Identification

Name
Mecasermin
Accession Number
DB01277
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Hormones
Description

Mecasermin contains recombinant-DNA-engineered human insulin-like growth factor-1 (rhIGF-1). IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1.

Protein structure
Db01277
Protein chemical formula
C331H518N94O101S7
Protein average weight
7649.0 Da
Sequences
>Mecasermin
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY
CAPLKPAKSA
Download FASTA Format
Synonyms
  • IGF-1
  • IGF1
  • Insulin-like growth factor 1
  • Mecasermin recombinant
  • Mecasermin rinfabate
  • Mecasermin rinfabate recombinant
  • Mechano growth factor
  • Somatomedin-C
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
IncrelexInjection, solution10 mg/mlSubcutaneousIpsen Pharma2007-08-03Not applicableEu
IncrelexInjection, solution40 mg/4mLSubcutaneousIpsen Biopharmaceuticals, Inc.2006-01-03Not applicableUs
International/Other Brands
Iplex
Categories
UNII
7GR9I2683O
CAS number
68562-41-4

Pharmacology

Indication

For the long-term treatment of growth failure in pediatric patients with Primary IGFD or with GH gene deletion who have developed neutralizing antibodies to GH. It is not indicated to treat Secondary IGFD resulting from GH deficiency, malnutrition, hypothyroidism or other causes; it is not a substitute for GH therapy.

Structured Indications
Pharmacodynamics

Mecasermin is a biosynthetic (recombinant DNA origin) form of human insulin growth factor 1 (IGF-1) designed to replace natural IGF-1 in pediatric patients who are deficient, promoting normalized statural growth. Growth hormones (GH) bind to growth hormone receptors (GHR) in the liver and other tissues, which stimulates the synthesis of IGF-1. In target tissues, IGF-1 activates the IGF-1 receptor, resulting in intracellular signals that stimulate growth. Although many actions of the GH are mediated through IGF-1, the precise roles of GH and IGF-1 have not been fully elucidated. Patients with severe primary IGF-1 deficiency (Primary IGFD) fail to produce adequate levels of IGF-1, due to disruption of the GH pathway used to promote IGF-1 release (possible GH pathway disruptions include mutations in the GHR, post-GHR signaling pathway, and IGF-1 gene defects).

Mechanism of action

Mecasermin supplies recombinant-DNA-origin IGF-1, which binds to the Type I IGF-1 receptor. This receptor exerts intra-cellular signaling activity in a number of processes involved in statural growth, including mitogenesis in multiple tissue types, chondrocyte growth and division along cartilage growth plates, and increases in organ growth.

TargetActionsOrganism
AInsulin-like growth factor 1 receptor
agonist
Human
UInsulin-like growth factor-binding protein 3Not AvailableHuman
UInsulin receptorNot AvailableHuman
UCation-independent mannose-6-phosphate receptorNot AvailableHuman
Absorption

While the bioavailability of rhIGF-1 after subcutaneous administration in healthy subjects has been reported to be close to 100%, the absolute bioavailability of mecasermin given subcutaneously to subjects with primary insulin-like growth factor-1 deficiency (Primary IGFD) has not been determined.

Volume of distribution
  • 0.257 ± 0.073 L/kg [subjects with severe Primary IGFD]
Protein binding

In blood, IGF-1 is bound to six IGF binding proteins, with > 80% bound as a complex with IGFBP-3 and an acid-labile subunit.

Metabolism

Both the liver and the kidney have been shown to metabolize IGF-1.

Route of elimination

Both the liver and the kidney have been shown to metabolize IGF-1.

