemical formula
- C1786H2779N509O519S29
- Protein average weight
- 55000.0 Da
- Sequences
>Heavy chain LIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLR RWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELN QAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGIL GDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRD KEAPQKSWAP
>Light chain SKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLD NGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL
Download FASTA Format- Synonyms
- Activated protein C
- Blood coagulation factor XIV (human)
- Drotrecogin alfa (activated)
- Drotrecogin alfa (activated), lyophilized
- Drotrecogin alfa activated
- Drotrecogin alfa, activated
- Drotrecogin-alfa
- Recombinant human activated protein C (rH-APC)
- External IDs
- LY203638
- Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Xigris Injection, powder, lyophilized, for solution 5 mg/2.5mL Intravenous Eli Lilly & Co. Ltd. 2001-11-24 2011-10-26 US Xigris Injection, powder, lyophilized, for solution 20 mg/10mL Intravenous Eli Lilly & Co. Ltd. 2001-11-24 2011-10-26 US Xigris (20mg/vial) Powder, for solution 20 mg Intravenous Eli Lilly & Co. Ltd. 2003-03-25 2011-11-14 Canada Xigris (5mg/vial) Powder, for solution 5 mg Intravenous Eli Lilly & Co. Ltd. 2003-02-20 2011-11-14 Canada - Unapproved/Other Products
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Xigris Drotrecogin alfa (20 mg) Injection, powder, for solution Intravenous Eli Lilly Nederland B.V. 2002-08-22 2012-02-21 EU Xigris Drotrecogin alfa (5 mg) Injection, powder, for solution Intravenous Eli Lilly Nederland B.V. 2002-08-22 2012-02-21 EU - International/Other Brands
- Xigris (Eli Lilly & Co)
- Categories
- Amino Acids, Peptides, and Proteins
- Anti-Infective Agents
- Anticoagulants
- Biological Factors
- Blood and Blood Forming Organs
- Blood Coagulation Factor Inhibitors
- Blood Proteins
- Carbohydrates
- Enzyme Precursors
- Enzymes
- Enzymes and Coenzymes
- Fibrinolytic Agents
- Glycoconjugates
- Glycoproteins
- Proteins
- Recombinant Activated Protein C
- UNII
- JGH8MYC891
- CAS number
- 98530-76-8
Pharmacology
- Indication
For reduction of mortality in patients with severe sepsis.
- Pharmacodynamics
Drotrecogin alfa is activated human protein C that is synthesized by recombinant DNA technology. It is a glycoprotein of approximately 55 kilodalton molecular weight, consisting of a heavy chain and a light chain linked by a disulfide bond. Drotrecogin alfa inhibits factor Va and VIIIa, thereby reducing the coagulability of blood.
- Mechanism of action
Activated protein C combines with protein S on platelet surfaces and then degrades factor Va and factor VIIIa, thereby reducing blood coagulability.
Target Actions Organism ACoagulation factor VIII multitargetHumans ACoagulation factor V multitargetHumans UPlasminogen activator inhibitor 1 Not Available Humans UThrombomodulin Not Available Humans UVitamin K-dependent protein S Not Available Humans UCeruloplasmin Not Available Humans UProthrombin Not Available Humans UPlatelet factor 4 Not Available Humans UPlasma serine protease inhibitor Not Available Humans USerpin B6 Not Available Humans UVitamin K-dependent gamma-carboxylase Not Available Humans UEndothelial protein C receptor Not Available Humans - Absorption
- Not Available
- Volume of distribution
- Not Available
- Protein binding
- Not Available
- Metabolism
- Not Available
- Route of elimination
- Not Available
- Half life
5.5 hours (mammalian reticulocytes, in vitro).
