You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameNesiritide
Accession NumberDB04899
TypeBiotech
GroupsApproved, Investigational
DescriptionNesiritide is a medication used to treat acutely decompensated congestive heart failure with dyspnea at rest or with minimal exertion (such as talk, eating or bathing). Nesiritide is the recombinant form of the 32 amino acid human B-type natriuretic peptide, which is normally produced by the ventricular myocardium.
Protein structureDb04899
Related Articles
Protein chemical formulaNot Available
Protein average weight3464.0 Da
Sequences
>DB04899: Natriuretic peptides B
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Download FASTA Format
Synonyms
BNP
Brain natriuretic peptide 32
Natriuretic peptides B
Nesiritide recombinant
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
NatrecorInjection, powder, lyophilized, for solution1.5 mg/5mLIntravenousScios LLC2001-08-01Not applicableUs
NatrecorPowder, for solution1.5 mgIntravenousJanssen Inc2008-02-052012-08-01Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIP7WI8UL647
CAS number124584-08-3
Pharmacology
IndicationFor the intravenous treatment of patients with acutely decompensated congestive heart failure who have dyspnea at rest or with minimal activity.
Structured Indications
PharmacodynamicsNesiritide works to facilitate cardiovascular fluid homeostasis through counterregulation of the renin-angiotensin-aldoesterone system, stimulating cyclic guanosine monophosphate, leading to smooth muscle cell relaxation. In simpler terms, it promotes vasodilation, natriuresis, and diuresis.
Mechanism of actionHuman BNP binds to the particulate guanylate cyclase receptor of vascular smooth muscle and endothelial cells, leading to increased intracellular concentrations of guanosine 3'5'-cyclic monophosphate (cGMP) and smooth muscle cell relaxation. Cyclic GMP serves as a second messenger to dilate veins and arteries. Nesiritide has been shown to relax isolated human arterial and venous tissue preparations that were precontracted with either endothelin-1 or the alpha-adrenergic agonist, phenylephrine. In human studies, nesiritide produced dose-dependent reductions in pulmonary capillary wedge pressure (PCWP) and systemic arterial pressure in patients with heart failure. In animals, nesiritide had no effects on cardiac contractility or on measures of cardiac electrophysiology such as atrial and ventricular effective refractory times or atrioventricular node conduction. Naturally occurring atrial natriuretic peptide (ANP), a related peptide, increases vascular permeability in animals and humans and may reduce intravascular volume. The effect of nesiritide on vascular permeability has not been studied.
TargetKindPharmacological actionActionsOrganismUniProt ID
Atrial natriuretic peptide receptor 1Proteinunknown
binder
HumanP16066 details
Atrial natriuretic peptide receptor 2ProteinunknownNot AvailableHumanP20594 details
Atrial natriuretic peptide receptor 3ProteinunknownNot AvailableHumanP17342 details
Related Articles
AbsorptionAdministration of nesiritide exhibits biphasic disposition from the plasma.
Volume of distribution
  • 0.19 L/kg
Protein bindingNot Available
Metabolism

Nesiritide undergoes proteolytic cleavage of the peptide by endopeptidases, such as neutral endopeptidase, which are present on the vascular lumenal surface.

Route of eliminationHuman BNP is cleared from the circulation via the following three independent mechanisms, in order of decreasing importance: 1) binding to cell surface clearance receptors with subsequent cellular internalization and lysosomal proteolysis; 2) proteolytic cleavage of the peptide by endopeptidases, such as neutral endopeptidase, which are present on the vascular lumenal surface; and 3) renal filtration.