Half life

2 hours

Clearance
Not Available
Toxicity

There is no clinical experience with overdosage of mecasermin. Based on known pharmacological effects, acute overdosage would be predicted to lead to hypoglycemia. Long-term overdosage may result in signs and symptoms of acromegaly.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
2,4-thiazolidinedione2,4-thiazolidinedione may increase the hypoglycemic activities of Mecasermin.Investigational
7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline may increase the hypoglycemic activities of Mecasermin.Experimental
AcarboseAcarbose may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Mecasermin.Investigational, Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
AICA ribonucleotideAICA ribonucleotide may increase the hypoglycemic activities of Mecasermin.Experimental, Investigational
AlaproclateAlaproclate may increase the hypoglycemic activities of Mecasermin.Experimental
AllicinAllicin may increase the hypoglycemic activities of Mecasermin.Investigational
AlogliptinAlogliptin may increase the hypoglycemic activities of Mecasermin.Approved
AloxiprinAloxiprin may increase the hypoglycemic activities of Mecasermin.Experimental
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Mecasermin.Approved
AmphetamineAmphetamine may increase the hypoglycemic activities of Mecasermin.Approved, Illicit
BalaglitazoneBalaglitazone may increase the hypoglycemic activities of Mecasermin.Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Bempedoic acidBempedoic acid may increase the hypoglycemic activities of Mecasermin.Investigational
BenmoxinBenmoxin may increase the hypoglycemic activities of Mecasermin.Withdrawn
BrofaromineBrofaromine may increase the hypoglycemic activities of Mecasermin.Experimental
BuforminBuformin may increase the hypoglycemic activities of Mecasermin.Investigational, Withdrawn
CanagliflozinCanagliflozin may increase the hypoglycemic activities of Mecasermin.Approved
CarbutamideCarbutamide may increase the hypoglycemic activities of Mecasermin.Experimental
CaroxazoneCaroxazone may increase the hypoglycemic activities of Mecasermin.Withdrawn
CastanospermineCastanospermine may increase the hypoglycemic activities of Mecasermin.Experimental
ChlorpropamideChlorpropamide may increase the hypoglycemic activities of Mecasermin.Approved
CiglitazoneCiglitazone may increase the hypoglycemic activities of Mecasermin.Experimental
CinoxacinCinoxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational, Withdrawn
CitalopramCitalopram may increase the hypoglycemic activities of Mecasermin.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Mecasermin.Investigational
DeoxyspergualinDeoxyspergualin may increase the hypoglycemic activities of Mecasermin.Investigational
dersalazinedersalazine may increase the hypoglycemic activities of Mecasermin.Investigational
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Mecasermin.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Mecasermin.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Mecasermin.Illicit
DisopyramideDisopyramide may increase the hypoglycemic activities of Mecasermin.Approved
DulaglutideDulaglutide may increase the hypoglycemic activities of Mecasermin.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Mecasermin.Approved
EmpagliflozinEmpagliflozin may increase the hypoglycemic activities of Mecasermin.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
EscitalopramEscitalopram may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Mecasermin.Withdrawn
ExenatideExenatide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
FleroxacinFleroxacin may increase the hypoglycemic activities of Mecasermin.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Mecasermin.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Mecasermin.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
FurazolidoneFurazolidone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational, Vet Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Mecasermin.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
GlibornurideGlibornuride may increase the hypoglycemic activities of Mecasermin.Investigational, Withdrawn
GliclazideGliclazide may increase the hypoglycemic activities of Mecasermin.Approved
GlimepirideGlimepiride may increase the hypoglycemic activities of Mecasermin.Approved
GlipizideGlipizide may increase the hypoglycemic activities of Mecasermin.Approved
GliquidoneGliquidone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
GLPG-0492GLPG-0492 may increase the hypoglycemic activities of Mecasermin.Investigational
GlyburideGlyburide may increase the hypoglycemic activities of Mecasermin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Mecasermin.Investigational, Withdrawn
GuacetisalGuacetisal may increase the hypoglycemic activities of Mecasermin.Experimental
GusperimusGusperimus may increase the hypoglycemic activities of Mecasermin.Investigational
HarmalineHarmaline may increase the hypoglycemic activities of Mecasermin.Experimental
Hemoglobin crosfumarilHemoglobin crosfumaril may increase the hypoglycemic activities of Mecasermin.Experimental
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Mecasermin.Experimental
IndalpineIndalpine may increase the hypoglycemic activities of Mecasermin.Investigational, Withdrawn
Insulin AspartMecasermin may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirMecasermin may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineInsulin Glargine may increase the hypoglycemic activities of Mecasermin.Approved
Insulin GlulisineMecasermin may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanInsulin Human may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Insulin LisproInsulin Lispro may increase the hypoglycemic activities of Mecasermin.Approved
Insulin PorkInsulin Pork may increase the hypoglycemic activities of Mecasermin.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Mecasermin.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Mecasermin.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Mecasermin.Approved
LanreotideMecasermin may increase the hypoglycemic activities of Lanreotide.Approved
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Mecasermin.Approved
