Reteplase
Identification
- Name
- Reteplase
- Accession Number
- DB00015 (BTD00013, BIOD00013)
- Type
- Biotech
- Groups
- Approved, Investigational
- Biologic Classification
- Protein Based Therapies
Thrombolytic agents - Description
Human tissue plasminogen activator, purified, glycosylated, 355 residues purified from CHO cells. Retavase is considered a "third-generation" thrombolytic agent, genetically engineered to retain and delete certain portions of human tPA. Retavase is a deletion mutein of human tPA formed by deleting various amino acids present in endogenous human tPA. Retavase contains 355 of the 527 amino acids of native human tPA (amino acids 1-3 and 176-527), and retains the activity-related kringle-2 and serine protease domains of human tPA. Three domains are deleted from retavase - kringle-1, finger, and epidermal growth factor (EGF).
- Protein structure
- Protein chemical formula
- C1736H2671N499O522S22
- Protein average weight
- 39589.6 Da
- Sequences
>DB00015 sequence SYQGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYC RNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAA IFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKF EVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELS GYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHD ACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Download FASTA Format- Synonyms
- Human t-PA (residues 1-3 and 176-527)
- Reteplasa
- Reteplase, recombinant
- Reteplase,recombinant
- External IDs
- BM 06.022 / BM-06.022 / BM-06022
- Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Unlock Additional DataRetavase Kit 1.81 mg/1mL Intravenous Chiesi Pharmaceuticals Inc. 1996-10-30 Not applicable US Retavase Powder, for solution 10.4 unit Intravenous Ekr Therapeutics 1999-02-19 2013-08-29 Canada Retavase Kit 1.81 mg/1mL Intravenous Ekr Therapeutics 1996-10-30 2017-07-01 US Retavase Kit 1.81 mg/1mL Intravenous Ekr Therapeutics 1996-10-30 2017-07-01 US Retavase Kit 1.81 mg/1mL Intravenous Chiesi Pharmaceuticals Inc. 1996-10-30 Not applicable US Additional Data Available- Application NumberApplication Number
A unique ID assigned by the FDA when a product is submitted for approval by the labeller.
Learn more - Product CodeProduct Code
A governmentally-recognized ID which uniquely identifies the product within its regulatory market.
Learn more
- Categories
- Agents causing angioedema
- Amino Acids, Peptides, and Proteins
- Anticoagulants
- Biological Factors
- Blood and Blood Forming Organs
- Blood Proteins
- Cardiovascular Agents
- Endopeptidases
- Enzymes
- Enzymes and Coenzymes
- Fibrin Modulating Agents
- Fibrinolytic Agents
- Hematologic Agents
- Hydrolases
- Peptide Hydrolases
- Plasminogen Activators
- Proteins
- Serine Endopeptidases
- Serine Proteases
- UNII
- DQA630RIE9
- CAS number
- 133652-38-7
Pharmacology
- Indication
For lysis of acute pulmonary emboli, intracoronary emboli and management of myocardial infarction
- Associated Conditions
- Pharmacodynamics
Reteplase cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
- Mechanism of action
Reteplase binds to fibrin rich clots via the fibronectin finger-like domain and the Kringle 2 domain. The protease domain then cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action.
Target Actions Organism APlasminogen activatorHumans AFibrinogen alpha chain Not Available Humans UUrokinase plasminogen activator surface receptor Not Available Humans UPlasminogen activator inhibitor 1 Not Available Humans - Absorption
- Not Available
- Volume of distribution
- Not Available
- Protein binding
- Not Available
- Metabolism
- Not Available
- Route of elimination
- Not Available
- Half life
- Not Available
- Clearance
- Not Available
- Toxicity
- Not Available
- Affected organisms
- Humans and other mammals
- Pathways
Pathway Category Reteplase Action Pathway Drug action - Pharmacogenomic Effects/ADRs
- Not Available
Comprehensive structured data on known drug adverse effects with statistical prevalence. MedDRA and ICD10 ids are provided for adverse effect conditions and symptoms.
Learn moreStructured data covering drug contraindications. Each contraindication describes a scenario in which the drug is not to be used. Includes restrictions on co-administration, contraindicated populations, and more.
Learn moreStructured data representing warnings from the black box section of drug labels. These warnings cover important and dangerous risks, contraindications, or adverse effects.
Learn moreInteractions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Unlock Additional Data(1,2,6,7-3H)Testosterone (1,2,6,7-3H)Testosterone may increase the anticoagulant activities of Reteplase. (R)-warfarin The risk or severity of bleeding can be increased when Reteplase is combined with (R)-warfarin. (S)-Warfarin The risk or severity of bleeding can be increased when Reteplase is combined with (S)-Warfarin. 1-Testosterone 1-Testosterone may increase the anticoagulant activities of Reteplase. 18-methyl-19-nortestosterone 18-methyl-19-nortestosterone may increase the anticoagulant activities of Reteplase. 3,5-Diiodotyrosine 3,5-Diiodotyrosine may increase the anticoagulant activities of Reteplase. 4-hydroxycoumarin The risk or severity of bleeding can be increased when Reteplase is combined with 4-hydroxycoumarin. 4-Hydroxytestosterone 4-Hydroxytestosterone may increase the anticoagulant activities of Reteplase. 5beta-dihydrotestosterone 5beta-dihydrotestosterone may increase the anticoagulant activities of Reteplase. 7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline The risk or severity of bleeding and hemorrhage can be increased when 7,8-Dichloro-1,2,3,4-tetrahydroisoquinoline is combined with Reteplase. Additional Data Available- Extended DescriptionExtended Description
Extended description of the mechanism of action and particular properties of each drug interaction.
