Pegaspargase

Identification

Name
Pegaspargase
Accession Number
DB00059  (BTD00079, BIOD00079)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.

Protein structure
Db00059
Protein chemical formula
C1377H2208N382O442S17
Protein average weight
31731.9 Da
Sequences
>DB00059 sequence
MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVGKVGVENLVNA
VPQLKDIANVKGEQVVNIGSQDMNDNVWLTLAKKINTDCDKTDGFVITHGTDTMEETAYF
LDLTVKCDKPVVMVGAMRPSTSMSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGR
DVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKHTSDTPFDVSKLNELPKVGIVY
NYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAKTGTAVVRSSRVPTGAT
TQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY
Download FASTA Format
Synonyms
  • Peg-asparaginase
  • Peg/L-asparaginase
  • Pegaspargasa
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
OncasparInjection, solution750 [iU]/1mLIntramuscular; IntravenousSigma Tau Pharmaceuticals, Inc.1994-02-012016-11-30Us
OncasparInjection, solution750 U/mlBaxalta Innovations Gmb H2016-01-14Not applicableEu
OncasparLiquid750 unitIntramuscular; IntravenousAventis Pharma Ltd.1998-10-13Not applicableCanada
OncasparInjection, solution750 [iU]/1mLIntramuscular; IntravenousBaxalta Canada Corporation1994-02-01Not applicableUs
OncasparSolution750 unitIntramuscular; IntravenousShire Pharma Canada Ulc2017-06-01Not applicableCanada
Categories
UNII
7D96IR0PPM
CAS number
130167-69-0

Pharmacology

Indication

For treatment of acute lymphoblastic leukemia

Associated Conditions
Pharmacodynamics

In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.

Mechanism of action

Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.

TargetActionsOrganism
AL-asparagine
other/unknown
Human
Absorption

Onset of Asparagine depletion by IM is within 4 days Time to peak: IM: 3 to 4 days

Volume of distribution

IV: Adults (asparaginase naive): 2.4 L/m2 Distributes into CSF (reportedly reducing CSF asparagine concentrations to a similar extent as asparaginase

Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life

IM: ~6 days; half-life decreased to ~3 days (range: 1.4 to 5 days) in patients with previous hypersensitivity to native L-asparaginase; IV: Adults (asparaginase naive): 7 days

Clearance
Not Available
Toxicity

Adverse effects that occur more than 10% of the time include hepatotoxicity as it is known to increase serum transaminases (ALT, AST). Also known to induce hypersensitivity reactions including anaphylaxis, erythema and bronchospasm.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
2-MethoxyethanolThe risk or severity of adverse effects can be increased when Pegaspargase is combined with 2-Methoxyethanol.
9-(N-methyl-L-isoleucine)-cyclosporin AThe risk or severity of adverse effects can be increased when Pegaspargase is combined with 9-(N-methyl-L-isoleucine)-cyclosporin A.
AbataceptThe risk or severity of adverse effects can be increased when Pegaspargase is combined with Abatacept.
AbetimusThe risk or severity of adverse effects can be increased when Pegaspargase is combined with Abetimus.
Abicipar PegolThe therapeutic efficacy of Abicipar Pegol can be decreased when used in combination with Pegaspargase.
ActeosideThe risk or severity of adverse effects can be increased when Pegaspargase is combined with Acteoside.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Pegaspargase.
Adenovirus type 7 vaccine liveThe therapeutic efficacy of Adenovirus type 7 vaccine live can be decreased when used in combination with Pegaspargase.
Adenovirus type 7 vaccine liveThe risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Pegaspargase.
AfelimomabThe risk or severity of adverse effects can be increased when Pegaspargase is combined with Afelimomab.
Food Interactions
Not Available

