Pegaspargase - DrugBank

ID Pharmacology Interactions References Trials Economics Properties Taxonomy

Targets (1)

Targets (1)Biointeractions (1)

Identification

Name

Pegaspargase

Accession Number

DB00059 (BTD00079, BIOD00079)

Type

Biotech

Groups

Approved, Investigational

Description

Pegylated L-asparagine amidohydrolase from E. coli. Pegylation substantially (by a factor of 4) extends the protein half life.

Protein structure

Protein chemical formula

C₁₃₇₇H₂₂₀₈N₃₈₂O₄₄₂S₁₇

Protein average weight

31731.9 Da

Sequences

>DB00059 sequence
MEFFKKTALAALVMGFSGAALALPNITILATGGTIAGGGDSATKSNYTVGKVGVENLVNA
VPQLKDIANVKGEQVVNIGSQDMNDNVWLTLAKKINTDCDKTDGFVITHGTDTMEETAYF
LDLTVKCDKPVVMVGAMRPSTSMSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGR
DVTKTNTTDVATFKSVNYGPLGYIHNGKIDYQRTPARKHTSDTPFDVSKLNELPKVGIVY
NYANASDLPAKALVDAGYDGIVSAGVGNGNLYKSVFDTLATAAKTGTAVVRSSRVPTGAT
TQDAEVDDAKYGFVASGTLNPQKARVLLQLALTQTKDPQQIQQIFNQY

Download FASTA Format

Synonyms

Peg-asparaginase

Peg/L-asparaginase

External IDs

Not Available

Product Ingredients

Not Available

Approved Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Oncaspar	Injection, solution	750 [iU]/mL	Intramuscular; Intravenous	Baxalta Canada Corporation	1994-02-01	Not applicable	US
Oncaspar	Liquid	750 unit	Intramuscular; Intravenous	Aventis Pharma Ltd.	1998-10-13	2004-01-02	Canada
Oncaspar	Solution	750 unit	Intramuscular; Intravenous	Baxalta Canada Corporation	Not applicable	Not applicable	Canada
Oncaspar	Injection, solution	750 [iU]/mL	Intramuscular; Intravenous	Sigma Tau Pharmaceuticals, Inc.	1994-02-01	2016-11-30	US
Oncaspar Use	Injection, solution	750 U/ml	Intramuscular; Intravenous	Baxalta Innovations Gmb H	2016-01-14	Not applicable	EU

Approved Generic Prescription Products

Not Available

Approved Over the Counter Products

Not Available

Unapproved/Other Products

Not Available

International Brands

Not Available

Brand mixtures

Not Available

Categories

UNII

7D96IR0PPM

CAS number

130167-69-0

Pharmacology

Indication

For treatment of acute lymphoblastic leukemia

Structured Indications

Acute Lymphoblastic Leukaemias (ALL)

Pharmacodynamics

In a significant number of patients with acute leukemia, the malignant cells are dependent on an exogenous source of asparagine for survival. Normal cells, however, are able to synthesize asparagine and thus are affected less by the rapid depletion produced by treatment with the enzyme asparaginase. Oncaspar exploits a metabolic defect in asparagine synthesis of some malignant cells.

Mechanism of action

Pegaspargase, more effective than asparaginase, converts asparagine to aspartic acid and ammonia. It facilitates production of oxaloacetate which is needed for general cellular metabolism. Some malignant cells lose the ability to produce asparagine and so the loss of exogenous sources of asparagine leads to cell death.

Target	Kind	Pharmacological action	Actions	Organism	UniProt ID
L-asparagine	Small molecule	yes	other/unknown	Human	not applicable	details

Absorption

Onset of Asparagine depletion by IM is within 4 days Time to peak: IM: 3 to 4 days

Volume of distribution

IV: Adults (asparaginase naive): 2.4 L/m2 Distributes into CSF (reportedly reducing CSF asparagine concentrations to a similar extent as asparaginase

Protein binding

Not Available

Metabolism

Not Available

Route of elimination

Not Available

Half life

IM: ~6 days; half-life decreased to ~3 days (range: 1.4 to 5 days) in patients with previous hypersensitivity to native L-asparaginase; IV: Adults (asparaginase naive): 7 days

Clearance

Not Available

Toxicity

Adverse effects that occur more than 10% of the time include hepatotoxicity as it is known to increase serum transaminases (ALT, AST). Also known to induce hypersensitivity reactions including anaphylaxis, erythema and bronchospasm.

