You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NamePramlintide
Accession NumberDB01278
TypeBiotech
GroupsApproved, Investigational
DescriptionPramlintide is a relatively new adjunct treatment for diabetes (both type 1 and 2), developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone that is released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes.
Protein structureNo structure small
Related Articles
Protein chemical formulaC171H267N51O53S2
Protein average weight3949.3896 Da
Sequences
>Pramlintide
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Download FASTA Format
SynonymsNot Available
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SymlinpenInjection1000 ug/mLSubcutaneousAmylin Pharmaceuticals, LLC2005-03-162016-08-31Us
SymlinpenInjection1000 ug/mLSubcutaneousAmylin Pharmaceuticals, LLC2005-03-16Not applicableUs
SymlinpenInjection1000 ug/mLSubcutaneousAstra Zeneca Pharmaceuticals Lp2015-01-08Not applicableUs
SymlinpenInjection1000 ug/mLSubcutaneousAstra Zeneca Pharmaceuticals Lp2015-01-08Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
SymlinAmylin Pharmaceuticals
Brand mixturesNot Available
Salts
Name/CASStructureProperties
Pramlintide acetate
Thumb
  • InChI Key:
  • Monoisotopic Mass:
  • Average Mass:
DBSALT000144
Categories
UNIID3FM8FA78T
CAS number151126-32-8
Pharmacology
IndicationFor the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
Structured Indications
PharmacodynamicsPramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic β-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of actionPramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
TargetKindPharmacological actionActionsOrganismUniProt ID
Calcitonin receptorProteinyes
agonist
HumanP30988 details
Receptor activity-modifying protein 1Proteinyes
agonist
HumanO60894 details
Receptor activity-modifying protein 2Proteinyes
agonist
HumanO60895 details
Receptor activity-modifying protein 3Proteinyes
agonist
HumanO60896 details
Related Articles
AbsorptionThe absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of distributionNot Available
Protein bindingPramlintide does not extensively bind to blood cells or albumin (approximately 40% of the drug is unbound in plasma).
Metabolism

Metabolized primarily by the kidneys.

Route of eliminationPramlintide is metabolized primarily by the kidneys.
Half lifeApproximately 48 minutes
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Pramlintide.Experimental
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
AclidiniumPramlintide may increase the anticholinergic activities of Aclidinium.Approved
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Pramlintide.Approved
Anisotropine MethylbromidePramlintide may increase the anticholinergic activities of Anisotropine Methylbromide.Approved
AripiprazoleThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Atazanavir.Approved, Investigational
Atracurium besylatePramlintide may increase the anticholinergic activities of Atracurium besylate.Approved
AtropinePramlintide may increase the anticholinergic activities of Atropine.Approved, Vet Approved
BalsalazideBalsalazide may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
BenactyzinePramlintide may increase the anticholinergic activities of Benactyzine.Withdrawn
BendroflumethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Pramlintide.Withdrawn
BenzatropinePramlintide may increase the anticholinergic activities of Benzatropine.Approved
BetamethasoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BiperidenPramlintide may increase the anticholinergic activities of Biperiden.Approved
BrexpiprazoleThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Brexpiprazole.Approved
BumetanideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Buserelin.Approved
CaroxazoneCaroxazone may increase the hypoglycemic activities of Pramlintide.Withdrawn
CeritinibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorphenoxaminePramlintide may increase the anticholinergic activities of Chlorphenoxamine.Withdrawn
ChlorpropamidePramlintide may increase the hypoglycemic activities of Chlorpropamide.Approved
ChlorthalidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Chlorthalidone.Approved
CinoxacinCinoxacin may increase the hypoglycemic activities of Pramlintide.Approved, Withdrawn
CiprofloxacinCiprofloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
CitalopramCitalopram may increase the hypoglycemic activities of Pramlintide.Approved
ClozapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Cortisone acetate.Approved
CyclopentolatePramlintide may increase the anticholinergic activities of Cyclopentolate.Approved
Cyproterone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Pramlintide.Investigational
DarifenacinPramlintide may increase the anticholinergic activities of Darifenacin.Approved, Investigational
DarunavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Darunavir.Approved
dersalazinedersalazine may increase the hypoglycemic activities of Pramlintide.Investigational
DesloratadinePramlintide may increase the anticholinergic activities of Desloratadine.Approved, Investigational
DesogestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Pramlintide.Approved
DexamethasoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DexetimidePramlintide may increase the anticholinergic activities of Dexetimide.Withdrawn
DiazoxideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Diazoxide.Approved