References

General References
  1. Graham ML: Pegaspargase: a review of clinical studies. Adv Drug Deliv Rev. 2003 Sep 26;55(10):1293-302. [PubMed:14499708]
  2. Link [Link]
External Links
UniProt
P37595
Genbank
U00096
PubChem Substance
46505366
ChEMBL
CHEMBL2108546
PharmGKB
PA164760860
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Pegaspargase
ATC Codes
L01XX24 — Pegaspargase
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
FDA label
Download (400 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0TerminatedTreatmentRecurrent Cutaneous T-cell lymphoma / Refractory T-Cell Lymphoma / T-Cell Lymphomas1
1Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)2
1CompletedTreatmentChildhood B Acute Lymphoblastic Leukemia / Childhood T Acute Lymphoblastic Leukemia / Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Lymphoblastic Lymphoma1
1Not Yet RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / All / ALL, Childhood1
1RecruitingTreatmentAcute Lymphoblastic Leukaemia Recurrent / Refractory Acute Lymphoblastic Leukemia1
1RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)1
1TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemia, Lymphoblastic, Acute, T Cell / Lymphoblastic Leukemia, Acute, Childhood1
1TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Recurrent Pediatric ALL / Refractory Pediatric ALL / Relapsed Pediatric ALL1
1WithdrawnTreatmentAcute Lymphoblastic Leukaemias (ALL)1
1, 2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
1, 2CompletedTreatmentRecurrent Childhood Acute Lymphoblastic Leukemia1
1, 2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)1
1, 2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
1, 2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Precursor B-Cell Lymphoblastic Leukemia / Precursor T-Cell Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Lymphoma, Lymphoblastic1
2Active Not RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Adult Lymphoblastic Lymphoma1
2Active Not RecruitingTreatmentExtranodal NK/T-cell Lymphoma, Nasal Type1
2Active Not RecruitingTreatmentLeukemias1
2Active Not RecruitingTreatmentLymphoma, Lymphoblastic1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)2
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2CompletedTreatmentB-cell Adult Acute Lymphoblastic Leukemia / B-cell Adult Acute Lymphoblastic Leukemia (ALL) / Ph Positive Adult Acute Lymphoblastic Leukemia / Ph-positive Adult Acute Lymphoblastic Leukemia (ALL) / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia (ALL) / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Adult Acute Lymphoblastic Leukemia (ALL)1
2CompletedTreatmentB-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Lymphoblastic Lymphoma / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia1
2CompletedTreatmentFallopian Tube Neoplasms / Neoplasms, Ovarian / Primary Peritoneal Neoplasms1
2CompletedTreatmentLeukaemia, Lymphoblastic / Lymphoma, Lymphoblastic1
2CompletedTreatmentLeukemia, Lymphocytic, Acute1
2CompletedTreatmentLeukemias2
2CompletedTreatmentLymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentMalignant Lymphomas1
2CompletedTreatmentNasal Type Extranodal NK/T-Cell Lymphoma1
2RecruitingTreatmentALL (Acute Lymphoblastic Leukemia) / B-cell Acute Lymphoblastic Leukemia / Leukemias1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2RecruitingTreatmentExtranodal NK/T-cell Lymphoma, Nasal Type1
2RecruitingTreatmentLeukaemia, Lymphoblastic1
2RecruitingTreatmentLeukemias1
2RecruitingTreatmentLymphoma, Extranodal NK-T-Cell1
2RecruitingTreatmentPrecursor Cell Lymphoblastic Leukemia-Lymphoma1
2RecruitingTreatmentRecurrent B-Cell Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood B-Lymphoblastic Lymphoma1
2RecruitingTreatmentTreatment Refusal1
2SuspendedTreatmentAcute Leukemias of Ambiguous Lineage / Childhood B Acute Lymphoblastic Leukemia / KMT2A Gene Rearrangement / Mixed Phenotype Acute Leukemia (MPAL)1
2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemia, B-Cell / Leukemia, T-Cell / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Lymphoma, Lymphoblastic1
2TerminatedTreatmentAcute Lymphocytic Leukemia (ALL) / Leukemia Acute Myeloid Leukemia (AML) / Mixed Lineage Acute Leukemia1
2TerminatedTreatmentLeukemias1
2TerminatedTreatmentLeukemias / Lymphoma, Lymphoblastic / Malignant Lymphomas / Precursor-B Acute Lymphoblastic Leukemia1
2TerminatedTreatmentLeukemias / Malignant Lymphomas1
2TerminatedTreatmentLymphoma, Extranodal NK-T-Cell1
2TerminatedTreatmentTreatment Refusal1
2Unknown StatusTreatmentLeukemias1
2WithdrawnTreatmentB Acute Lymphoblastic Leukemia / B Lymphoblastic Lymphoma / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent B Lymphoblastic Lymphoma / Recurrent T Lymphoblastic Leukemia/Lymphoma / Refractory B Lymphoblastic Lymphoma / Refractory T Lymphoblastic Lymphoma / T Acute Lymphoblastic Leukemia / T Lymphoblastic Lymphoma1
2, 3CompletedTreatmentAdult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Childhood B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
2, 3RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Lymphoblastic Lymphoma1
2, 3RecruitingTreatmentAdult Acute Lymphoblastic Leukemia / Adult Lymphoblastic Lymphoma / Leukaemia, Lymphoblastic / Leukemia, Acute / Leukemia, T Cell / Leukemias / Lymphoma, Lymphoblastic1
2, 3RecruitingTreatmentLeukaemia, Lymphoblastic / Leukemia, Acute / Leukemia, T Cell1
2, 3RecruitingTreatmentLeukemias1
3Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult B Lymphoblastic Lymphoma / Ann Arbor Stage I B Lymphoblastic Lymphoma / Ann Arbor Stage II B Lymphoblastic Lymphoma / Childhood B Acute Lymphoblastic Leukemia / Childhood B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Childhood B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Childhood B Lymphoblastic Lymphoma / Down Syndrome (DS) / Hypodiploid B Acute Lymphoblastic Leukemia / Intrachromosomal Amplification of Chromosome 21 / Philadelphia Chromosome Positive / Stage I B Lymphoblastic Lymphoma / Stage II B Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3Active Not RecruitingTreatmentB-cell Childhood Acute Lymphoblastic Leukemia / Intermediate Risk Recurrent Childhood Acute Lymphoblastic Leukemia / L1 Childhood Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia1
3Active Not RecruitingTreatmentB-cell Childhood Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3Active Not RecruitingTreatmentDrug/Agent Toxicity by Tissue/Organ / Leukemias1
3CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
3CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Undifferentiated Leukemia (AUL) / Childhood T Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult T Acute Lymphoblastic Leukemia / Ann Arbor Stage II Adult T-Cell Leukemia/Lymphoma / Ann Arbor Stage II Childhood Lymphoblastic Lymphoma / Ann Arbor Stage II Contiguous Adult Lymphoblastic Lymphoma / Ann Arbor Stage II Non-Contiguous Adult Lymphoblastic Lymphoma / Ann Arbor Stage III Adult Lymphoblastic Lymphoma / Ann Arbor Stage III Adult T-Cell Leukemia/Lymphoma / Ann Arbor Stage III Childhood Lymphoblastic Lymphoma / Ann Arbor Stage IV Adult Lymphoblastic Lymphoma / Ann Arbor Stage IV Adult T-Cell Leukemia/Lymphoma / Ann Arbor Stage IV Childhood Lymphoblastic Lymphoma / Childhood T Acute Lymphoblastic Leukemia / Stage II Adult T-Cell Leukemia/Lymphoma / Stage II Childhood Lymphoblastic Lymphoma / Stage II Contiguous Adult Lymphoblastic Lymphoma / Stage II Non-Contiguous Adult Lymphoblastic Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Adult T-Cell Leukemia/Lymphoma / Stage III Childhood Lymphoblastic Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Adult T-Cell Leukemia/Lymphoma / Stage IV Childhood Lymphoblastic Lymphoma / T Acute Lymphoblastic Leukemia / T Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3CompletedTreatmentChildhood Acute Lymphoblastic Leukemia in Remission / Recurrent Childhood Acute Lymphoblastic Leukemia1
3CompletedTreatmentLeukemias8
3CompletedTreatmentLeukemias / Malignant Lymphomas1
3RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia, Philadelphia Chromosome Negative / BCR/ABL1 Fusion Protein Negative / Untreated Adult Acute Lymphoblastic Leukemia1
3RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / BCR-ABL1 Fusion Protein Expression / Minimal Residual Disease / Philadelphia Chromosome Positive / T Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / B Acute Lymphoblastic Leukemia / Central Nervous System Leukemia / Cognitive Side Effects of Cancer Therapy / Neurotoxicity Syndrome / Osteonecrosis / Pain NOS / Ph-Like Acute Lymphoblastic Leukemia / Testicular Leukemia / Therapy-Related Toxicity / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Lymphoma, Lymphoblastic1
3RecruitingTreatmentAcute Lymphoblastic Leukemia, Pediatric2
3RecruitingTreatmentB Acute Lymphoblastic Leukemia / Central Nervous System Leukemia / Cognitive Side Effects of Cancer Therapy / Neurotoxicity Syndrome / Osteonecrosis / Pain NOS / Testicular Leukemia / Therapy-Related Toxicity / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3RecruitingTreatmentB Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia1
3RecruitingTreatmentExtranodal NK-T-Cell Lymphoma, Nasal Type1
3RecruitingTreatmentExtranodal NK-T-Cell Lymphoma, Nasal and Nasal-Type1
3RecruitingTreatmentExtranodal NK/T-cell Lymphoma, Nasal Type1
3RecruitingTreatmentLeukemias / Mucositis / Oral Complications1
3RecruitingTreatmentLymphohistiocytosis, Hemophagocytic2
3RecruitingTreatmentMalignant Lymphomas1
3SuspendedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult T Acute Lymphoblastic Leukemia / Ann Arbor Stage II Adult Lymphoblastic Lymphoma / Ann Arbor Stage II Childhood Lymphoblastic Lymphoma / Ann Arbor Stage III Adult Lymphoblastic Lymphoma / Ann Arbor Stage III Childhood Lymphoblastic Lymphoma / Ann Arbor Stage IV Adult Lymphoblastic Lymphoma / Ann Arbor Stage IV Childhood Lymphoblastic Lymphoma / Childhood T Acute Lymphoblastic Leukemia / Stage II Adult Lymphoblastic Lymphoma / Stage II Childhood Lymphoblastic Lymphoma / Stage II Contiguous Adult Lymphoblastic Lymphoma / Stage II Non-Contiguous Adult Lymphoblastic Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Childhood Lymphoblastic Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Childhood Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
3TerminatedTreatmentLymphoma, Extranodal NK-T-Cell1
3Unknown StatusTreatmentLeukemias1
4Unknown StatusTreatmentAcute Lymphoblastic Leukaemias (ALL)1
Not AvailableCompletedTreatmentB-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia2
Not AvailableCompletedTreatmentL1 Childhood Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia / Non-T, Non-B Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia1
Not AvailableCompletedTreatmentLeukemias2
Not AvailableCompletedTreatmentT-cell Childhood Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
Not AvailableUnknown StatusTreatmentLeukemias2

