Identification

Name
Pramlintide
Accession Number
DB01278
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Hormones
Description

Pramlintide is a relatively new adjunct treatment for diabetes (both type 1 and 2), developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone that is released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes.

Protein chemical formula
C171H267N51O53S2
Protein average weight
3949.3896 Da
Sequences
>Pramlintide
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Download FASTA Format
Synonyms
Not Available
Product Ingredients
IngredientUNIICASInChI Key
Pramlintide acetate726I6TE06G196078-30-5NRKVKVQDUCJPIZ-MKAGXXMWSA-N
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
SymlinPenInjection1000 ug/mLSubcutaneousAmylin Pharmaceuticals, Llc.2005-03-162016-08-31Us
SymlinPenInjection1000 ug/mLSubcutaneousAstra Zeneca Lp2015-01-08Not applicableUs
SymlinPenInjection1000 ug/mLSubcutaneousAmylin Pharmaceuticals, Llc.2005-03-162017-07-31Us
SymlinPenInjection1000 ug/mLSubcutaneousAstra Zeneca Lp2015-01-08Not applicableUs
International/Other Brands
Symlin (Amylin Pharmaceuticals)
Categories
UNII
D3FM8FA78T
CAS number
151126-32-8

Pharmacology

Indication

For the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.

Structured Indications
Pharmacodynamics

Pramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic β-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.

Mechanism of action

Pramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.

TargetActionsOrganism
ACalcitonin receptor
agonist
Human
AReceptor activity-modifying protein 1
agonist
Human
AReceptor activity-modifying protein 2
agonist
Human
AReceptor activity-modifying protein 3
agonist
Human
Absorption

The absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.

Volume of distribution
Not Available
Protein binding

Pramlintide does not extensively bind to blood cells or albumin (approximately 40% of the drug is unbound in plasma).

Metabolism

Metabolized primarily by the kidneys.

Route of elimination

Pramlintide is metabolized primarily by the kidneys.