LinagliptinLinagliptin may increase the hypoglycemic activities of Mecasermin.Approved
LiraglutideLiraglutide may increase the hypoglycemic activities of Mecasermin.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
MesalazineMesalazine may increase the hypoglycemic activities of Mecasermin.Approved
MesteroloneMesterolone may increase the hypoglycemic activities of Mecasermin.Experimental
MetforminMetformin may increase the hypoglycemic activities of Mecasermin.Approved
Methyl salicylateMethyl salicylate may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Mecasermin.Approved
MifepristoneMifepristone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
MiglitolMiglitol may increase the hypoglycemic activities of Mecasermin.Approved
MiglustatMiglustat may increase the hypoglycemic activities of Mecasermin.Approved
MilnacipranMilnacipran may increase the hypoglycemic activities of Mecasermin.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Mecasermin.Approved
MitiglinideMitiglinide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
MoclobemideMoclobemide may increase the hypoglycemic activities of Mecasermin.Approved
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
NandroloneNandrolone may increase the hypoglycemic activities of Mecasermin.Experimental, Investigational
Nandrolone decanoateNandrolone decanoate may increase the hypoglycemic activities of Mecasermin.Approved, Illicit
NateglinideNateglinide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Mecasermin.Approved, Withdrawn
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Mecasermin.Investigational
NialamideNialamide may increase the hypoglycemic activities of Mecasermin.Withdrawn
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Mecasermin.Investigational
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Mecasermin.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Mecasermin.Withdrawn
OctreotideOctreotide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Mecasermin.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Oxolinic acidOxolinic acid may increase the hypoglycemic activities of Mecasermin.Experimental
OxymetholoneOxymetholone may increase the hypoglycemic activities of Mecasermin.Approved, Illicit
PargylinePargyline may increase the hypoglycemic activities of Mecasermin.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
PasireotideMecasermin may increase the hypoglycemic activities of Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Mecasermin.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Mecasermin.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Mecasermin.Approved
PentamidinePentamidine may increase the hypoglycemic activities of Mecasermin.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Mecasermin.Approved
PhenforminPhenformin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational, Withdrawn
PheniprazinePheniprazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
PioglitazonePioglitazone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Pipemidic acidPipemidic acid may increase the hypoglycemic activities of Mecasermin.Experimental
PirlindolePirlindole may increase the hypoglycemic activities of Mecasermin.Approved
Piromidic acidPiromidic acid may increase the hypoglycemic activities of Mecasermin.Experimental
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
PramlintidePramlintide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
ProcarbazineProcarbazine may increase the hypoglycemic activities of Mecasermin.Approved
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Mecasermin.Investigational
QuinineQuinine may increase the hypoglycemic activities of Mecasermin.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Mecasermin.Approved
RepaglinideRepaglinide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
RosiglitazoneRosiglitazone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
RufloxacinRufloxacin may increase the hypoglycemic activities of Mecasermin.Experimental
SafrazineSafrazine may increase the hypoglycemic activities of Mecasermin.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
SaxagliptinSaxagliptin may increase the hypoglycemic activities of Mecasermin.Approved
SelegilineSelegiline may increase the hypoglycemic activities of Mecasermin.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Mecasermin.Approved
SitafloxacinSitafloxacin may increase the hypoglycemic activities of Mecasermin.Experimental, Investigational
SitagliptinSitagliptin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
SotagliflozinSotagliflozin may increase the hypoglycemic activities of Mecasermin.Investigational
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
StanozololStanozolol may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
SulfadiazineSulfadiazine may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
SulfamethoxazoleSulfamethoxazole may increase the hypoglycemic activities of Mecasermin.Approved
SulfisoxazoleSulfisoxazole may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
SulodexideSulodexide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
SunitinibSunitinib may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Mecasermin.Withdrawn
TestosteroneTestosterone may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Testosterone PropionateTestosterone Propionate may increase the hypoglycemic activities of Mecasermin.Approved, Vet Approved
TolazamideTolazamide may increase the hypoglycemic activities of Mecasermin.Approved
TolbutamideTolbutamide may increase the hypoglycemic activities of Mecasermin.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Mecasermin.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Mecasermin.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Mecasermin.Approved
TroglitazoneTroglitazone may increase the hypoglycemic activities of Mecasermin.Investigational, Withdrawn
Trolamine salicylateTrolamine salicylate may increase the hypoglycemic activities of Mecasermin.Approved
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Mecasermin.Approved
VildagliptinVildagliptin may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
VogliboseVoglibose may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Mecasermin.Withdrawn
Food Interactions
Not Available

