You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameMecasermin
Accession NumberDB01277
TypeBiotech
GroupsApproved, Investigational
DescriptionMecasermin contains recombinant-DNA-engineered human insulin-like growth factor-1 (rhIGF-1). IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1.
Protein structureDb01277
Related Articles
Protein chemical formulaC331H518N94O101S7
Protein average weight7649.0 Da
Sequences
>Mecasermin
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY
CAPLKPAKSA
Download FASTA Format
Synonyms
IGF-1
IGF1
Insulin-like growth factor 1
Mecasermin recombinant
Mecasermin rinfabate
Mecasermin rinfabate recombinant
Mechano growth factor
Somatomedin-C
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
IncrelexInjection, solution40 mg/4mLSubcutaneousIpsen Biopharmaceuticals, Inc.2006-01-03Not applicableUs
IncrelexInjection, solution10 mg/mlSubcutaneousIpsen Pharma2007-08-03Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
IplexNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII7GR9I2683O
CAS number68562-41-4
Pharmacology
IndicationFor the long-term treatment of growth failure in pediatric patients with Primary IGFD or with GH gene deletion who have developed neutralizing antibodies to GH. It is not indicated to treat Secondary IGFD resulting from GH deficiency, malnutrition, hypothyroidism or other causes; it is not a substitute for GH therapy.
Structured Indications
PharmacodynamicsMecasermin is a biosynthetic (recombinant DNA origin) form of human insulin growth factor 1 (IGF-1) designed to replace natural IGF-1 in pediatric patients who are deficient, promoting normalized statural growth. Growth hormones (GH) bind to growth hormone receptors (GHR) in the liver and other tissues, which stimulates the synthesis of IGF-1. In target tissues, IGF-1 activates the IGF-1 receptor, resulting in intracellular signals that stimulate growth. Although many actions of the GH are mediated through IGF-1, the precise roles of GH and IGF-1 have not been fully elucidated. Patients with severe primary IGF-1 deficiency (Primary IGFD) fail to produce adequate levels of IGF-1, due to disruption of the GH pathway used to promote IGF-1 release (possible GH pathway disruptions include mutations in the GHR, post-GHR signaling pathway, and IGF-1 gene defects).
Mechanism of actionMecasermin supplies recombinant-DNA-origin IGF-1, which binds to the Type I IGF-1 receptor. This receptor exerts intra-cellular signaling activity in a number of processes involved in statural growth, including mitogenesis in multiple tissue types, chondrocyte growth and division along cartilage growth plates, and increases in organ growth.
TargetKindPharmacological actionActionsOrganismUniProt ID
Insulin-like growth factor 1 receptorProteinyes
agonist
HumanP08069 details
Insulin-like growth factor-binding protein 3ProteinunknownNot AvailableHumanP17936 details
Insulin receptorProteinunknownNot AvailableHumanP06213 details
Cation-independent mannose-6-phosphate receptorProteinunknownNot AvailableHumanP11717 details
Related Articles
AbsorptionWhile the bioavailability of rhIGF-1 after subcutaneous administration in healthy subjects has been reported to be close to 100%, the absolute bioavailability of mecasermin given subcutaneously to subjects with primary insulin-like growth factor-1 deficiency (Primary IGFD) has not been determined.
Volume of distribution
  • 0.257 ± 0.073 L/kg [subjects with severe Primary IGFD]
Protein bindingIn blood, IGF-1 is bound to six IGF binding proteins, with > 80% bound as a complex with IGFBP-3 and an acid-labile subunit.
Metabolism

Both the liver and the kidney have been shown to metabolize IGF-1.

Route of eliminationBoth the liver and the kidney have been shown to metabolize IGF-1.