Half life

Approximately 48 minutes

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline may increase the hypoglycemic activities of Pramlintide.Experimental
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
AclidiniumPramlintide may increase the anticholinergic activities of Aclidinium.Approved
AlaproclateAlaproclate may increase the hypoglycemic activities of Pramlintide.Experimental
AlcuroniumPramlintide may increase the anticholinergic activities of Alcuronium.Experimental
AloxiprinAloxiprin may increase the hypoglycemic activities of Pramlintide.Experimental
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Pramlintide.Approved
AmphetamineAmphetamine may increase the hypoglycemic activities of Pramlintide.Approved, Illicit
Anisotropine MethylbromidePramlintide may increase the anticholinergic activities of Anisotropine Methylbromide.Approved
AripiprazoleThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Atazanavir.Approved, Investigational
AtracuriumPramlintide may increase the anticholinergic activities of Atracurium.Experimental, Investigational
Atracurium besylatePramlintide may increase the anticholinergic activities of Atracurium besylate.Approved
AtropinePramlintide may increase the anticholinergic activities of Atropine.Approved, Vet Approved
BalsalazideBalsalazide may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
BenactyzinePramlintide may increase the anticholinergic activities of Benactyzine.Withdrawn
BendroflumethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Pramlintide.Withdrawn
BenzatropinePramlintide may increase the anticholinergic activities of Benzatropine.Approved
BetamethasoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BiperidenPramlintide may increase the anticholinergic activities of Biperiden.Approved, Investigational
BornaprinePramlintide may increase the anticholinergic activities of Bornaprine.Experimental
BrexpiprazoleThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Brexpiprazole.Approved
BrofaromineBrofaromine may increase the hypoglycemic activities of Pramlintide.Experimental
BumetanideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Buserelin.Approved
ButylscopolaminePramlintide may increase the anticholinergic activities of Scopolamine butylbromide.Approved, Vet Approved
Carbaspirin calciumCarbaspirin calcium may increase the hypoglycemic activities of Pramlintide.Experimental, Investigational
CaroxazoneCaroxazone may increase the hypoglycemic activities of Pramlintide.Withdrawn
CeritinibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorphenoxaminePramlintide may increase the anticholinergic activities of Chlorphenoxamine.Withdrawn
ChlorpropamidePramlintide may increase the hypoglycemic activities of Chlorpropamide.Approved
ChlorthalidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Chlorthalidone.Approved
CinoxacinCinoxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational, Withdrawn
CitalopramCitalopram may increase the hypoglycemic activities of Pramlintide.Approved
ClozapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Cortisone acetate.Approved
CyclopenthiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Cyclopenthiazide.Experimental
CyclopentolatePramlintide may increase the anticholinergic activities of Cyclopentolate.Approved
Cyproterone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Pramlintide.Investigational
DarifenacinPramlintide may increase the anticholinergic activities of Darifenacin.Approved, Investigational
DarunavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Darunavir.Approved
dersalazinedersalazine may increase the hypoglycemic activities of Pramlintide.Investigational
DesloratadinePramlintide may increase the anticholinergic activities of Desloratadine.Approved, Investigational
DesogestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Pramlintide.Approved
DexamethasoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DexetimidePramlintide may increase the anticholinergic activities of Dexetimide.Withdrawn
DiazoxideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Diazoxide.Approved
DicyclominePramlintide may increase the anticholinergic activities of Dicyclomine.Approved
DienogestThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Pramlintide.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Pramlintide.Illicit
DisopyramidePramlintide may increase the hypoglycemic activities of Disopyramide.Approved
DrospirenoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Drospirenone.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Pramlintide.Approved
EmeproniumPramlintide may increase the anticholinergic activities of Emepronium.Experimental
EnoxacinEnoxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
EpinephrineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
EstradiolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Etacrynic acid.Approved
EtanautinePramlintide may increase the anticholinergic activities of Etanautine.Experimental
Ethinyl EstradiolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ethinyl Estradiol.Approved
EthopropazinePramlintide may increase the anticholinergic activities of Ethopropazine.Approved
Ethynodiol diacetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Pramlintide.Withdrawn
EtybenzatropinePramlintide may increase the anticholinergic activities of Etybenzatropine.Experimental
EverolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Everolimus.Approved
FesoterodinePramlintide may increase the anticholinergic activities of Fesoterodine.Approved
FleroxacinFleroxacin may increase the hypoglycemic activities of Pramlintide.Approved
FludrocortisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Pramlintide.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Pramlintide.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Pramlintide.Approved, Investigational, Vet Approved
FurosemideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Furosemide.Approved, Vet Approved
GallaminePramlintide may increase the anticholinergic activities of Gallamine.Experimental
Gallamine TriethiodidePramlintide may increase the anticholinergic activities of Gallamine Triethiodide.Approved
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Pramlintide.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
GliclazidePramlintide may increase the hypoglycemic activities of Gliclazide.Approved
GlimepiridePramlintide may increase the hypoglycemic activities of Glimepiride.Approved
GlipizidePramlintide may increase the hypoglycemic activities of Glipizide.Approved