Affected organisms

Humans and other mammals

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

Drug	Interaction	Drug group
Acetyldigitoxin	Acetyldigitoxin may decrease the cardiotoxic activities of Pegaspargase.	Approved
Bevacizumab	Bevacizumab may increase the cardiotoxic activities of Pegaspargase.	Approved, Investigational
Cabazitaxel	The risk or severity of adverse effects can be increased when Cabazitaxel is combined with Pegaspargase.	Approved
Cyclophosphamide	Cyclophosphamide may increase the cardiotoxic activities of Pegaspargase.	Approved, Investigational
Denosumab	The risk or severity of adverse effects can be increased when Denosumab is combined with Pegaspargase.	Approved
Deslanoside	Deslanoside may decrease the cardiotoxic activities of Pegaspargase.	Approved
Digitoxin	Digitoxin may decrease the cardiotoxic activities of Pegaspargase.	Approved
Digoxin	Digoxin may decrease the cardiotoxic activities of Pegaspargase.	Approved
Docetaxel	The risk or severity of adverse effects can be increased when Docetaxel is combined with Pegaspargase.	Approved, Investigational
Fingolimod	Pegaspargase may increase the immunosuppressive activities of Fingolimod.	Approved, Investigational
G17DT	The risk or severity of adverse effects can be increased when Pegaspargase is combined with G17DT.	Investigational
INGN 201	The risk or severity of adverse effects can be increased when Pegaspargase is combined with INGN 201.	Investigational
INGN 225	The risk or severity of adverse effects can be increased when Pegaspargase is combined with INGN 225.	Investigational
Leflunomide	The risk or severity of adverse effects can be increased when Pegaspargase is combined with Leflunomide.	Approved, Investigational
Natalizumab	The risk or severity of adverse effects can be increased when Pegaspargase is combined with Natalizumab.	Approved, Investigational
Oleandrin	Anvirzel may decrease the cardiotoxic activities of Pegaspargase.	Experimental
Ouabain	Ouabain may decrease the cardiotoxic activities of Pegaspargase.	Approved
Paclitaxel	The risk or severity of adverse effects can be increased when Paclitaxel is combined with Pegaspargase.	Approved, Vet Approved
Pegloticase	The therapeutic efficacy of Pegaspargase can be decreased when used in combination with Pegloticase.	Approved
Pimecrolimus	The risk or severity of adverse effects can be increased when Pimecrolimus is combined with Pegaspargase.	Approved, Investigational
Rindopepimut	The risk or severity of adverse effects can be increased when Pegaspargase is combined with CDX-110.	Investigational
Roflumilast	Roflumilast may increase the immunosuppressive activities of Pegaspargase.	Approved
Sipuleucel-T	The therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Pegaspargase.	Approved
SRP 299	The risk or severity of adverse effects can be increased when Pegaspargase is combined with SRP 299.	Investigational
Tacrolimus	The risk or severity of adverse effects can be increased when Tacrolimus is combined with Pegaspargase.	Approved, Investigational
Tofacitinib	Pegaspargase may increase the immunosuppressive activities of Tofacitinib.	Approved, Investigational
Trastuzumab	Trastuzumab may increase the cardiotoxic activities of Pegaspargase.	Approved, Investigational

Food Interactions

Not Available

References

Synthesis Reference

Not Available

General References

Graham ML: Pegaspargase: a review of clinical studies. Adv Drug Deliv Rev. 2003 Sep 26;55(10):1293-302. [PubMed:14499708 ]
Link [Link]

External Links

Resource	Link
UniProt	P37595
Genbank	U00096
PharmGKB	PA164760860
Drug Product Database	11706
RxList	http://www.rxlist.com/cgi/generic2/pegaspargase.htm
Drugs.com	http://www.drugs.com/cdi/pegaspargase.html
Wikipedia	Pegaspargase

ATC Codes

L01XX24

AHFS Codes

Not Available

PDB Entries

1JN9

FDA label

Download (400 KB)