Half life2 hours
ClearanceNot Available
ToxicityThere is no clinical experience with overdosage of mecasermin. Based on known pharmacological effects, acute overdosage would be predicted to lead to hypoglycemia. Long-term overdosage may result in signs and symptoms of acromegaly.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Mecasermin.Experimental
AcarboseAcarbose may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Mecasermin.Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
AicarAicar may increase the hypoglycemic activities of Mecasermin.Experimental
AlogliptinAlogliptin may increase the hypoglycemic activities of Mecasermin.Approved
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Mecasermin.Approved
BalaglitazoneBalaglitazone may increase the hypoglycemic activities of Mecasermin.Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
BenmoxinBenmoxin may increase the hypoglycemic activities of Mecasermin.Withdrawn
BuforminBuformin may increase the hypoglycemic activities of Mecasermin.Withdrawn
CanagliflozinCanagliflozin may increase the hypoglycemic activities of Mecasermin.Approved
CaroxazoneCaroxazone may increase the hypoglycemic activities of Mecasermin.Withdrawn
CastanospermineCastanospermine may increase the hypoglycemic activities of Mecasermin.Experimental
ChlorpropamideChlorpropamide may increase the hypoglycemic activities of Mecasermin.Approved
CiglitazoneCiglitazone may increase the hypoglycemic activities of Mecasermin.Experimental
CinoxacinCinoxacin may increase the hypoglycemic activities of Mecasermin.Approved, Withdrawn
CiprofloxacinCiprofloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
CitalopramCitalopram may increase the hypoglycemic activities of Mecasermin.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Mecasermin.Investigational
DeoxyspergualinDeoxyspergualin may increase the hypoglycemic activities of Mecasermin.Investigational
dersalazinedersalazine may increase the hypoglycemic activities of Mecasermin.Investigational
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Mecasermin.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Mecasermin.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Mecasermin.Illicit
DisopyramideDisopyramide may increase the hypoglycemic activities of Mecasermin.Approved
DulaglutideDulaglutide may increase the hypoglycemic activities of Mecasermin.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Mecasermin.Approved
EmpagliflozinEmpagliflozin may increase the hypoglycemic activities of Mecasermin.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Mecasermin.Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Mecasermin.Approved
ExenatideExenatide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
FleroxacinFleroxacin may increase the hypoglycemic activities of Mecasermin.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Mecasermin.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Mecasermin.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
FurazolidoneFurazolidone may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Mecasermin.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
GlibornurideGlibornuride may increase the hypoglycemic activities of Mecasermin.Withdrawn
GliclazideGliclazide may increase the hypoglycemic activities of Mecasermin.Approved
GlimepirideGlimepiride may increase the hypoglycemic activities of Mecasermin.Approved
GlipizideGlipizide may increase the hypoglycemic activities of Mecasermin.Approved
GliquidoneGliquidone may increase the hypoglycemic activities of Mecasermin.Approved
GlyburideGlyburide may increase the hypoglycemic activities of Mecasermin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Mecasermin.Withdrawn
GusperimusGusperimus may increase the hypoglycemic activities of Mecasermin.Investigational
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Mecasermin.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Mecasermin.Investigational, Withdrawn
Insulin AspartMecasermin may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirMecasermin may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineInsulin Glargine may increase the hypoglycemic activities of Mecasermin.Approved
Insulin GlulisineMecasermin may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanInsulin Human may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Insulin LisproInsulin Lispro may increase the hypoglycemic activities of Mecasermin.Approved
Insulin PorkInsulin Pork may increase the hypoglycemic activities of Mecasermin.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Mecasermin.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Mecasermin.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Mecasermin.Approved
LanreotideMecasermin may increase the hypoglycemic activities of Lanreotide.Approved
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Mecasermin.Approved
LinagliptinLinagliptin may increase the hypoglycemic activities of Mecasermin.Approved
LiraglutideLiraglutide may increase the hypoglycemic activities of Mecasermin.Approved
LomefloxacinLomefloxacin may increase the hypoglycemic activities of Mecasermin.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
MesalazineMesalazine may increase the hypoglycemic activities of Mecasermin.Approved
MetforminMetformin may increase the hypoglycemic activities of Mecasermin.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Mecasermin.Investigational
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Mecasermin.Approved
MifepristoneMifepristone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
MiglitolMiglitol may increase the hypoglycemic activities of Mecasermin.Approved
MiglustatMiglustat may increase the hypoglycemic activities of Mecasermin.Approved
MilnacipranMilnacipran may increase the hypoglycemic activities of Mecasermin.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Mecasermin.Approved
MitiglinideMitiglinide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
MoclobemideMoclobemide may increase the hypoglycemic activities of Mecasermin.Approved
MoxifloxacinMoxifloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Mecasermin.Approved
NateglinideNateglinide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
NCX 4016NCX 4016 may increase the hypoglycemic activities of Mecasermin.Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Mecasermin.Approved, Withdrawn
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Mecasermin.Investigational
NialamideNialamide may increase the hypoglycemic activities of Mecasermin.Withdrawn
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Mecasermin.Investigational
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Mecasermin.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Mecasermin.Withdrawn