GLPG-0492GLPG-0492 may increase the hypoglycemic activities of Pramlintide.Investigational
GlyburidePramlintide may increase the hypoglycemic activities of Glyburide.Approved
GlycopyrroniumPramlintide may increase the anticholinergic activities of Glycopyrronium.Approved, Investigational, Vet Approved
GoserelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Pramlintide.Investigational, Withdrawn
GuacetisalGuacetisal may increase the hypoglycemic activities of Pramlintide.Experimental
HarmalineHarmaline may increase the hypoglycemic activities of Pramlintide.Experimental
Hemoglobin crosfumarilHemoglobin crosfumaril may increase the hypoglycemic activities of Pramlintide.Experimental
HexamethoniumPramlintide may increase the anticholinergic activities of Hexamethonium.Experimental
HistrelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Histrelin.Approved
HomatropinePramlintide may increase the anticholinergic activities of Homatropine.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Pramlintide.Experimental
HydrochlorothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydroflumethiazide.Approved, Investigational
Hydroxyprogesterone caproateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
HyoscyaminePramlintide may increase the anticholinergic activities of Hyoscyamine.Approved
IloperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Pramlintide.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Indinavir.Approved
Insulin AspartPramlintide may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirPramlintide may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlarginePramlintide may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin GlulisinePramlintide may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanPramlintide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
Insulin LisproPramlintide may increase the hypoglycemic activities of Insulin Lispro.Approved
Insulin PorkPramlintide may increase the hypoglycemic activities of Insulin Pork.Approved
Ipratropium bromidePramlintide may increase the anticholinergic activities of Ipratropium bromide.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Pramlintide.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Pramlintide.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Pramlintide.Approved
LanreotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Pramlintide.Approved
LevonorgestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Levonorgestrel.Approved, Investigational
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Pramlintide.Approved, Nutraceutical
LopinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lurasidone.Approved
MazaticolPramlintide may increase the anticholinergic activities of Mazaticol.Experimental
MebanazineMebanazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
MecamylaminePramlintide may increase the anticholinergic activities of Mecamylamine.Approved
MecaserminPramlintide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Pramlintide.Approved
MesteroloneMesterolone may increase the hypoglycemic activities of Pramlintide.Experimental
MestranolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Mestranol.Approved
MethanthelinePramlintide may increase the anticholinergic activities of Methantheline.Approved, Investigational
MethotrimeprazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methotrimeprazine.Approved
MethscopolaminePramlintide may increase the anticholinergic activities of Methscopolamine.Approved
MethyclothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methyclothiazide.Approved
Methyl salicylateMethyl salicylate may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
MethylprednisoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
Methylscopolamine bromidePramlintide may increase the anticholinergic activities of Methylscopolamine bromide.Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Pramlintide.Approved
MetixenePramlintide may increase the anticholinergic activities of Metixene.Approved
MetolazoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Metolazone.Approved
MifepristonePramlintide may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MilnacipranMilnacipran may increase the hypoglycemic activities of Pramlintide.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Pramlintide.Approved
MoclobemideMoclobemide may increase the hypoglycemic activities of Pramlintide.Approved
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
NandroloneNandrolone may increase the hypoglycemic activities of Pramlintide.Experimental, Investigational
Nandrolone decanoateNandrolone decanoate may increase the hypoglycemic activities of Pramlintide.Approved, Illicit
NateglinidePramlintide may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Pramlintide.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Nelfinavir.Approved
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Pramlintide.Investigational
NiacinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Pramlintide.Withdrawn
NilotinibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Nilotinib.Approved, Investigational
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Pramlintide.Investigational
NorethisteroneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Pramlintide.Approved
NorgestimateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Norgestimate.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Pramlintide.Withdrawn
OctreotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Octreotide.Approved, Investigational
OlanzapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Pramlintide.Approved
OrphenadrinePramlintide may increase the anticholinergic activities of Orphenadrine.Approved
OtiloniumPramlintide may increase the anticholinergic activities of Otilonium.Experimental, Investigational
OxandroloneOxandrolone may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
OxitropiumPramlintide may increase the anticholinergic activities of Oxitropium.Investigational
Oxolinic acidOxolinic acid may increase the hypoglycemic activities of Pramlintide.Experimental
OxybutyninPramlintide may increase the anticholinergic activities of Oxybutynin.Approved, Investigational
OxymetholoneOxymetholone may increase the hypoglycemic activities of Pramlintide.Approved, Illicit
OxyphenoniumPramlintide may increase the anticholinergic activities of Oxyphenonium.Approved
PaliperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Paliperidone.Approved
PancuroniumPramlintide may increase the anticholinergic activities of Pancuronium.Approved