DicyclominePramlintide may increase the anticholinergic activities of Dicyclomine.Approved
DienogestThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Pramlintide.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Pramlintide.Illicit
DisopyramidePramlintide may increase the hypoglycemic activities of Disopyramide.Approved
DrospirenoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Drospirenone.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Pramlintide.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Pramlintide.Approved
EpinephrineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
EstradiolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Etacrynic acid.Approved
Ethinyl EstradiolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ethinyl Estradiol.Approved
EthopropazinePramlintide may increase the anticholinergic activities of Ethopropazine.Approved
Ethynodiol diacetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Pramlintide.Approved
EverolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Everolimus.Approved
FesoterodinePramlintide may increase the anticholinergic activities of Fesoterodine.Approved
FleroxacinFleroxacin may increase the hypoglycemic activities of Pramlintide.Approved
FludrocortisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Pramlintide.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Pramlintide.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
FurosemideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Furosemide.Approved, Vet Approved
Gallamine TriethiodidePramlintide may increase the anticholinergic activities of Gallamine Triethiodide.Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Pramlintide.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
GliclazidePramlintide may increase the hypoglycemic activities of Gliclazide.Approved
GlimepiridePramlintide may increase the hypoglycemic activities of Glimepiride.Approved
GlipizidePramlintide may increase the hypoglycemic activities of Glipizide.Approved
GlyburidePramlintide may increase the hypoglycemic activities of Glyburide.Approved
GlycopyrroniumPramlintide may increase the anticholinergic activities of Glycopyrronium.Approved, Investigational, Vet Approved
GoserelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Pramlintide.Withdrawn
HexamethoniumPramlintide may increase the anticholinergic activities of Hexamethonium.Experimental
HistrelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Histrelin.Approved
HomatropinePramlintide may increase the anticholinergic activities of Homatropine.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Pramlintide.Approved
HydrochlorothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydroflumethiazide.Approved
Hydroxyprogesterone caproateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
HyoscyaminePramlintide may increase the anticholinergic activities of Hyoscyamine.Approved
IloperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Pramlintide.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Indinavir.Approved
Insulin AspartPramlintide may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirPramlintide may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlarginePramlintide may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin GlulisinePramlintide may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanPramlintide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
Insulin LisproPramlintide may increase the hypoglycemic activities of Insulin Lispro.Approved
Insulin PorkPramlintide may increase the hypoglycemic activities of Insulin Pork.Approved
Ipratropium bromidePramlintide may increase the anticholinergic activities of Ipratropium bromide.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Pramlintide.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Pramlintide.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Pramlintide.Approved
LanreotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Pramlintide.Approved
LevonorgestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Levonorgestrel.Approved, Investigational
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Pramlintide.Approved, Nutraceutical
LomefloxacinLomefloxacin may increase the hypoglycemic activities of Pramlintide.Approved
LopinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lurasidone.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
MecamylaminePramlintide may increase the anticholinergic activities of Mecamylamine.Approved
MecaserminPramlintide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Pramlintide.Approved
MestranolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Mestranol.Approved
MethanthelinePramlintide may increase the anticholinergic activities of Methantheline.Approved
MethotrimeprazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methotrimeprazine.Approved
MethyclothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methyclothiazide.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Pramlintide.Investigational
MethylprednisoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Pramlintide.Approved
MetixenePramlintide may increase the anticholinergic activities of Metixene.Approved
MetolazoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Metolazone.Approved
MifepristonePramlintide may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MilnacipranMilnacipran may increase the hypoglycemic activities of Pramlintide.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Pramlintide.Approved
