Identification

Name
Dulaglutide
Accession Number
DB09045
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Fusion proteins / Hormones
Description

Dulaglutide is a novel glucagon-like peptide-1 agonist (GLP-1) biologic drug consisting of a dipeptidyl peptidase-IV-protected GLP-1 analogue covalently linked to a human IgG4-Fc heavy chain by a small peptide linker. Dulaglutide is indicated in the treatment of type 2 diabetes and can be used once a week. It was approved by the FDA in September 2014. Dulaglutide is manufactured and marketed by Eli Lily under the brand Trulicity™. It is not known if dulaglutide can increase the risk of medullary thyroid carcinoma or multiple endocrine neoplasia syndrome type 2, and is thus not recommended for use in populations with a personal or family history of these conditions.

Protein structure
Db09045
Protein chemical formula
C2646H4044N704O836S18
Protein average weight
59669.81 Da
Sequences
> Dulaglutide Sequence
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSAESKYGPPCPPCPA
PEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP
REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT
VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
Download FASTA Format
Synonyms
Not Available
External IDs
LY-2189265
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
TrulicitySolution0.75 mgSubcutaneousEli Lilly & Co. Ltd.2016-01-08Not applicableCanada
TrulicitySolution1.5 mgSubcutaneousEli Lilly & Co. Ltd.Not applicableNot applicableCanada
TrulicitySolution1.5 mgSubcutaneousEli Lilly & Co. Ltd.2015-11-24Not applicableCanada
TrulicityInjection, solution.75 mg/.5mLSubcutaneousEli Lilly & Co. Ltd.2014-11-07Not applicableUs
TrulicitySolution0.75 mgSubcutaneousEli Lilly & Co. Ltd.Not applicableNot applicableCanada
TrulicityInjection, solution1.5 mg/.5mLSubcutaneousEli Lilly & Co. Ltd.2014-11-07Not applicableUs
Categories
UNII
WTT295HSY5
CAS number
923950-08-7

Pharmacology

Indication

Indicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus.

Structured Indications
Pharmacodynamics

Dulaglutide activates human glucagon-like peptide-1 receptors, thus increasing intracellular cyclic AMP in beta cells. This, in turn, increases glucose-dependent insulin release. Dulaglutide also reduces glucagon secretion and slows gastric emptying.

Mechanism of action

Dulaglutide is a human GLP-1 receptor agonist with 90% amino acid sequence homology to endogenous human GLP-1 (7-37). Dulaglutide activates the GLP-1 receptor, a membrane-bound cell-surface receptor coupled to adenylyl cyclase in pancreatic beta cells. Dulaglutide increases intracellular cyclic AMP (cAMP) in beta cells leading to glucose-dependent insulin release. Dulaglutide also decreases glucagon secretion and slows gastric emptying.

TargetActionsOrganism
AGlucagon-like peptide 1 receptor
agonist
Human
Absorption

Maximum plasma concentration (Cmax) is achieved in 24–72 h (median 48 h) after a subcutaneous injection administered at a steady state.

Volume of distribution

After subcutaneous administration of 0.75 mg and 1.5 mg to steady state were approximately 19.2 L (range 14.3 to 26.4 L) and 17.4 L (range 9.3 to 33 L), respectively.

Protein binding
Not Available
Metabolism

Dulaglutide is presumed to be degraded into its component amino acids by general protein catabolism pathways.

Route of elimination
Not Available
Half life

Approximately 5 days.

Clearance

The mean apparent clearance at steady state of dulaglutide is approximately 0.111 L/h for the 0.75 mg dose, and 0.107 L/h for the 1.5 mg dose.