MSDS

Not Available

Clinical Trials

Phase	Status	Purpose	Conditions	Count
0	Terminated	Treatment	Recurrent Cutaneous T-cell lymphoma / Refractory T-Cell Lymphoma / T-Cell Lymphomas	1
1	Active Not Recruiting	Treatment	Acute Lymphoblastic Leukaemias (ALL)	2
1	Completed	Treatment	Childhood B Acute Lymphoblastic Leukemia / Childhood T Acute Lymphoblastic Leukemia / Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Lymphoblastic Lymphoma	1
1	Recruiting	Treatment	Acute Lymphoblastic Leukaemias (ALL)	1
1	Terminated	Treatment	Acute Lymphoblastic Leukaemias (ALL) / Recurrent Pediatric ALL / Refractory Pediatric ALL / Relapsed Pediatric ALL	1
1	Terminated	Treatment	Leukemia, Lymphoblastic, Acute / Leukemia, Lymphoblastic, Acute, T Cell / Lymphoblastic Leukemia, Acute / Lymphoblastic Leukemia, Acute, Childhood	1
1	Withdrawn	Treatment	Acute Lymphoblastic Leukaemias (ALL)	1
1, 2	Active Not Recruiting	Treatment	Recurrent Childhood Acute Lymphoblastic Leukemia	1
1, 2	Completed	Treatment	Acute Lymphoblastic Leukaemias (ALL)	1
1, 2	Recruiting	Treatment	Acute Lymphoblastic Leukaemias (ALL)	1
1, 2	Terminated	Treatment	Acute Lymphoblastic Leukaemias (ALL)	1
1, 2	Terminated	Treatment	Acute Lymphoblastic Leukaemias (ALL) / Precursor B-Cell Lymphoblastic Leukemia / Precursor T-Cell Lymphoblastic Leukemia	1
2	Active Not Recruiting	Treatment	Acute Lymphoblastic Leukaemias (ALL)	1
2	Active Not Recruiting	Treatment	Acute Lymphoblastic Leukaemias (ALL) / Lymphoma, Lymphoblastic	1
2	Active Not Recruiting	Treatment	B-cell Adult Acute Lymphoblastic Leukemia / Ph Positive Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / T-cell Adult Acute Lymphoblastic Leukemia	1
2	Active Not Recruiting	Treatment	Extranodal NK/T-cell Lymphoma, Nasal Type	1
2	Active Not Recruiting	Treatment	Leukaemia, Lymphoblastic / Lymphoma, Lymphoblastic	1
2	Active Not Recruiting	Treatment	Leukemias	1
2	Active Not Recruiting	Treatment	Leukemias / Lymphoma, Lymphoblastic / Malignant Lymphomas / Precursor-B Acute Lymphoblastic Leukemia	1
2	Active Not Recruiting	Treatment	Nasal Type Extranodal NK/T-Cell Lymphoma	1
2	Completed	Treatment	Acute Lymphoblastic Leukaemias (ALL)	2
2	Completed	Treatment	Acute Lymphoblastic Leukaemias (ALL) / Leukemias	1
2	Completed	Treatment	B-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Lymphoblastic Lymphoma / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia	1
2	Completed	Treatment	Fallopian Tube Neoplasms / Neoplasms, Ovarian / Primary Peritoneal Neoplasms	1
2	Completed	Treatment	Leukemia, Lymphocytic, Acute	1
2	Completed	Treatment	Leukemias	2
2	Completed	Treatment	Lymphoma, Hodgkins / Multiple Myeloma (MM) / Non-Hodgkin's Lymphoma (NHL)	1
2	Completed	Treatment	Malignant Lymphomas	1
2	Not Yet Recruiting	Treatment	B Acute Lymphoblastic Leukemia / B Lymphoblastic Lymphoma / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent B Lymphoblastic Lymphoma / Recurrent T Lymphoblastic Leukemia/Lymphoma / Refractory B Lymphoblastic Lymphoma / Refractory T Lymphoblastic Lymphoma / T Acute Lymphoblastic Leukemia / T Lymphoblastic Lymphoma	1
2	Recruiting	Treatment	Acute Lymphoblastic Leukaemias (ALL) / Leukemia, B-Cell / Leukemia, T-Cell / Non-Hodgkin's Lymphoma (NHL)	1
2	Recruiting	Treatment	Acute Lymphoblastic Leukaemias (ALL) / Lymphoma, Lymphoblastic	1
2	Recruiting	Treatment	Acute Lymphocytic Leukemia (ALL) / Adult Lymphoblastic Lymphoma	1
2	Recruiting	Treatment	B-cell Acute Lymphoblastic Leukemia	1
2	Recruiting	Treatment	Extranodal NK/T-cell Lymphoma, Nasal Type	1
2	Recruiting	Treatment	Leukaemia, Lymphoblastic	1
2	Recruiting	Treatment	Leukemias	1
2	Recruiting	Treatment	Lymphoma, Extranodal NK-T-Cell	1
2	Recruiting	Treatment	Recurrent B-Cell Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood B-Lymphoblastic Lymphoma	1
2	Recruiting	Treatment	Treatment Refusal	2
2	Terminated	Treatment	Acute Lymphocytic Leukemia (ALL) / Acute Myeloid Leukaemias (AML) / Mixed Lineage Acute Leukemia	1
2	Terminated	Treatment	Leukemias	1
2	Terminated	Treatment	Leukemias / Malignant Lymphomas	1
2	Terminated	Treatment	Lymphoma, Extranodal NK-T-Cell	1
2	Terminated	Treatment	Lymphoma, Lymphoblastic	1
2	Unknown Status	Treatment	Leukemias	1
2, 3	Completed	Treatment	Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Childhood B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
2, 3	Recruiting	Treatment	Leukemias	1
3	Active Not Recruiting	Treatment	Acute Undifferentiated Leukemia (AUL) / T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