OctreotideOctreotide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
OfloxacinOfloxacin may increase the hypoglycemic activities of Mecasermin.Approved
OlsalazineOlsalazine may increase the hypoglycemic activities of Mecasermin.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
OxymetholoneOxymetholone may increase the hypoglycemic activities of Mecasermin.Approved, Illicit
PargylinePargyline may increase the hypoglycemic activities of Mecasermin.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
PasireotideMecasermin may increase the hypoglycemic activities of Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Mecasermin.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Mecasermin.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Mecasermin.Approved
PentamidinePentamidine may increase the hypoglycemic activities of Mecasermin.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Mecasermin.Approved
PhenforminPhenformin may increase the hypoglycemic activities of Mecasermin.Approved, Withdrawn
PheniprazinePheniprazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
PioglitazonePioglitazone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
PirlindolePirlindole may increase the hypoglycemic activities of Mecasermin.Approved
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
PramlintidePramlintide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Mecasermin.Investigational
QuinineQuinine may increase the hypoglycemic activities of Mecasermin.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Mecasermin.Approved
RepaglinideRepaglinide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
RosiglitazoneRosiglitazone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Mecasermin.Approved
SafrazineSafrazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
SaxagliptinSaxagliptin may increase the hypoglycemic activities of Mecasermin.Approved
SelegilineSelegiline may increase the hypoglycemic activities of Mecasermin.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Mecasermin.Approved
SitagliptinSitagliptin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Mecasermin.Approved
StanozololStanozolol may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
SulfadiazineSulfadiazine may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
SulfamethoxazoleSulfamethoxazole may increase the hypoglycemic activities of Mecasermin.Approved
SulfisoxazoleSulfisoxazole may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
SulodexideSulodexide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
SunitinibSunitinib may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Mecasermin.Withdrawn
TestosteroneTestosterone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
ThiazolidinedioneThiazolidinedione may increase the hypoglycemic activities of Mecasermin.Investigational
TolazamideTolazamide may increase the hypoglycemic activities of Mecasermin.Approved
TolbutamideTolbutamide may increase the hypoglycemic activities of Mecasermin.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Mecasermin.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Mecasermin.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Mecasermin.Approved
TroglitazoneTroglitazone may increase the hypoglycemic activities of Mecasermin.Withdrawn
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Mecasermin.Approved
VildagliptinVildagliptin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
VogliboseVoglibose may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Mecasermin.Withdrawn
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Keating GM: Mecasermin. BioDrugs. 2008;22(3):177-88. [PubMed:18481900 ]
  2. Rosenbloom AL: Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54. doi: 10.1007/s12325-008-0136-5. Epub 2009 Jan 28. [PubMed:19198769 ]
  3. Kemp SF: Insulin-like growth factor-I deficiency in children with growth hormone insensitivity: current and future treatment options. BioDrugs. 2009;23(3):155-63. doi: 10.2165/00063030-200923030-00002. [PubMed:19627167 ]
  4. Rosenbloom AL: Is there a role for recombinant insulin-like growth factor-I in the treatment of idiopathic short stature? Lancet. 2006 Aug 12;368(9535):612-6. [PubMed:16905026 ]
  5. Lewis ME, Neff NT, Contreras PC, Stong DB, Oppenheim RW, Grebow PE, Vaught JL: Insulin-like growth factor-I: potential for treatment of motor neuronal disorders. Exp Neurol. 1993 Nov;124(1):73-88. [PubMed:8282084 ]
External Links
ATC CodesH01AC05H01AC03
AHFS CodesNot Available
PDB Entries
FDA labelDownload (490 KB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous10 mg/ml
Injection, solutionSubcutaneous40 mg/4mL
Prices
Unit descriptionCostUnit
Increlex 40 mg/4 ml vial232.8USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5200509 No1993-04-062010-04-06Us
US5681814 No1997-09-182017-09-18Us
Properties
StateLiquid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation,...
Gene Name:
IGF1R
Uniprot ID:
P08069
Molecular Weight:
154791.73 Da
References
  1. Rosenbloom AL: Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54. doi: 10.1007/s12325-008-0136-5. Epub 2009 Jan 28. [PubMed:19198769 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Protein tyrosine phosphatase activator activity
Specific Function:
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R.
Gene Name:
IGFBP3
Uniprot ID:
P17936
Molecular Weight:
31673.87 Da
References
  1. Kemp SF: Insulin-like growth factor-I deficiency in children with growth hormone insensitivity: current and future treatment options. BioDrugs. 2009;23(3):155-63. doi: 10.2165/00063030-200923030-00002. [PubMed:19627167 ]
  2. Williams RM, McDonald A, O'Savage M, Dunger DB: Mecasermin rinfabate: rhIGF-I/rhIGFBP-3 complex: iPLEX. Expert Opin Drug Metab Toxicol. 2008 Mar;4(3):311-24. doi: 10.1517/17425255.4.3.311 . [PubMed:18363546 ]
  3. Authors unspecified: Mecasermin rinfabate: insulin-like growth factor-I/insulin-like growth factor binding protein-3, mecaserimin rinfibate, rhIGF-I/rhIGFBP-3. Drugs R D. 2005;6(2):120-7. [PubMed:15777106 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 ...
Gene Name:
INSR
Uniprot ID:
P06213
Molecular Weight:
156331.465 Da
References
  1. Rosenbloom AL: Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54. doi: 10.1007/s12325-008-0136-5. Epub 2009 Jan 28. [PubMed:19198769 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transporter activity
Specific Function:
Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This receptor a...
Gene Name:
IGF2R
Uniprot ID:
P11717
Molecular Weight:
274372.42 Da
References
  1. Rosenbloom AL: Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54. doi: 10.1007/s12325-008-0136-5. Epub 2009 Jan 28. [PubMed:19198769 ]
Comments
comments powered by Disqus
Drug created on May 16, 2007 14:46 / Updated on December 02, 2016 02:43