Toxicity

-RISK OF THYROID C-CELL TUMORS -Dulaglutide is contraindicated in patients with a personal or family history of MTC or in patients with Multiple Endocrine Neoplasia syndrome type 2 (MEN2). Routine serum calcitonin or thyroid ultrasound monitoring is of uncertain value in patients treated with Dulaglutide.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline may increase the hypoglycemic activities of Dulaglutide.Experimental
AcetohexamideDulaglutide may increase the hypoglycemic activities of Acetohexamide.Withdrawn
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
AlaproclateAlaproclate may increase the hypoglycemic activities of Dulaglutide.Experimental
AloxiprinAloxiprin may increase the hypoglycemic activities of Dulaglutide.Experimental
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Dulaglutide.Approved
AripiprazoleThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Aripiprazole.Approved, Investigational
Arsenic trioxideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Arsenic trioxide.Approved, Investigational
ArticaineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Articaine.Approved
AsenapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Asenapine.Approved
AtazanavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Atazanavir.Approved, Investigational
BalsalazideBalsalazide may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Dulaglutide.Investigational
BendroflumethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Bendroflumethiazide.Approved
BenmoxinBenmoxin may increase the hypoglycemic activities of Dulaglutide.Withdrawn
BetamethasoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BrexpiprazoleThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Brexpiprazole.Approved
BrofaromineBrofaromine may increase the hypoglycemic activities of Dulaglutide.Experimental
BumetanideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Bumetanide.Approved
BuserelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Buserelin.Approved
Carbaspirin calciumCarbaspirin calcium may increase the hypoglycemic activities of Dulaglutide.Experimental
CarbutamideDulaglutide may increase the hypoglycemic activities of Carbutamide.Experimental
CaroxazoneCaroxazone may increase the hypoglycemic activities of Dulaglutide.Withdrawn
CeritinibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ceritinib.Approved
ChlorothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Chlorothiazide.Approved, Vet Approved
ChlorpropamideDulaglutide may increase the hypoglycemic activities of Chlorpropamide.Approved
ChlorthalidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Chlorthalidone.Approved
CinoxacinCinoxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Withdrawn
CitalopramCitalopram may increase the hypoglycemic activities of Dulaglutide.Approved
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Dulaglutide.Approved
ClozapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Clozapine.Approved
CorticotropinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Corticotropin.Approved, Vet Approved
Cortisone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Cortisone acetate.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Dulaglutide.Approved
CyclopenthiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Cyclopenthiazide.Experimental
Cyproterone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Cyproterone acetate.Approved, Investigational
DabrafenibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dabrafenib.Approved
DanazolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Danazol.Approved
DapoxetineDapoxetine may increase the hypoglycemic activities of Dulaglutide.Investigational
DarunavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Darunavir.Approved
dersalazinedersalazine may increase the hypoglycemic activities of Dulaglutide.Investigational
DesogestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Desogestrel.Approved
DesvenlafaxineDesvenlafaxine may increase the hypoglycemic activities of Dulaglutide.Approved
DexamethasoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
DiazoxideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Diazoxide.Approved
DienogestThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dienogest.Approved
DiflunisalDiflunisal may increase the hypoglycemic activities of Dulaglutide.Approved
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Dulaglutide.Illicit
DisopyramideDulaglutide may increase the hypoglycemic activities of Disopyramide.Approved
DrospirenoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Drospirenone.Approved
DuloxetineDuloxetine may increase the hypoglycemic activities of Dulaglutide.Approved
EnoxacinEnoxacin may increase the hypoglycemic activities of Dulaglutide.Approved
EpinephrineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Epinephrine.Approved, Vet Approved
EscitalopramEscitalopram may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
EstradiolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
Estrone sulfateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Estrone sulfate.Approved
Etacrynic acidThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Etacrynic acid.Approved
Ethinyl EstradiolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ethinyl Estradiol.Approved
Ethynodiol diacetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ethynodiol diacetate.Approved
EtonogestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoperidoneEtoperidone may increase the hypoglycemic activities of Dulaglutide.Approved
EverolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Everolimus.Approved
FleroxacinFleroxacin may increase the hypoglycemic activities of Dulaglutide.Approved
FludrocortisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Fludrocortisone.Approved
FlumequineFlumequine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
FluoxetineFluoxetine may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Dulaglutide.Approved, Illicit
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
FosamprenavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Fosamprenavir.Approved
FurazolidoneFurazolidone may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
FurosemideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Furosemide.Approved, Vet Approved
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Dulaglutide.Investigational
GarenoxacinGarenoxacin may increase the hypoglycemic activities of Dulaglutide.Investigational
GatifloxacinGatifloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
GemifloxacinGemifloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Dulaglutide.Investigational
GlibornurideDulaglutide may increase the hypoglycemic activities of Glibornuride.Withdrawn
GliclazideDulaglutide may increase the hypoglycemic activities of Gliclazide.Approved
GlimepirideDulaglutide may increase the hypoglycemic activities of Glimepiride.Approved
GlipizideDulaglutide may increase the hypoglycemic activities of Glipizide.Approved
GliquidoneDulaglutide may increase the hypoglycemic activities of Gliquidone.Approved
GlisoxepideDulaglutide may increase the hypoglycemic activities of Glisoxepide.Approved
GLPG-0492GLPG-0492 may increase the hypoglycemic activities of Dulaglutide.Investigational
GlyburideDulaglutide may increase the hypoglycemic activities of Glyburide.Approved
GoserelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Goserelin.Approved
GrepafloxacinGrepafloxacin may increase the hypoglycemic activities of Dulaglutide.Withdrawn
GuacetisalGuacetisal may increase the hypoglycemic activities of Dulaglutide.Experimental
HarmalineHarmaline may increase the hypoglycemic activities of Dulaglutide.Experimental
Hemoglobin crosfumarilHemoglobin crosfumaril may increase the hypoglycemic activities of Dulaglutide.Experimental
HistrelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Histrelin.Approved
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Dulaglutide.Experimental
HydrochlorothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydrochlorothiazide.Approved, Vet Approved
HydrocortisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroflumethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydroflumethiazide.Approved
Hydroxyprogesterone caproateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
IloperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Iloperidone.Approved
IndalpineIndalpine may increase the hypoglycemic activities of Dulaglutide.Investigational, Withdrawn
IndapamideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Indapamide.Approved
IndinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Indinavir.Approved
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Dulaglutide.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Dulaglutide.Investigational
Insulin AspartDulaglutide may increase the hypoglycemic activities of Insulin Aspart.Approved
Insulin DetemirDulaglutide may increase the hypoglycemic activities of Insulin Detemir.Approved
Insulin GlargineDulaglutide may increase the hypoglycemic activities of Insulin Glargine.Approved
Insulin GlulisineDulaglutide may increase the hypoglycemic activities of Insulin Glulisine.Approved
Insulin HumanDulaglutide may increase the hypoglycemic activities of Insulin Human.Approved, Investigational
Insulin LisproDulaglutide may increase the hypoglycemic activities of Insulin Lispro.Approved
Insulin PorkDulaglutide may increase the hypoglycemic activities of Insulin Pork.Approved
IproclozideIproclozide may increase the hypoglycemic activities of Dulaglutide.Withdrawn
IproniazidIproniazid may increase the hypoglycemic activities of Dulaglutide.Withdrawn
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Dulaglutide.Approved
LanreotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lanreotide.Approved
LeuprolideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Leuprolide.Approved, Investigational
LevofloxacinLevofloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Dulaglutide.Approved
LevonorgestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Levonorgestrel.Approved, Investigational
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Dulaglutide.Approved, Nutraceutical
LopinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lopinavir.Approved
LurasidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lurasidone.Approved
MebanazineMebanazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
MecaserminDulaglutide may increase the hypoglycemic activities of Mecasermin.Approved, Investigational
Medroxyprogesterone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MesalazineMesalazine may increase the hypoglycemic activities of Dulaglutide.Approved
MesteroloneMesterolone may increase the hypoglycemic activities of Dulaglutide.Experimental
MestranolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Mestranol.Approved
MetahexamideDulaglutide may increase the hypoglycemic activities of Metahexamide.Experimental
MethotrimeprazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methotrimeprazine.Approved
MethyclothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methyclothiazide.Approved
Methylene blueMethylene blue may increase the hypoglycemic activities of Dulaglutide.Investigational
MethylprednisoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Dulaglutide.Approved
MetolazoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Metolazone.Approved
MifepristoneDulaglutide may increase the hypoglycemic activities of Mifepristone.Approved, Investigational
MilnacipranMilnacipran may increase the hypoglycemic activities of Dulaglutide.Approved
MinaprineMinaprine may increase the hypoglycemic activities of Dulaglutide.Approved
MoclobemideMoclobemide may increase the hypoglycemic activities of Dulaglutide.Approved
Nalidixic AcidNalidixic Acid may increase the hypoglycemic activities of Dulaglutide.Approved
NandroloneNandrolone may increase the hypoglycemic activities of Dulaglutide.Experimental
NateglinideDulaglutide may increase the hypoglycemic activities of Nateglinide.Approved, Investigational
NefazodoneNefazodone may increase the hypoglycemic activities of Dulaglutide.Approved, Withdrawn
NelfinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Nelfinavir.Approved
NemonoxacinNemonoxacin may increase the hypoglycemic activities of Dulaglutide.Investigational
NiacinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Niacin.Approved, Investigational, Nutraceutical
NialamideNialamide may increase the hypoglycemic activities of Dulaglutide.Withdrawn
NilotinibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Nilotinib.Approved, Investigational
NitroaspirinNitroaspirin may increase the hypoglycemic activities of Dulaglutide.Investigational
NorethisteroneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Norethisterone.Approved
NorfloxacinNorfloxacin may increase the hypoglycemic activities of Dulaglutide.Approved
NorgestimateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Norgestimate.Approved
OctamoxinOctamoxin may increase the hypoglycemic activities of Dulaglutide.Withdrawn
OctreotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Octreotide.Approved, Investigational
OlanzapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Olanzapine.Approved, Investigational
OlsalazineOlsalazine may increase the hypoglycemic activities of Dulaglutide.Approved
OxandroloneOxandrolone may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
Oxolinic acidOxolinic acid may increase the hypoglycemic activities of Dulaglutide.Experimental
OxymetholoneOxymetholone may increase the hypoglycemic activities of Dulaglutide.Approved, Illicit
PaliperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Paliperidone.Approved
PargylinePargyline may increase the hypoglycemic activities of Dulaglutide.Approved
ParoxetineParoxetine may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
PasireotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pasireotide.Approved
PazufloxacinPazufloxacin may increase the hypoglycemic activities of Dulaglutide.Investigational
PefloxacinPefloxacin may increase the hypoglycemic activities of Dulaglutide.Approved
PegvisomantPegvisomant may increase the hypoglycemic activities of Dulaglutide.Approved
PentamidineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pentamidine.Approved
PhenelzinePhenelzine may increase the hypoglycemic activities of Dulaglutide.Approved
PheniprazinePheniprazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
Pipemidic acidPipemidic acid may increase the hypoglycemic activities of Dulaglutide.Experimental
PiperazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Piperazine.Approved, Vet Approved
PipotiazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pipotiazine.Approved
PirlindolePirlindole may increase the hypoglycemic activities of Dulaglutide.Approved
Piromidic acidPiromidic acid may increase the hypoglycemic activities of Dulaglutide.Experimental
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
PolythiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Polythiazide.Approved
PrednisoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Prednisone.Approved, Vet Approved
ProgesteroneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Progesterone.Approved, Vet Approved
PrulifloxacinPrulifloxacin may increase the hypoglycemic activities of Dulaglutide.Investigational
QuetiapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Quetiapine.Approved
QuinethazoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Quinethazone.Approved
QuinineDulaglutide may increase the hypoglycemic activities of Quinine.Approved
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Dulaglutide.Approved
RasagilineRasagiline may increase the hypoglycemic activities of Dulaglutide.Approved
RepaglinideDulaglutide may increase the hypoglycemic activities of Repaglinide.Approved, Investigational
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Dulaglutide.Investigational
RisperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Risperidone.Approved, Investigational
RitonavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ritonavir.Approved, Investigational
RosoxacinRosoxacin may increase the hypoglycemic activities of Dulaglutide.Approved
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Dulaglutide.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Dulaglutide.Approved
RufloxacinRufloxacin may increase the hypoglycemic activities of Dulaglutide.Experimental
SafrazineSafrazine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
SaquinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Saquinavir.Approved, Investigational
SelegilineSelegiline may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational, Vet Approved
SertralineSertraline may increase the hypoglycemic activities of Dulaglutide.Approved
SirolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Sirolimus.Approved, Investigational
SitafloxacinSitafloxacin may increase the hypoglycemic activities of Dulaglutide.Experimental
SparfloxacinSparfloxacin may increase the hypoglycemic activities of Dulaglutide.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Dulaglutide.Investigational
StanozololStanozolol may increase the hypoglycemic activities of Dulaglutide.Approved, Vet Approved
SulfadiazineDulaglutide may increase the hypoglycemic activities of Sulfadiazine.Approved, Vet Approved
SulfamethoxazoleDulaglutide may increase the hypoglycemic activities of Sulfamethoxazole.Approved
SulfisoxazoleDulaglutide may increase the hypoglycemic activities of Sulfisoxazole.Approved, Vet Approved
SunitinibDulaglutide may increase the hypoglycemic activities of Sunitinib.Approved, Investigational
TacrolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Tacrolimus.Approved, Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Dulaglutide.Investigational
TemafloxacinTemafloxacin may increase the hypoglycemic activities of Dulaglutide.Withdrawn
TemsirolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Temsirolimus.Approved
TestosteroneTestosterone may increase the hypoglycemic activities of Dulaglutide.Approved, Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Dulaglutide.Investigational
TipranavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Tipranavir.Approved, Investigational
TolazamideDulaglutide may increase the hypoglycemic activities of Tolazamide.Approved
TolbutamideDulaglutide may increase the hypoglycemic activities of Tolbutamide.Approved
ToloxatoneToloxatone may increase the hypoglycemic activities of Dulaglutide.Approved
TorasemideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Torasemide.Approved
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Dulaglutide.Experimental
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Dulaglutide.Approved
TriamcinoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TrichlormethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Trichlormethiazide.Approved, Vet Approved
TriptorelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Triptorelin.Approved, Vet Approved
TrovafloxacinTrovafloxacin may increase the hypoglycemic activities of Dulaglutide.Approved, Withdrawn
VenlafaxineVenlafaxine may increase the hypoglycemic activities of Dulaglutide.Approved
VorinostatThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Vorinostat.Approved, Investigational
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Dulaglutide.Approved
ZimelidineZimelidine may increase the hypoglycemic activities of Dulaglutide.Withdrawn
ZiprasidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ziprasidone.Approved
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Dulaglutide.Approved
Food Interactions
Not Available