3	Active Not Recruiting	Treatment	Adult T Acute Lymphoblastic Leukemia / Childhood T Acute Lymphoblastic Leukemia / Stage II Adult T-Cell Leukemia/Lymphoma / Stage II Childhood Lymphoblastic Lymphoma / Stage II Contiguous Adult Lymphoblastic Lymphoma / Stage II Non-Contiguous Adult Lymphoblastic Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Adult T-Cell Leukemia/Lymphoma / Stage III Childhood Lymphoblastic Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Adult T-Cell Leukemia/Lymphoma / Stage IV Childhood Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
3	Active Not Recruiting	Treatment	B-cell Childhood Acute Lymphoblastic Leukemia / Intermediate Risk Recurrent Childhood Acute Lymphoblastic Leukemia / L1 Childhood Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia	1
3	Active Not Recruiting	Treatment	B-cell Childhood Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
3	Active Not Recruiting	Treatment	Drug/Agent Toxicity by Tissue/Organ / Leukemias	1
3	Completed	Treatment	Acute Lymphoblastic Leukaemias (ALL)	1
3	Completed	Treatment	Childhood Acute Lymphoblastic Leukemia in Remission / Recurrent Childhood Acute Lymphoblastic Leukemia	1
3	Completed	Treatment	Leukemias	8
3	Completed	Treatment	Leukemias / Malignant Lymphomas	1
3	Not Yet Recruiting	Treatment	Acute Lymphoblastic Leukemia, Pediatric	1
3	Not Yet Recruiting	Treatment	B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / BCR-ABL1 Fusion Protein Expression / Minimal Residual Disease / Philadelphia Chromosome Positive / T Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
3	Recruiting	Treatment	Acute Lymphoblastic Leukaemias (ALL) / Lymphoma, Lymphoblastic	1
3	Recruiting	Treatment	Adult B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia, Philadelphia Chromosome Negative / Untreated Adult Acute Lymphoblastic Leukemia	1
3	Recruiting	Treatment	Adult B Lymphoblastic Lymphoma / Childhood B Acute Lymphoblastic Leukemia / Childhood B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Childhood B Lymphoblastic Lymphoma / Down Syndrome (DS) / Stage I B Lymphoblastic Lymphoma / Stage II B Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
3	Recruiting	Treatment	Adult T Acute Lymphoblastic Leukemia / Childhood T Acute Lymphoblastic Leukemia / Stage II Childhood Lymphoblastic Lymphoma / Stage II Contiguous Adult Lymphoblastic Lymphoma / Stage II Non-Contiguous Adult Lymphoblastic Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Childhood Lymphoblastic Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Childhood Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
3	Recruiting	Treatment	B Acute Lymphoblastic Leukemia / Central Nervous System Leukemia / Cognitive Side Effects of Cancer Therapy / Neurotoxicity Syndrome / Osteonecrosis / Pain / Testicular Leukemia / Therapy-Related Toxicity / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	2
3	Recruiting	Treatment	B Acute Lymphoblastic Leukemia / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia	1
3	Recruiting	Treatment	Childhood Acute Myeloid Leukemia / Childhood Myelodysplastic Syndrome / Cytopenias / Down Syndrome (DS) / Myeloid Leukemia Associated With Down Syndrome / Myeloproliferative Neoplasms	1
3	Recruiting	Treatment	Extranodal NK-T-Cell Lymphoma, Nasal Type	1
3	Recruiting	Treatment	Extranodal NK-T-Cell Lymphoma, Nasal and Nasal-Type	1
3	Recruiting	Treatment	Extranodal NK/T-cell Lymphoma, Nasal Type	1
3	Recruiting	Treatment	Granulocytic Sarcoma / Leukaemia cutis / Untreated Adult Acute Myeloid Leukemia / Untreated Childhood Myeloid Neoplasm	1
3	Recruiting	Treatment	Lymphohistiocytosis, Hemophagocytic	2
3	Recruiting	Treatment	Lymphoma, Extranodal NK-T-Cell	1
3	Recruiting	Treatment	Malignant Lymphomas	1
3	Unknown Status	Treatment	Leukemias	1
3	Unknown Status	Treatment	Leukemias / Mucositis / Oral Complications	1
4	Unknown Status	Treatment	Acute Lymphoblastic Leukaemias (ALL)	1
Not Available	Active Not Recruiting	Treatment	B-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
Not Available	Completed	Treatment	B-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
Not Available	Completed	Treatment	L1 Childhood Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia / Non-T, Non-B Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia	1
Not Available	Completed	Treatment	Leukemias	2
Not Available	Completed	Treatment	T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia	1
Not Available	Recruiting	Treatment	Acute Leukemias of Ambiguous Lineage / Childhood B Acute Lymphoblastic Leukemia / Mixed Phenotype Acute Leukemia (MPAL)	1
Not Available	Unknown Status	Treatment	Leukemias	2