References

General References
  1. Keating GM: Mecasermin. BioDrugs. 2008;22(3):177-88. [PubMed:18481900]
  2. Rosenbloom AL: Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54. doi: 10.1007/s12325-008-0136-5. Epub 2009 Jan 28. [PubMed:19198769]
  3. Kemp SF: Insulin-like growth factor-I deficiency in children with growth hormone insensitivity: current and future treatment options. BioDrugs. 2009;23(3):155-63. doi: 10.2165/00063030-200923030-00002. [PubMed:19627167]
  4. Rosenbloom AL: Is there a role for recombinant insulin-like growth factor-I in the treatment of idiopathic short stature? Lancet. 2006 Aug 12;368(9535):612-6. [PubMed:16905026]
  5. Lewis ME, Neff NT, Contreras PC, Stong DB, Oppenheim RW, Grebow PE, Vaught JL: Insulin-like growth factor-I: potential for treatment of motor neuronal disorders. Exp Neurol. 1993 Nov;124(1):73-88. [PubMed:8282084]
External Links
KEGG Drug
D04870
PubChem Substance
46504889
ChEMBL
CHEMBL1201716
Therapeutic Targets Database
DAP000287
PharmGKB
PA164774876
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
ATC Codes
H01AC05 — Mecasermin rinfabateH01AC03 — Mecasermin
FDA label
Download (490 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedTreatmentRett's Syndrome1
1TerminatedTreatmentCystic Fibrosis (CF)1
1TerminatedTreatmentHIV Lipodystrophy1
1, 2Active Not RecruitingTreatmentShort Stature1
1, 2CompletedNot AvailableAnorexia Nervosa (AN)1
1, 2CompletedTreatmentHeart Failure, Unspecified / Myocardial Infarction (MI)1
1, 2CompletedTreatmentSteinert's Disease1
1, 2TerminatedTreatmentGrowth Failure / Growth Hormone Resistence / X-linked Severe Combined Immunodeficiency (XSCID)1
1, 2Unknown StatusTreatmentDuchenne's Muscular Dystrophy (DMD)1
2CompletedPreventionRetinopathy of Prematurity / Retinopathy of Prematurity (ROP)1
2CompletedTreatment22q13 Deletion Syndrome / Phelan-McDermid Syndrome1
2CompletedTreatmentRett's Syndrome1
2RecruitingTreatmentAutism Spectrum Conditions/Disorders1
2TerminatedTreatmentInsulin-Like Growth Factor-1 Deficiency1
2, 3CompletedTreatmentGrowth Hormone Insensitivity Syndrome (GHIS)1
2, 3CompletedTreatmentMinor burns1
2, 3Not Yet RecruitingPreventionChronic Lung Disease of Prematurity / Intraventricular Hemorrhage / Retinopathy of Prematurity (ROP)1
2, 3TerminatedTreatmentCrohn's Disease (CD)1
3CompletedNot AvailableDiabetes Mellitus (DM)1
3CompletedTreatmentAmyotrophic Lateral Sclerosis (ALS)1
3CompletedTreatmentGrowth Disorders / Insulin-Like Growth Factor-1 Deficiency1
3RecruitingTreatmentAnorexia Nervosa (AN)1
3TerminatedTreatmentGrowth Disorders1
Not AvailableCompletedBasic ScienceDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedBasic ScienceEhlers-Danlos Syndrome, Classic1
Not AvailableEnrolling by InvitationNot AvailableRetinopathy of Prematurity (ROP)1
Not AvailableRecruitingNot AvailableIGF1 Deficiency1
Not AvailableRecruitingTreatmentAnorexia Nervosa (AN) / Bone destruction / Osteopenia1
Not AvailableTerminatedNot AvailablePrimary Insulin-like Growth Factor-1 Deficiency1
Not AvailableWithdrawnTreatmentChronic Liver Diseases (CLD) / Growth Failure1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous10 mg/ml
Injection, solutionSubcutaneous40 mg/4mL
Prices
Unit descriptionCostUnit
Increlex 40 mg/4 ml vial232.8USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5200509No1993-04-062010-04-06Us
US5681814No1997-09-182017-09-18Us