MoclobemideMoclobemide may increase the hypoglycemic activities of Pramlintide.Approved
MoxifloxacinMoxifloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
N-butylscopolammonium bromidePramlintide may increase the anticholinergic activities of N-butylscopolammonium bromide.Vet Approved
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Pramlintide.Approved
NateglinidePramlintide may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NCX 4016NCX 4016 may increase the hypoglycemic activities of Pramlintide.Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Pramlintide.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Nelfinavir.Approved
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Pramlintide.Investigational
NiacinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Pramlintide.Withdrawn
NilotinibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Nilotinib.Approved, Investigational
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Pramlintide.Investigational
NorethisteroneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Pramlintide.Approved
NorgestimateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Norgestimate.Approved
NVA237Pramlintide may increase the anticholinergic activities of NVA237.Investigational
OctamoxinOctamoxin may increase the hypoglycemic activities of Pramlintide.Withdrawn
OctreotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Octreotide.Approved, Investigational
OfloxacinOfloxacin may increase the hypoglycemic activities of Pramlintide.Approved
OlanzapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Pramlintide.Approved
OrphenadrinePramlintide may increase the anticholinergic activities of Orphenadrine.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
OxybutyninPramlintide may increase the anticholinergic activities of Oxybutynin.Approved, Investigational
OxymetholoneOxymetholone may increase the hypoglycemic activities of Pramlintide.Approved, Illicit
OxyphenoniumPramlintide may increase the anticholinergic activities of Oxyphenonium.Approved
PaliperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Paliperidone.Approved
PancuroniumPramlintide may increase the anticholinergic activities of Pancuronium.Approved
PargylinePargyline may increase the hypoglycemic activities of Pramlintide.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
PasireotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Pramlintide.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Pramlintide.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Pramlintide.Approved
PentamidineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pentamidine.Approved
PentoliniumPramlintide may increase the anticholinergic activities of Pentolinium.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Pramlintide.Approved
PheniprazinePheniprazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
PipecuroniumPramlintide may increase the anticholinergic activities of Pipecuronium.Approved
PiperazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pipotiazine.Approved
PirenzepinePramlintide may increase the anticholinergic activities of Pirenzepine.Approved
PirlindolePirlindole may increase the hypoglycemic activities of Pramlintide.Approved
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
PolythiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Polythiazide.Approved
PrednisoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Prednisone.Approved, Vet Approved
ProcyclidinePramlintide may increase the anticholinergic activities of Procyclidine.Approved
ProgesteroneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Progesterone.Approved, Vet Approved
PropanthelinePramlintide may increase the anticholinergic activities of Propantheline.Approved
PropiverinePramlintide may increase the anticholinergic activities of Propiverine.Investigational
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Pramlintide.Investigational
QuetiapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Quinethazone.Approved
QuinidinePramlintide may increase the anticholinergic activities of Quinidine.Approved
QuininePramlintide may increase the hypoglycemic activities of Quinine.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Pramlintide.Approved
RepaglinidePramlintide may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RisperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ritonavir.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Pramlintide.Approved
SafrazineSafrazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Saquinavir.Approved, Investigational
ScopolaminePramlintide may increase the anticholinergic activities of Scopolamine.Approved
Scopolamine butylbromidePramlintide may increase the anticholinergic activities of Scopolamine butylbromide.Approved
SelegilineSelegiline may increase the hypoglycemic activities of Pramlintide.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Pramlintide.Approved
SirolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Sirolimus.Approved, Investigational
SolifenacinPramlintide may increase the anticholinergic activities of Solifenacin.Approved
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Pramlintide.Approved
StanozololStanozolol may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