References

Synthesis Reference
Not Available
General References
  1. Nadkarni P, Chepurny OG, Holz GG: Regulation of glucose homeostasis by GLP-1. Prog Mol Biol Transl Sci. 2014;121:23-65. doi: 10.1016/B978-0-12-800101-1.00002-8. [PubMed:24373234]
  2. Sanford M: Dulaglutide: first global approval. Drugs. 2014 Nov;74(17):2097-103. doi: 10.1007/s40265-014-0320-7. [PubMed:25367716]
External Links
UniProt
P43220
KEGG Drug
D09889
ChEMBL
CHEMBL2108027
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Dulaglutide
ATC Codes
A10BX14 — Dulaglutide
AHFS Codes
Not Available
PDB Entries
Not Available
FDA label
Not Available
MSDS
Download (97.1 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedBasic ScienceHealthy Volunteers / Type 2 Diabetes Mellitus1
1CompletedTreatmentHealthy Volunteers / Type 2 Diabetes Mellitus1
1CompletedTreatmentType 2 Diabetes Mellitus8
2Active Not RecruitingTreatmentThirst / Water-Electrolyte Imbalance1
2Active Not RecruitingTreatmentType 2 Diabetes Mellitus1
2CompletedTreatmentType 2 Diabetes Mellitus3
2RecruitingTreatmentCessation, Smoking / Craving / Glucagon-like Peptide-1 / Weight Change, Body1
2RecruitingTreatmentPrimary Polydipsia1
2RecruitingTreatmentType 2 Diabetes Mellitus1
2, 3CompletedTreatmentType 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentCardiovascular Disease (CVD) / Type 2 Diabetes Mellitus1
3Active Not RecruitingTreatmentDiabetes / Type 2 Diabetes Mellitus1
3CompletedTreatmentChronic Kidney Disease (CKD) / Type 2 Diabetes Mellitus1
3CompletedTreatmentDiabetes / Type 2 Diabetes Mellitus1
3CompletedTreatmentType 2 Diabetes Mellitus13
3RecruitingTreatmentType 2 Diabetes Mellitus2
4RecruitingTreatmentType 2 Diabetes Mellitus1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous.75 mg/.5mL
Injection, solutionSubcutaneous1.5 mg/.5mL
SolutionSubcutaneous0.75 mg
SolutionSubcutaneous1.5 mg
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Transmembrane signaling receptor activity
Specific Function
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene Name
GLP1R
Uniprot ID
P43220
Uniprot Name
Glucagon-like peptide 1 receptor
Molecular Weight
53025.22 Da
References
  1. Sanford M: Dulaglutide: first global approval. Drugs. 2014 Nov;74(17):2097-103. doi: 10.1007/s40265-014-0320-7. [PubMed:25367716]

Drug created on April 29, 2015 12:08 / Updated on August 17, 2016 12:24