PargylinePargyline may increase the hypoglycemic activities of Pramlintide.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
PasireotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Pramlintide.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Pramlintide.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Pramlintide.Approved
PentamidineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pentamidine.Approved
PentoliniumPramlintide may increase the anticholinergic activities of Pentolinium.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Pramlintide.Approved
PhenglutarimidePramlintide may increase the anticholinergic activities of Phenglutarimide.Experimental
PheniprazinePheniprazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
PipecuroniumPramlintide may increase the anticholinergic activities of Pipecuronium.Approved
Pipemidic acidPipemidic acid may increase the hypoglycemic activities of Pramlintide.Experimental
PiperazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pipotiazine.Approved, Investigational
PirenzepinePramlintide may increase the anticholinergic activities of Pirenzepine.Approved
PirlindolePirlindole may increase the hypoglycemic activities of Pramlintide.Approved
Piromidic acidPiromidic acid may increase the hypoglycemic activities of Pramlintide.Experimental
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
PolythiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Polythiazide.Approved
PrednisoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Prednisone.Approved, Vet Approved
PregabalinThe risk or severity of heart failure can be increased when Pregabalin is combined with Pramlintide.Approved, Illicit, Investigational
ProcarbazineProcarbazine may increase the hypoglycemic activities of Pramlintide.Approved
ProcyclidinePramlintide may increase the anticholinergic activities of Procyclidine.Approved
ProgesteroneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Progesterone.Approved, Vet Approved
PropanthelinePramlintide may increase the anticholinergic activities of Propantheline.Approved
PropiverinePramlintide may increase the anticholinergic activities of Propiverine.Approved, Investigational
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Pramlintide.Investigational
QuetiapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Quinethazone.Approved
QuinidinePramlintide may increase the anticholinergic activities of Quinidine.Approved
QuininePramlintide may increase the hypoglycemic activities of Quinine.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Pramlintide.Approved
RepaglinidePramlintide may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RisperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ritonavir.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
RufloxacinRufloxacin may increase the hypoglycemic activities of Pramlintide.Experimental
SafrazineSafrazine may increase the hypoglycemic activities of Pramlintide.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Saquinavir.Approved, Investigational
ScopolaminePramlintide may increase the anticholinergic activities of Scopolamine.Approved
SelegilineSelegiline may increase the hypoglycemic activities of Pramlintide.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Pramlintide.Approved
SirolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Sirolimus.Approved, Investigational
SitafloxacinSitafloxacin may increase the hypoglycemic activities of Pramlintide.Experimental, Investigational
SolifenacinPramlintide may increase the anticholinergic activities of Solifenacin.Approved
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
StanozololStanozolol may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
SulfadiazinePramlintide may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazolePramlintide may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazolePramlintide may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SunitinibPramlintide may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TacrolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Tacrolimus.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Pramlintide.Withdrawn
TemsirolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Pramlintide.Approved, Investigational
Testosterone PropionateTestosterone Propionate may increase the hypoglycemic activities of Pramlintide.Approved, Vet Approved
TiotropiumPramlintide may increase the anticholinergic activities of Tiotropium.Approved
TipranavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamidePramlintide may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamidePramlintide may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Pramlintide.Approved
TolterodinePramlintide may increase the anticholinergic activities of Tolterodine.Approved, Investigational
TorasemideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Pramlintide.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Pramlintide.Approved
TriamcinoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TrihexyphenidylPramlintide may increase the anticholinergic activities of Trihexyphenidyl.Approved
TrimethaphanPramlintide may increase the anticholinergic activities of Trimethaphan.Approved, Investigational
TriptorelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Triptorelin.Approved, Vet Approved
Trolamine salicylateTrolamine salicylate may increase the hypoglycemic activities of Pramlintide.Approved
TropatepinePramlintide may increase the anticholinergic activities of Tropatepine.Experimental
TropicamidePramlintide may increase the anticholinergic activities of Tropicamide.Approved
TrospiumPramlintide may increase the anticholinergic activities of Trospium.Approved
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Pramlintide.Approved, Investigational, Withdrawn
TubocurarinePramlintide may increase the anticholinergic activities of Tubocurarine.Approved
UbidecarenoneThe therapeutic efficacy of Pramlintide can be increased when used in combination with Ubidecarenone.Approved, Investigational, Nutraceutical
UmeclidiniumPramlintide may increase the anticholinergic activities of Umeclidinium.Approved
VecuroniumPramlintide may increase the anticholinergic activities of Vecuronium.Approved
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Pramlintide.Approved
VorinostatThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Vorinostat.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Pramlintide.Withdrawn
ZiprasidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ziprasidone.Approved
Food Interactions
Not Available