- Clearance
- 40 L/hr [severe sepsis adults]
- 30 +/- 8 L/hr [patients without sepsis undergoing hemodialysis]
- 28 +/- 9 L/hr [heathy]
- Toxicity
- Not Available
- Affected organisms
- Humans and other mammals
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
Drug Interaction (1,2,6,7-3H)Testosterone The therapeutic efficacy of Drotrecogin alfa can be increased when used in combination with (1,2,6,7-3H)Testosterone. (R)-warfarin The risk or severity of bleeding can be increased when Drotrecogin alfa is combined with (R)-warfarin. (S)-Warfarin The risk or severity of bleeding can be increased when Drotrecogin alfa is combined with (S)-Warfarin. 1-Testosterone The therapeutic efficacy of Drotrecogin alfa can be increased when used in combination with 1-Testosterone. 18-methyl-19-nortestosterone The therapeutic efficacy of Drotrecogin alfa can be increased when used in combination with 18-methyl-19-nortestosterone. 4-hydroxycoumarin The risk or severity of bleeding can be increased when Drotrecogin alfa is combined with 4-hydroxycoumarin. 4-Hydroxytestosterone The therapeutic efficacy of Drotrecogin alfa can be increased when used in combination with 4-Hydroxytestosterone. 5beta-dihydrotestosterone The therapeutic efficacy of Drotrecogin alfa can be increased when used in combination with 5beta-dihydrotestosterone. Abciximab The risk or severity of bleeding can be increased when Abciximab is combined with Drotrecogin alfa. Aceclofenac The risk or severity of bleeding and hemorrhage can be increased when Aceclofenac is combined with Drotrecogin alfa. - Food Interactions
- Not Available
References
- General References
- Not Available
- External Links
- UniProt
- P04070
- Genbank
- M11228
- PubChem Substance
- 46505655
- Therapeutic Targets Database
- DAP000151
- PharmGKB
- PA131548935
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Drotrecogin_alfa
- ATC Codes
- B01AD10 — Drotrecogin alfa (activated)
- FDA label
- Download (241 KB)
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 0 Completed Treatment Lung Inflammation 1 2 Completed Treatment End Stage Renal Disease (ESRD) 1 2 Completed Treatment Sepsis / Shock, Septic 1 2 Completed Treatment Severe Sepsis 1 2 Completed Treatment Submassive Pulmonary Embolism 1 2 Terminated Treatment Respiratory Distress Syndrome, Adult 1 2 Terminated Treatment Strokes 1 3 Completed Treatment Arterial Hypotension / Sepsis 1 3 Completed Treatment Sepsis 3 4 Completed Treatment Acute Pancreatitis (AP) 1 4 Completed Treatment Hematopoietic Stem Cell Transplantation (HSCT) / Infection NOS / Neoplasms, Hematologic / Sepsis 1 4 Completed Treatment Sepsis 2 4 Completed Treatment Sepsis / Shock, Septic 1 4 Completed Treatment Severe Sepsis 1 4 Completed Treatment Shock, Septic 1 Not Available Completed Not Available Sepsis 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- DSM Corp.
- Eli Lilly & Co.
- Dosage forms
Form Route Strength Injection, powder, for solution Intravenous 20 mg Injection, powder, for solution Intravenous 5 mg Injection, powder, lyophilized, for solution Intravenous 20 mg/10mL Injection, powder, lyophilized, for solution Intravenous 5 mg/2.5mL Powder, for solution Intravenous 20 mg Powder, for solution Intravenous 5 mg - Prices
Unit description Cost Unit Xigris 20 mg vial 1481.66USD vial Xigris 5 mg vial 370.42USD vial DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
Patent Number Pediatric Extension Approved Expires (estimated) CA2139468 No 2007-08-21 2015-01-03 Canada CA2036894 No 2002-01-15 2011-02-22 Canada
Properties
- State
- Liquid
- Experimental Properties
Property Value Source hydrophobicity -0.291 Not Available isoelectric point 6.78 Not Available
Taxonomy
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Multitarget
- General Function
- Oxidoreductase activity
- Specific Function
- Factor VIII, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa.