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Protein tyrosine kinase activity
Specific Function
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involv...
Gene Name
IGF1R
Uniprot ID
P08069
Uniprot Name
Insulin-like growth factor 1 receptor
Molecular Weight
154791.73 Da
References
  1. Rosenbloom AL: Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54. doi: 10.1007/s12325-008-0136-5. Epub 2009 Jan 28. [PubMed:19198769]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Protein tyrosine phosphatase activator activity
Specific Function
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGF...
Gene Name
IGFBP3
Uniprot ID
P17936
Uniprot Name
Insulin-like growth factor-binding protein 3
Molecular Weight
31673.87 Da
References
  1. Kemp SF: Insulin-like growth factor-I deficiency in children with growth hormone insensitivity: current and future treatment options. BioDrugs. 2009;23(3):155-63. doi: 10.2165/00063030-200923030-00002. [PubMed:19627167]
  2. Williams RM, McDonald A, O'Savage M, Dunger DB: Mecasermin rinfabate: rhIGF-I/rhIGFBP-3 complex: iPLEX. Expert Opin Drug Metab Toxicol. 2008 Mar;4(3):311-24. doi: 10.1517/17425255.4.3.311 . [PubMed:18363546]
  3. Authors unspecified: Mecasermin rinfabate: insulin-like growth factor-I/insulin-like growth factor binding protein-3, mecaserimin rinfibate, rhIGF-I/rhIGFBP-3. Drugs R D. 2005;6(2):120-7. [PubMed:15777106]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein tyrosine kinase activity
Specific Function
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (...
Gene Name
INSR
Uniprot ID
P06213
Uniprot Name
Insulin receptor
Molecular Weight
156331.465 Da
References
  1. Rosenbloom AL: Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54. doi: 10.1007/s12325-008-0136-5. Epub 2009 Jan 28. [PubMed:19198769]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transporter activity
Specific Function
Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate r...
Gene Name
IGF2R
Uniprot ID
P11717
Uniprot Name
Cation-independent mannose-6-phosphate receptor
Molecular Weight
274372.42 Da
References
  1. Rosenbloom AL: Mecasermin (recombinant human insulin-like growth factor I). Adv Ther. 2009 Jan;26(1):40-54. doi: 10.1007/s12325-008-0136-5. Epub 2009 Jan 28. [PubMed:19198769]

Drug created on May 16, 2007 14:46 / Updated on November 06, 2017 06:43