References

Synthesis Reference

Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos, "PROCESS FOR THE PRODUCTION OF PRAMLINTIDE." U.S. Patent US20100249370, issued September 30, 2010.

US20100249370
General References
  1. Jones MC: Therapies for diabetes: pramlintide and exenatide. Am Fam Physician. 2007 Jun 15;75(12):1831-5. [PubMed:17619527]
  2. Ryan GJ, Jobe LJ, Martin R: Pramlintide in the treatment of type 1 and type 2 diabetes mellitus. Clin Ther. 2005 Oct;27(10):1500-12. [PubMed:16330288]
  3. Edelman S, Maier H, Wilhelm K: Pramlintide in the treatment of diabetes mellitus. BioDrugs. 2008;22(6):375-86. doi: 10.2165/0063030-200822060-00004. [PubMed:18998755]
  4. Kleppinger EL, Vivian EM: Pramlintide for the treatment of diabetes mellitus. Ann Pharmacother. 2003 Jul-Aug;37(7-8):1082-9. [PubMed:12841822]
External Links
KEGG Drug
D05595
PubChem Substance
46509048
ChEMBL
CHEMBL2103758
Therapeutic Targets Database
DCL000936
PharmGKB
PA164781394
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Pramlintide
ATC Codes
A10BX05 — Pramlintide
FDA label
Download (856 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
1, 2WithdrawnTreatmentDiabetes Mellitus (DM)1
2CompletedTreatmentBMI >27 kg/m2 / BMI >30 kg/m24
2CompletedTreatmentBMI >30 kg/m23
2CompletedTreatmentDiabetes Mellitus, Non-Insulin-Dependent1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 1 / Type 2 Diabetes Mellitus2
2TerminatedTreatmentBMI >30 kg/m21
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 14
3CompletedTreatmentDiabetes, Diabetes Mellitus Type 1 / Type 2 Diabetes Mellitus1
3Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
3Unknown StatusTreatmentType 2 Diabetes Mellitus1
4Active Not RecruitingTreatmentEvidence of Previous Gastric Surgery / Hypoglycemia1
4CompletedNot AvailableDiabetes Mellitus (DM) / Schizoaffective Disorders / Schizophrenic Disorders / Weight gain therapy1
4CompletedTreatmentDiabetes, Diabetes Mellitus Type 13
4CompletedTreatmentType 1 Insulin-Dependent Diabetes Mellitus1
4CompletedTreatmentType 2 Diabetes Mellitus2
4Unknown StatusTreatmentType 2 Diabetes Mellitus1
4WithdrawnTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedNot AvailableDiabetes, Diabetes Mellitus Type 1 / Type 2 Diabetes Mellitus1
Not AvailableCompletedDiagnosticDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedHealth Services ResearchDiabetes, Diabetes Mellitus Type 11
Not AvailableCompletedTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableUnknown StatusBasic ScienceBMI >30 kg/m21
Not AvailableWithdrawnTreatmentType 2 Diabetes Mellitus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
InjectionSubcutaneous1000 ug/mL
Prices
Unit descriptionCostUnit
Symlin 600 mcg/ml Solution 5ml Vial227.69USD vial
SymlinPen 120 1000 mcg/ml Solution Two 2.7ml Syringes Per Box168.85USD syringe
Symlinpen 60 pen injector123.51USD ml
Symlin 0.6 mg/ml vial49.35USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US6610824No1994-03-032011-03-03Us
US5686411No1999-03-162019-03-16Us
US5814600No1995-09-292015-09-29Us
US6114304No1997-09-052017-09-05Us

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Receptor activity
Specific Function
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanos...
Gene Name
CALCR
Uniprot ID
P30988
Uniprot Name
Calcitonin receptor
Molecular Weight
59351.865 Da
References
  1. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274]
  2. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748]
  3. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016]
  4. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292]
  5. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822]
  6. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Receptor activity
Specific Function
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
Gene Name
RAMP1
Uniprot ID
O60894
Uniprot Name
Receptor activity-modifying protein 1
Molecular Weight
16987.765 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274]
  4. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748]
  5. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016]
  6. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292]
  7. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822]
  8. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Protein transporter activity
Specific Function
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Gene Name
RAMP2
Uniprot ID
O60895
Uniprot Name
Receptor activity-modifying protein 2
Molecular Weight
19607.44 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748]
  4. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292]
  5. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822]
  6. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Receptor activity
Specific Function
Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and G...
Gene Name
RAMP3
Uniprot ID
O60896
Uniprot Name
Receptor activity-modifying protein 3
Molecular Weight
16518.325 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274]
  4. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748]
  5. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016]
  6. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292]
  7. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822]
  8. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035]

Drug created on May 16, 2007 16:15 / Updated on December 01, 2017 17:10