- Gene Name
- F8
- Uniprot ID
- P00451
- Uniprot Name
- Coagulation factor VIII
- Molecular Weight
- 267007.42 Da
References
- Geng JP, Castellino FJ: Properties of a recombinant chimeric protein in which the gamma-carboxyglutamic acid and helical stack domains of human anticoagulant protein C are replaced by those of human coagulation factor VII. Thromb Haemost. 1997 May;77(5):926-33. [PubMed:9184404]
- Colin G, Annane D: Corticosteroids and human recombinant activated protein C for septic shock. Clin Chest Med. 2008 Dec;29(4):705-12, x. doi: 10.1016/j.ccm.2008.06.009. [PubMed:18954704]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Multitarget
- General Function
- Copper ion binding
- Specific Function
- Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
- Gene Name
- F5
- Uniprot ID
- P12259
- Uniprot Name
- Coagulation factor V
- Molecular Weight
- 251701.245 Da
References
- Bernard GR, Vincent JL, Laterre PF, LaRosa SP, Dhainaut JF, Lopez-Rodriguez A, Steingrub JS, Garber GE, Helterbrand JD, Ely EW, Fisher CJ Jr: Efficacy and safety of recombinant human activated protein C for severe sepsis. N Engl J Med. 2001 Mar 8;344(10):699-709. [PubMed:11236773]
- Kanji S, Devlin JW, Piekos KA, Racine E: Recombinant human activated protein C, drotrecogin alfa (activated): a novel therapy for severe sepsis. Pharmacotherapy. 2001 Nov;21(11):1389-402. [PubMed:11714212]
- Lyseng-Williamson KA, Perry CM: Drotrecogin alfa (activated). Drugs. 2002;62(4):617-30; discussion 631-2. [PubMed:11893230]
- Joyce DE, Grinnell BW: Recombinant human activated protein C attenuates the inflammatory response in endothelium and monocytes by modulating nuclear factor-kappaB. Crit Care Med. 2002 May;30(5 Suppl):S288-93. [PubMed:12004250]
- Poe K: Drotrecogin alfa (activated) approved for treatment of severe sepsis. J Am Pharm Assoc (Wash). 2002 May-Jun;42(3):520-2. [PubMed:12030642]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Serine-type endopeptidase inhibitor activity
- Specific Function
- Serine protease inhibitor. This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, protein C and matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major con...
- Gene Name
- SERPINE1
- Uniprot ID
- P05121
- Uniprot Name
- Plasminogen activator inhibitor 1
- Molecular Weight
- 45059.695 Da
References
- Carr ME: Diabetes mellitus: a hypercoagulable state. J Diabetes Complications. 2001 Jan-Feb;15(1):44-54. [PubMed:11259926]
- Cerchiara E, Tirindelli MC, Giannetti B, Dicuonzo G, Avvisati G: [The numerous properties of the anticoagulant protein C]. Clin Ter. 2007 Mar-Apr;158(2):181-7. [PubMed:17566522]
- Idell S: Endothelium and disordered fibrin turnover in the injured lung: newly recognized pathways. Crit Care Med. 2002 May;30(5 Suppl):S274-80. [PubMed:12004248]
- Dhainaut JF, Yan SB, Margolis BD, Lorente JA, Russell JA, Freebairn RC, Spapen HD, Riess H, Basson B, Johnson G 3rd, Kinasewitz GT: Drotrecogin alfa (activated) (recombinant human activated protein C) reduces host coagulopathy response in patients with severe sepsis. Thromb Haemost. 2003 Oct;90(4):642-53. [PubMed:14515185]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Transmembrane signaling receptor activity
- Specific Function
- Thrombomodulin is a specific endothelial cell receptor that forms a 1:1 stoichiometric complex with thrombin. This complex is responsible for the conversion of protein C to the activated protein C ...
- Gene Name
- THBD
- Uniprot ID
- P07204
- Uniprot Name
- Thrombomodulin
- Molecular Weight
- 60328.72 Da
References
- Gresele P, Agnelli G: Novel approaches to the treatment of thrombosis. Trends Pharmacol Sci. 2002 Jan;23(1):25-32. [PubMed:11804648]
- Pineda AO, Chen ZW, Caccia S, Cantwell AM, Savvides SN, Waksman G, Mathews FS, Di Cera E: The anticoagulant thrombin mutant W215A/E217A has a collapsed primary specificity pocket. J Biol Chem. 2004 Sep 17;279(38):39824-8. Epub 2004 Jul 13. [PubMed:15252033]
- McCachren SS, Diggs J, Weinberg JB, Dittman WA: Thrombomodulin expression by human blood monocytes and by human synovial tissue lining macrophages. Blood. 1991 Dec 15;78(12):3128-32. [PubMed:1660324]
- Shirai T, Shiojiri S, Ito H, Yamamoto S, Kusumoto H, Deyashiki Y, Maruyama I, Suzuki K: Gene structure of human thrombomodulin, a cofactor for thrombin-catalyzed activation of protein C. J Biochem. 1988 Feb;103(2):281-5. [PubMed:2836377]
- Boffa MC, Burke B, Haudenschild C: [Different localization of thrombomodulin]. Ann Biol Clin (Paris). 1987;45(2):191-7. [PubMed:3039877]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Endopeptidase inhibitor activity
- Specific Function
- Anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.