Learn more - Severity
- Evidence Level
- ActionAction
An effect category for each drug interaction. Know how this interaction affects the subject drug.
Learn more
- Food Interactions
- Not Available
References
- General References
- Not Available
- External Links
- UniProt
- P00750
- Genbank
- L00153
- PubChem Substance
- 46506092
- ChEMBL
- CHEMBL2107885
- Therapeutic Targets Database
- DAP001195
- PharmGKB
- PA164743728
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Reteplase
- ATC Codes
- B01AD07 — Reteplase
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 2 Completed Treatment Cerebrovascular Accident 1 3 Not Yet Recruiting Treatment Catheter Occlusion / Thrombotic events 1 3 Not Yet Recruiting Treatment Restoration of Function to CVADs 1 4 Completed Treatment Acute Myocardial Infarction (AMI) 1 4 Completed Treatment Acute Myocardial Infarction (AMI) / Heart Diseases / Myocardial Infarction 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- EKR Therapeutics Inc.
- Hospira Inc.
- PDL BioPharma Inc.
- Dosage forms
Form Route Strength Kit Intravenous 1.81 mg/1mL Powder, for solution Intravenous 10.4 unit - Prices
Unit description Cost Unit Retavase vial half-kit 2605.93USD vial DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
Patent Number Pediatric Extension Approved Expires (estimated) Unlock Additional DataCA2107476 No 2007-12-18 2012-04-15 Canada Additional Data Available- Filed On
Properties
- State
- Liquid
- Experimental Properties
Property Value Source melting point (°C) 60 °C Novokhatny, V.V. et al., J. Biol. Chem. 266:12994-123002 (1991) hydrophobicity -0.435 Not Available isoelectric point 6.86 Not Available
Taxonomy
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Activator
- General Function
- Serine-type peptidase activity
- Specific Function
- Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In...
- Gene Name
- PLG
- Uniprot ID
- P00747
- Uniprot Name
- Plasminogen
- Molecular Weight
- 90568.415 Da
References
- Hilleman DE, Tsikouris JP, Seals AA, Marmur JD: Fibrinolytic agents for the management of ST-segment elevation myocardial infarction. Pharmacotherapy. 2007 Nov;27(11):1558-70. [PubMed:17963464]
- Longstaff C, Williams S, Thelwell C: Fibrin binding and the regulation of plasminogen activators during thrombolytic therapy. Cardiovasc Hematol Agents Med Chem. 2008 Jul;6(3):212-23. [PubMed:18673235]
- Melandri G, Vagnarelli F, Calabrese D, Semprini F, Nanni S, Branzi A: Review of tenecteplase (TNKase) in the treatment of acute myocardial infarction. Vasc Health Risk Manag. 2009;5(1):249-56. Epub 2009 Apr 8. [PubMed:19436656]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- General Function
- Structural molecule activity
- Specific Function
- Cleaved by the protease thrombin to yield monomers which, together with fibrinogen beta (FGB) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function ...
- Gene Name
- FGA
- Uniprot ID
- P02671
- Uniprot Name
- Fibrinogen alpha chain
- Molecular Weight
- 94972.455 Da
References
- Longstaff C, Williams S, Thelwell C: Fibrin binding and the regulation of plasminogen activators during thrombolytic therapy. Cardiovasc Hematol Agents Med Chem. 2008 Jul;6(3):212-23. [PubMed:18673235]
- Melandri G, Vagnarelli F, Calabrese D, Semprini F, Nanni S, Branzi A: Review of tenecteplase (TNKase) in the treatment of acute myocardial infarction. Vasc Health Risk Manag. 2009;5(1):249-56. Epub 2009 Apr 8. [PubMed:19436656]
- Hilleman DE, Tsikouris JP, Seals AA, Marmur JD: Fibrinolytic agents for the management of ST-segment elevation myocardial infarction. Pharmacotherapy. 2007 Nov;27(11):1558-70. [PubMed:17963464]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Urokinase plasminogen activator receptor activity
- Specific Function
- Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-...
- Gene Name
- PLAUR
- Uniprot ID
- Q03405
- Uniprot Name
- Urokinase plasminogen activator surface receptor
- Molecular Weight
- 36977.62 Da
References
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Serine-type endopeptidase inhibitor activity
- Specific Function
- Serine protease inhibitor. This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, protein C and matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major con...
- Gene Name
- SERPINE1
- Uniprot ID
- P05121
- Uniprot Name
- Plasminogen activator inhibitor 1
- Molecular Weight
- 45059.695 Da
References
- Hilleman DE, Tsikouris JP, Seals AA, Marmur JD: Fibrinolytic agents for the management of ST-segment elevation myocardial infarction. Pharmacotherapy. 2007 Nov;27(11):1558-70. [PubMed:17963464]
Drug created on June 13, 2005 07:24 / Updated on December 02, 2019 05:14