SulfadiazinePramlintide may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazolePramlintide may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazolePramlintide may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SunitinibPramlintide may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TacrolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Tacrolimus.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Pramlintide.Withdrawn
TemsirolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
TiotropiumPramlintide may increase the anticholinergic activities of Tiotropium.Approved
TipranavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamidePramlintide may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamidePramlintide may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Pramlintide.Approved
TolterodinePramlintide may increase the anticholinergic activities of Tolterodine.Approved, Investigational
TorasemideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Pramlintide.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Pramlintide.Approved
TriamcinoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TrihexyphenidylPramlintide may increase the anticholinergic activities of Trihexyphenidyl.Approved
TrimethaphanPramlintide may increase the anticholinergic activities of Trimethaphan.Approved
TriptorelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Triptorelin.Approved, Vet Approved
TropicamidePramlintide may increase the anticholinergic activities of Tropicamide.Approved
TrospiumPramlintide may increase the anticholinergic activities of Trospium.Approved
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Withdrawn
TubocurarinePramlintide may increase the anticholinergic activities of Tubocurarine.Approved
UmeclidiniumPramlintide may increase the anticholinergic activities of Umeclidinium.Approved
VecuroniumPramlintide may increase the anticholinergic activities of Vecuronium.Approved
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Pramlintide.Approved
VorinostatThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Vorinostat.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Pramlintide.Withdrawn
ZiprasidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ziprasidone.Approved
Food InteractionsNot Available
References
Synthesis Reference

Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos, “PROCESS FOR THE PRODUCTION OF PRAMLINTIDE.” U.S. Patent US20100249370, issued September 30, 2010.

US20100249370
General References
  1. Jones MC: Therapies for diabetes: pramlintide and exenatide. Am Fam Physician. 2007 Jun 15;75(12):1831-5. [PubMed:17619527 ]
  2. Ryan GJ, Jobe LJ, Martin R: Pramlintide in the treatment of type 1 and type 2 diabetes mellitus. Clin Ther. 2005 Oct;27(10):1500-12. [PubMed:16330288 ]
  3. Edelman S, Maier H, Wilhelm K: Pramlintide in the treatment of diabetes mellitus. BioDrugs. 2008;22(6):375-86. doi: 10.2165/0063030-200822060-00004. [PubMed:18998755 ]
  4. Kleppinger EL, Vivian EM: Pramlintide for the treatment of diabetes mellitus. Ann Pharmacother. 2003 Jul-Aug;37(7-8):1082-9. [PubMed:12841822 ]
External Links
ATC CodesA10BX05
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelDownload (856 KB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
InjectionSubcutaneous1000 ug/mL
Prices
Unit descriptionCostUnit
Symlin 600 mcg/ml Solution 5ml Vial227.69USD vial
SymlinPen 120 1000 mcg/ml Solution Two 2.7ml Syringes Per Box168.85USD syringe
Symlinpen 60 pen injector123.51USD ml
Symlin 0.6 mg/ml vial49.35USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5686411 No1999-03-162019-03-16Us
US5814600 No1995-09-292015-09-29Us
US6114304 No1997-09-052017-09-05Us
US6610824 No1994-03-032011-03-03Us
Properties
StateLiquid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
Gene Name:
CALCR
Uniprot ID:
P30988
Molecular Weight:
59351.865 Da
References
  1. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274 ]
  2. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748 ]
  3. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016 ]
  4. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292 ]
  5. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822 ]
  6. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
Gene Name:
RAMP1
Uniprot ID:
O60894
Molecular Weight:
16987.765 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274 ]
  4. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748 ]
  5. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016 ]
  6. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292 ]
  7. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822 ]
  8. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Protein transporter activity
Specific Function:
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Gene Name:
RAMP2
Uniprot ID:
O60895
Molecular Weight:
19607.44 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748 ]
  4. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292 ]
  5. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822 ]
  6. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Gene Name:
RAMP3
Uniprot ID:
O60896
Molecular Weight:
16518.325 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274 ]
  4. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748 ]
  5. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016 ]
  6. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292 ]
  7. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822 ]
  8. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035 ]
Comments
comments powered by Disqus
Drug created on May 16, 2007 16:15 / Updated on December 07, 2016 02:38