- Gene Name
- PROS1
- Uniprot ID
- P07225
- Uniprot Name
- Vitamin K-dependent protein S
- Molecular Weight
- 75121.905 Da
References
- Cvirn G, Gallistl S, Koestenberger M, Kutschera J, Leschnik B, Muntean W: Alpha 2-macroglobulin enhances prothrombin activation and thrombin potential by inhibiting the anticoagulant protein C/protein S system in cord and adult plasma. Thromb Res. 2002 Mar 1;105(5):433-9. [PubMed:12062545]
- Hesselvik JF, Malm J, Dahlback B, Blomback M: Protein C, protein S and C4b-binding protein in severe infection and septic shock. Thromb Haemost. 1991 Feb 12;65(2):126-9. [PubMed:1828915]
- Cosio FG, Harker C, Batard MA, Brandt JT, Griffin JH: Plasma concentrations of the natural anticoagulants protein C and protein S in patients with proteinuria. J Lab Clin Med. 1985 Aug;106(2):218-22. [PubMed:3160800]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Ferroxidase activity
- Specific Function
- Ceruloplasmin is a blue, copper-binding (6-7 atoms per molecule) glycoprotein. It has ferroxidase activity oxidizing Fe(2+) to Fe(3+) without releasing radical oxygen species. It is involved in iro...
- Gene Name
- CP
- Uniprot ID
- P00450
- Uniprot Name
- Ceruloplasmin
- Molecular Weight
- 122204.45 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Thrombospondin receptor activity
- Specific Function
- Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostas...
- Gene Name
- F2
- Uniprot ID
- P00734
- Uniprot Name
- Prothrombin
- Molecular Weight
- 70036.295 Da
References
- Omar MN, Shouk TA, Khaleq MA: Activity of blood coagulation and fibrinolysis during and after hydroxyethyl starch (HES) colloidal volume replacement. Clin Biochem. 1999 Jun;32(4):269-74. [PubMed:10463819]
- Cvirn G, Gallistl S, Koestenberger M, Kutschera J, Leschnik B, Muntean W: Alpha 2-macroglobulin enhances prothrombin activation and thrombin potential by inhibiting the anticoagulant protein C/protein S system in cord and adult plasma. Thromb Res. 2002 Mar 1;105(5):433-9. [PubMed:12062545]
- Gruber A, Cantwell AM, Di Cera E, Hanson SR: The thrombin mutant W215A/E217A shows safe and potent anticoagulant and antithrombotic effects in vivo. J Biol Chem. 2002 Aug 2;277(31):27581-4. Epub 2002 Jun 17. [PubMed:12070133]
- Conway EM, Van de Wouwer M, Pollefeyt S, Jurk K, Van Aken H, De Vriese A, Weitz JI, Weiler H, Hellings PW, Schaeffer P, Herbert JM, Collen D, Theilmeier G: The lectin-like domain of thrombomodulin confers protection from neutrophil-mediated tissue damage by suppressing adhesion molecule expression via nuclear factor kappaB and mitogen-activated protein kinase pathways. J Exp Med. 2002 Sep 2;196(5):565-77. [PubMed:12208873]
- Levi M, De Jonge E, van der Poll T: Recombinant human activated protein C (Xigris). Int J Clin Pract. 2002 Sep;56(7):542-5. [PubMed:12296618]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Heparin binding
- Specific Function
- Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Che...
- Gene Name
- PF4
- Uniprot ID
- P02776
- Uniprot Name
- Platelet factor 4
- Molecular Weight
- 10844.78 Da
References
- Carr ME: Diabetes mellitus: a hypercoagulable state. J Diabetes Complications. 2001 Jan-Feb;15(1):44-54. [PubMed:11259926]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Serine-type endopeptidase inhibitor activity
- Specific Function
- Heparin-dependent serine protease inhibitor acting in body fluids and secretions. Inactivates serine proteases by binding irreversibly to their serine activation site. Involved in the regulation of...