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Dosage forms

Form	Route	Strength
Injection, solution	Intramuscular; Intravenous	750 [iU]/mL
Liquid	Intramuscular; Intravenous	750 unit
Solution	Intramuscular; Intravenous	750 unit
Injection, solution	Intramuscular; Intravenous	750 U/ml

Prices

Unit description	Cost	Unit
Oncaspar 750 unit/ml vial	656.0USD	ml

DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.

Patents

Not Available

Properties

State

Liquid

Experimental Properties

Property	Value	Source
hydrophobicity	0.059	Not Available
isoelectric point	4.67	Not Available

Taxonomy

Description

Not Available

Kingdom

Organic Compounds

Super Class

Organic Acids

Class

Carboxylic Acids and Derivatives

Sub Class

Amino Acids, Peptides, and Analogues

Direct Parent

Peptides

Alternative Parents

Not Available

Substituents

Not Available

Molecular Framework

Not Available

External Descriptors

Not Available

Targets

1. L-asparagine

Kind: Small molecule
Organism: Human
Pharmacological action: yes
Actions: other/unknown

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Douer D, Yampolsky H, Cohen LJ, Watkins K, Levine AM, Periclou AP, Avramis VI: Pharmacodynamics and safety of intravenous pegaspargase during remission induction in adults aged 55 years or younger with newly diagnosed acute lymphoblastic leukemia. Blood. 2007 Apr 1;109(7):2744-50. [PubMed:17132721 ]
Wetzler M, Sanford BL, Kurtzberg J, DeOliveira D, Frankel SR, Powell BL, Kolitz JE, Bloomfield CD, Larson RA: Effective asparagine depletion with pegylated asparaginase results in improved outcomes in adult acute lymphoblastic leukemia: Cancer and Leukemia Group B Study 9511. Blood. 2007 May 15;109(10):4164-7. Epub 2007 Jan 30. [PubMed:17264295 ]
Dinndorf PA, Gootenberg J, Cohen MH, Keegan P, Pazdur R: FDA drug approval summary: pegaspargase (oncaspar) for the first-line treatment of children with acute lymphoblastic leukemia (ALL). Oncologist. 2007 Aug;12(8):991-8. [PubMed:17766659 ]

Drug created on June 13, 2005 07:24 / Updated on June 08, 2017 10:00

Get DrugBank to go!

Targets

References