You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameDulaglutide
Accession NumberDB09045
TypeBiotech
GroupsApproved
DescriptionDulaglutide is a novel glucagon-like peptide-1 agonist (GLP-1) biologic drug consisting of a dipeptidyl peptidase-IV-protected GLP-1 analogue covalently linked to a human IgG4-Fc heavy chain by a small peptide linker. Dulaglutide is indicated in the treatment of type 2 diabetes and can be used once a week. It was approved by the FDA in September 2014. Dulaglutide is manufactured and marketed by Eli Lily under the brand Trulicity™. It is not known if dulaglutide can increase the risk of medullary thyroid carcinoma or multiple endocrine neoplasia syndrome type 2, and is thus not recommended for use in populations with a personal or family history of these conditions.
Protein structureDb09045
Related Articles
Protein chemical formulaC2646H4044N704O836S18
Protein average weight59669.81 Da
Sequences
> Dulaglutide Sequence
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSAESKYGPPCPPCPA
PEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP
REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT
VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
Download FASTA Format
SynonymsNot Available
External Identifiers
  • LY-2189265
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
TrulicitySolution1.5 mgSubcutaneousEli Lilly Canada Inc2015-11-24Not applicableCanada
TrulicityInjection, solution1.5 mg/.5mLSubcutaneousEli Lilly and Company2014-11-07Not applicableUs
TrulicitySolution0.75 mgSubcutaneousEli Lilly Canada IncNot applicableNot applicableCanada
TrulicitySolution0.75 mgSubcutaneousEli Lilly Canada Inc2016-01-08Not applicableCanada
TrulicitySolution1.5 mgSubcutaneousEli Lilly Canada IncNot applicableNot applicableCanada
TrulicityInjection, solution.75 mg/.5mLSubcutaneousEli Lilly and Company2014-11-07Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIWTT295HSY5
CAS number923950-08-7
Pharmacology
IndicationIndicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus.
Structured Indications
PharmacodynamicsDulaglutide activates human glucagon-like peptide-1 receptors, thus increasing intracellular cyclic AMP in beta cells. This, in turn, increases glucose-dependent insulin release. Dulaglutide also reduces glucagon secretion and slows gastric emptying.
Mechanism of actionDulaglutide is a human GLP-1 receptor agonist with 90% amino acid sequence homology to endogenous human GLP-1 (7-37). Dulaglutide activates the GLP-1 receptor, a membrane-bound cell-surface receptor coupled to adenylyl cyclase in pancreatic beta cells. Dulaglutide increases intracellular cyclic AMP (cAMP) in beta cells leading to glucose-dependent insulin release. Dulaglutide also decreases glucagon secretion and slows gastric emptying.
TargetKindPharmacological actionActionsOrganismUniProt ID
Glucagon-like peptide 1 receptorProteinyes
agonist
HumanP43220 details
Related Articles
AbsorptionMaximum plasma concentration (Cmax) is achieved in 24–72 h (median 48 h) after a subcutaneous injection administered at a steady state.
Volume of distribution

After subcutaneous administration of 0.75 mg and 1.5 mg to steady state were approximately 19.2 L (range 14.3 to 26.4 L) and 17.4 L (range 9.3 to 33 L), respectively.

Protein bindingNot Available
Metabolism

Dulaglutide is presumed to be degraded into its component amino acids by general protein catabolism pathways.

Route of eliminationNot Available
Half lifeApproximately 5 days.
Clearance

The mean apparent clearance at steady state of dulaglutide is approximately 0.111 L/h for the 0.75 mg dose, and 0.107 L/h for the 1.5 mg dose.