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Ben Venue Laboratories Inc.
  • Enzon Inc.
Dosage forms
FormRouteStrength
Injection, solution750 U/ml
Injection, solutionIntramuscular; Intravenous750 [iU]/1mL
LiquidIntramuscular; Intravenous750 unit
SolutionIntramuscular; Intravenous750 unit
Prices
Unit descriptionCostUnit
Oncaspar 750 unit/ml vial656.0USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity0.059Not Available
isoelectric point4.67Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

1. L-asparagine
Kind
Small molecule
Organism
Human
Pharmacological action
Yes
Actions
Other/unknown
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. Douer D, Yampolsky H, Cohen LJ, Watkins K, Levine AM, Periclou AP, Avramis VI: Pharmacodynamics and safety of intravenous pegaspargase during remission induction in adults aged 55 years or younger with newly diagnosed acute lymphoblastic leukemia. Blood. 2007 Apr 1;109(7):2744-50. [PubMed:17132721]
  4. Wetzler M, Sanford BL, Kurtzberg J, DeOliveira D, Frankel SR, Powell BL, Kolitz JE, Bloomfield CD, Larson RA: Effective asparagine depletion with pegylated asparaginase results in improved outcomes in adult acute lymphoblastic leukemia: Cancer and Leukemia Group B Study 9511. Blood. 2007 May 15;109(10):4164-7. Epub 2007 Jan 30. [PubMed:17264295]
  5. Dinndorf PA, Gootenberg J, Cohen MH, Keegan P, Pazdur R: FDA drug approval summary: pegaspargase (oncaspar) for the first-line treatment of children with acute lymphoblastic leukemia (ALL). Oncologist. 2007 Aug;12(8):991-8. [PubMed:17766659]

Drug created on June 13, 2005 07:24 / Updated on November 20, 2018 00:38