- Gene Name
- SERPINA5
- Uniprot ID
- P05154
- Uniprot Name
- Plasma serine protease inhibitor
- Molecular Weight
- 45674.315 Da
References
- Shen L, Villoutreix BO, Dahlback B: Involvement of Lys 62(217) and Lys 63(218) of human anticoagulant protein C in heparin stimulation of inhibition by the protein C inhibitor. Thromb Haemost. 1999 Jul;82(1):72-9. [PubMed:10456457]
- He X, Shen L, Bjartell A, Malm J, Lilja H, Dahlback B: The gene encoding vitamin K-dependent anticoagulant protein C is expressed in human male reproductive tissues. J Histochem Cytochem. 1995 Jun;43(6):563-70. [PubMed:7769227]
- Kobayashi H, Gabazza EC, Taguchi O, Wada H, Takeya H, Nishioka J, Yasui H, Kobayashi T, Hataji O, Suzuki K, Adachi Y: Protein C anticoagulant system in patients with interstitial lung disease. Am J Respir Crit Care Med. 1998 Jun;157(6 Pt 1):1850-4. [PubMed:9620917]
- Hayashi T, Suzuki K: [Molecular biology of protein C-thrombomodulin pathway. Structure and function, and basic studies on its clinical application]. Nihon Rinsho. 1993 Jun;51(6):1610-9. [PubMed:8391599]
- Berg DT, Gerlitz B, Shang J, Smith T, Santa P, Richardson MA, Kurz KD, Grinnell BW, Mace K, Jones BE: Engineering the proteolytic specificity of activated protein C improves its pharmacological properties. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4423-8. Epub 2003 Apr 1. [PubMed:12671072]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Serine-type endopeptidase inhibitor activity
- Specific Function
- May be involved in the regulation of serine proteinases present in the brain or extravasated from the blood (By similarity). Inhibitor of cathepsin G, kallikrein-8 and thrombin. May play an importa...
- Gene Name
- SERPINB6
- Uniprot ID
- P35237
- Uniprot Name
- Serpin B6
- Molecular Weight
- 42621.575 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Gamma-glutamyl carboxylase activity
- Specific Function
- Mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vit...
- Gene Name
- GGCX
- Uniprot ID
- P38435
- Uniprot Name
- Vitamin K-dependent gamma-carboxylase
- Molecular Weight
- 87560.065 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Receptor activity
- Specific Function
- Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.
- Gene Name
- PROCR
- Uniprot ID
- Q9UNN8
- Uniprot Name
- Endothelial protein C receptor
- Molecular Weight
- 26671.245 Da
References
- Fukudome K, Ye X, Tsuneyoshi N, Tokunaga O, Sugawara K, Mizokami H, Kimoto M: Activation mechanism of anticoagulant protein C in large blood vessels involving the endothelial cell protein C receptor. J Exp Med. 1998 Apr 6;187(7):1029-35. [PubMed:9529319]
- Ruf W, Dorfleutner A, Riewald M: Specificity of coagulation factor signaling. J Thromb Haemost. 2003 Jul;1(7):1495-503. [PubMed:12871285]
- Castellino FJ, Liang Z, Volkir SP, Haalboom E, Martin JA, Sandoval-Cooper MJ, Rosen ED: Mice with a severe deficiency of the endothelial protein C receptor gene develop, survive, and reproduce normally, and do not present with enhanced arterial thrombosis after challenge. Thromb Haemost. 2002 Sep;88(3):462-72. [PubMed:12353077]
- Cerchiara E, Tirindelli MC, Giannetti B, Dicuonzo G, Avvisati G: [The numerous properties of the anticoagulant protein C]. Clin Ter. 2007 Mar-Apr;158(2):181-7. [PubMed:17566522]
- Liaw PC: Endogenous protein C activation in patients with severe sepsis. Crit Care Med. 2004 May;32(5 Suppl):S214-8. [PubMed:15118520]
Drug created on June 13, 2005 07:24 / Updated on January 02, 2019 21:22