Toxicity-RISK OF THYROID C-CELL TUMORS -Dulaglutide is contraindicated in patients with a personal or family history of MTC or in patients with Multiple Endocrine Neoplasia syndrome type 2 (MEN2). Routine serum calcitonin or thyroid ultrasound monitoring is of uncertain value in patients treated with Dulaglutide.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Dulaglutide.Experimental
AcetohexamideDulaglutide may increase the hypoglycemic activities of Acetohexamide.Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
ALT-110The therapeutic efficacy of ALT-110 can be decreased when used in combination with Dulaglutide.Investigational
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Dulaglutide.Approved
AripiprazoleThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Atazanavir.Approved, Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
BendroflumethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Dulaglutide.Withdrawn
BetamethasoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BrexpiprazoleThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Brexpiprazole.Approved
BumetanideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Buserelin.Approved
CaroxazoneCaroxazone may increase the hypoglycemic activities of Dulaglutide.Withdrawn
CDX-110The therapeutic efficacy of CDX-110 can be decreased when used in combination with Dulaglutide.Investigational
CeritinibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorpropamideDulaglutide may increase the hypoglycemic activities of Chlorpropamide.Approved
ChlorthalidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Chlorthalidone.Approved
CinoxacinCinoxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Withdrawn
CiprofloxacinCiprofloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
CitalopramCitalopram may increase the hypoglycemic activities of Dulaglutide.Approved
ClozapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Cortisone acetate.Approved
Cyproterone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Dulaglutide.Investigational
DarunavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Darunavir.Approved
dersalazinedersalazine may increase the hypoglycemic activities of Dulaglutide.Investigational
DesogestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Dulaglutide.Approved
DexamethasoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DiazoxideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Diazoxide.Approved
DienogestThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Dulaglutide.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Dulaglutide.Illicit
DisopyramideDulaglutide may increase the hypoglycemic activities of Disopyramide.Approved
DrospirenoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Drospirenone.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Dulaglutide.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Dulaglutide.Approved
EpinephrineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
EstradiolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Etacrynic acid.Approved
Ethinyl EstradiolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ethinyl Estradiol.Approved
Ethynodiol diacetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Dulaglutide.Approved
EverolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Everolimus.Approved
FleroxacinFleroxacin may increase the hypoglycemic activities of Dulaglutide.Approved
FludrocortisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Dulaglutide.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
FurosemideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Furosemide.Approved, Vet Approved
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Dulaglutide.Investigational
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Dulaglutide.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Dulaglutide.Investigational
GlibornurideDulaglutide may increase the hypoglycemic activities of Glibornuride.Withdrawn
GliclazideDulaglutide may increase the hypoglycemic activities of Gliclazide.Approved
GlimepirideDulaglutide may increase the hypoglycemic activities of Glimepiride.Approved
GlipizideDulaglutide may increase the hypoglycemic activities of Glipizide.Approved
GliquidoneDulaglutide may increase the hypoglycemic activities of Gliquidone.Approved
GlisoxepideDulaglutide may increase the hypoglycemic activities of Glisoxepide.Approved
GlyburideDulaglutide may increase the hypoglycemic activities of Glyburide.Approved
GoserelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Dulaglutide.Withdrawn
HistrelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Histrelin.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Dulaglutide.Approved
HydrochlorothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydroflumethiazide.Approved
Hydroxyprogesterone caproateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
IloperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Dulaglutide.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Indinavir.Approved
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Dulaglutide.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Dulaglutide.Investigational
Insulin AspartDulaglutide may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirDulaglutide may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineDulaglutide may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin GlulisineDulaglutide may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanDulaglutide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
Insulin LisproDulaglutide may increase the hypoglycemic activities of Insulin Lispro.Approved
Insulin PorkDulaglutide may increase the hypoglycemic activities of Insulin Pork.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Dulaglutide.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Dulaglutide.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Dulaglutide.Approved
LanreotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Dulaglutide.Approved
LevonorgestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Levonorgestrel.Approved, Investigational
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Dulaglutide.Approved, Nutraceutical
LomefloxacinLomefloxacin may increase the hypoglycemic activities of Dulaglutide.Approved
LopinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lurasidone.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
MecaserminDulaglutide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Dulaglutide.Approved
MestranolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Mestranol.Approved
MethotrimeprazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methotrimeprazine.Approved
MethyclothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methyclothiazide.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Dulaglutide.Investigational
MethylprednisoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Dulaglutide.Approved
MetolazoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Metolazone.Approved
MifepristoneDulaglutide may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MilnacipranMilnacipran may increase the hypoglycemic activities of Dulaglutide.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Dulaglutide.Approved
MoclobemideMoclobemide may increase the hypoglycemic activities of Dulaglutide.Approved
MoxifloxacinMoxifloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Dulaglutide.Approved
NateglinideDulaglutide may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NCX 4016NCX 4016 may increase the hypoglycemic activities of Dulaglutide.Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Dulaglutide.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Nelfinavir.Approved
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Dulaglutide.Investigational
NiacinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Dulaglutide.Withdrawn
NilotinibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Nilotinib.Approved, Investigational
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Dulaglutide.Investigational
NorethisteroneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Dulaglutide.Approved
NorgestimateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Norgestimate.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Dulaglutide.Withdrawn
OctreotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Octreotide.Approved, Investigational
OfloxacinOfloxacin may increase the hypoglycemic activities of Dulaglutide.Approved
OlanzapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Dulaglutide.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
OxymetholoneOxymetholone may increase the hypoglycemic activities of Dulaglutide.Approved, Illicit
PaliperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Paliperidone.Approved
PargylinePargyline may increase the hypoglycemic activities of Dulaglutide.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
PasireotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Dulaglutide.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Dulaglutide.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Dulaglutide.Approved
PentamidineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pentamidine.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Dulaglutide.Approved
PheniprazinePheniprazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
PiperazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pipotiazine.Approved
PirlindolePirlindole may increase the hypoglycemic activities of Dulaglutide.Approved
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
PolythiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Polythiazide.Approved
PrednisoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Prednisone.Approved, Vet Approved
ProgesteroneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Progesterone.Approved, Vet Approved
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Dulaglutide.Investigational
QuetiapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Quinethazone.Approved
QuinineDulaglutide may increase the hypoglycemic activities of Quinine.Approved
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Dulaglutide.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Dulaglutide.Approved
RepaglinideDulaglutide may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RisperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ritonavir.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Dulaglutide.Approved
SafrazineSafrazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Saquinavir.Approved, Investigational
SelegilineSelegiline may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Dulaglutide.Approved
SirolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Sirolimus.Approved, Investigational
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Dulaglutide.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Dulaglutide.Investigational
StanozololStanozolol may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
SulfadiazineDulaglutide may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazoleDulaglutide may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazoleDulaglutide may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SunitinibDulaglutide may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TacrolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Tacrolimus.Approved, Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Dulaglutide.Withdrawn
TemsirolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Dulaglutide.Investigational
TipranavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamideDulaglutide may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamideDulaglutide may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Dulaglutide.Approved
TorasemideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Dulaglutide.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Dulaglutide.Approved
TriamcinoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TriptorelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Triptorelin.Approved, Vet Approved
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Dulaglutide.Approved
VorinostatThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Vorinostat.Approved, Investigational
ZimelidineZimelidine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
ZiprasidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ziprasidone.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Nadkarni P, Chepurny OG, Holz GG: Regulation of glucose homeostasis by GLP-1. Prog Mol Biol Transl Sci. 2014;121:23-65. doi: 10.1016/B978-0-12-800101-1.00002-8. [PubMed:24373234 ]
  2. Sanford M: Dulaglutide: first global approval. Drugs. 2014 Nov;74(17):2097-103. doi: 10.1007/s40265-014-0320-7. [PubMed:25367716 ]
External Links
ATC CodesA10BX14
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelNot Available
MSDSDownload (97.1 KB)
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous.75 mg/.5mL
Injection, solutionSubcutaneous1.5 mg/.5mL
SolutionSubcutaneous0.75 mg
SolutionSubcutaneous1.5 mg
PricesNot Available
PatentsNot Available
Properties
StateLiquid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Transmembrane signaling receptor activity
Specific Function:
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene Name:
GLP1R
Uniprot ID:
P43220
Molecular Weight:
53025.22 Da
References
  1. Sanford M: Dulaglutide: first global approval. Drugs. 2014 Nov;74(17):2097-103. doi: 10.1007/s40265-014-0320-7. [PubMed:25367716 ]
Comments
comments powered by Disqus
Drug created on April 29, 2015 12:08 / Updated on August 17, 2016 12:24