Half lifeApproximately 18 minutes
Clearance
  • 9.2 mL/min/k [patients with congestive heart failure receiving IV infusion]
ToxicityNo data are available with respect to overdosage in humans. The expected reaction would be excessive hypotension, which should be treated with drug discontinuation or reduction and appropriate measures.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AcebutololThe risk or severity of adverse effects can be increased when Acebutolol is combined with Nesiritide.Approved
AcetazolamideThe risk or severity of adverse effects can be increased when Nesiritide is combined with Acetazolamide.Approved, Vet Approved
AldesleukinThe risk or severity of adverse effects can be increased when Aldesleukin is combined with Nesiritide.Approved
AliskirenThe risk or severity of adverse effects can be increased when Nesiritide is combined with Aliskiren.Approved, Investigational
AmifostineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Amifostine.Approved, Investigational
AmilorideThe risk or severity of adverse effects can be increased when Amiloride is combined with Nesiritide.Approved
AmiodaroneThe risk or severity of adverse effects can be increased when Nesiritide is combined with Amiodarone.Approved, Investigational
AmlodipineThe risk or severity of adverse effects can be increased when Amlodipine is combined with Nesiritide.Approved
AmobarbitalAmobarbital may increase the hypotensive activities of Nesiritide.Approved, Illicit
Amphotericin BThe risk or severity of adverse effects can be increased when Nesiritide is combined with Amphotericin B.Approved, Investigational
Amyl NitriteThe risk or severity of adverse effects can be increased when Amyl Nitrite is combined with Nesiritide.Approved
ApomorphineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Apomorphine.Approved, Investigational
ApraclonidineThe risk or severity of adverse effects can be increased when Apraclonidine is combined with Nesiritide.Approved
AripiprazoleAripiprazole may increase the hypotensive activities of Nesiritide.Approved, Investigational
ArotinololThe risk or severity of adverse effects can be increased when Nesiritide is combined with Arotinolol.Approved
Arsenic trioxideThe risk or severity of adverse effects can be increased when Nesiritide is combined with Arsenic trioxide.Approved, Investigational
AtenololThe risk or severity of adverse effects can be increased when Atenolol is combined with Nesiritide.Approved
Azilsartan medoxomilThe risk or severity of adverse effects can be increased when Nesiritide is combined with Azilsartan medoxomil.Approved
BarbexacloneBarbexaclone may increase the hypotensive activities of Nesiritide.Experimental
BarbitalBarbital may increase the hypotensive activities of Nesiritide.Illicit
BarnidipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Barnidipine.Approved
BenazeprilThe risk or severity of adverse effects can be increased when Benazepril is combined with Nesiritide.Approved, Investigational
BendroflumethiazideThe risk or severity of adverse effects can be increased when Bendroflumethiazide is combined with Nesiritide.Approved
BepridilThe risk or severity of adverse effects can be increased when Nesiritide is combined with Bepridil.Approved, Withdrawn
BetaxololThe risk or severity of adverse effects can be increased when Betaxolol is combined with Nesiritide.Approved
BisoprololThe risk or severity of adverse effects can be increased when Bisoprolol is combined with Nesiritide.Approved
BortezomibThe risk or severity of adverse effects can be increased when Nesiritide is combined with Bortezomib.Approved, Investigational
BretyliumThe risk or severity of adverse effects can be increased when Bretylium is combined with Nesiritide.Approved
BrimonidineThe risk or severity of adverse effects can be increased when Brimonidine is combined with Nesiritide.Approved
BromocriptineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Bromocriptine.Approved, Investigational
BumetanideThe risk or severity of adverse effects can be increased when Bumetanide is combined with Nesiritide.Approved
BupivacaineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Bupivacaine.Approved, Investigational
CanagliflozinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Canagliflozin.Approved
CandesartanThe risk or severity of adverse effects can be increased when Candesartan is combined with Nesiritide.Approved
CaptoprilThe risk or severity of adverse effects can be increased when Captopril is combined with Nesiritide.Approved
CarbetocinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Carbetocin.Approved
CarteololThe risk or severity of adverse effects can be increased when Carteolol is combined with Nesiritide.Approved
CarvedilolThe risk or severity of adverse effects can be increased when Carvedilol is combined with Nesiritide.Approved, Investigational
ChlorothiazideThe risk or severity of adverse effects can be increased when Chlorothiazide is combined with Nesiritide.Approved, Vet Approved
ChlorpromazineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Chlorpromazine.Approved, Vet Approved
ChlorthalidoneThe risk or severity of adverse effects can be increased when Chlorthalidone is combined with Nesiritide.Approved
CilazaprilThe risk or severity of adverse effects can be increased when Cilazapril is combined with Nesiritide.Approved
CilnidipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Cilnidipine.Approved
ClevidipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Clevidipine.Approved
ClofarabineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Clofarabine.Approved, Investigational
ClomipramineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Clomipramine.Approved, Vet Approved
ClonidineThe risk or severity of adverse effects can be increased when Clonidine is combined with Nesiritide.Approved
ClozapineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Clozapine.Approved
ConivaptanThe risk or severity of adverse effects can be increased when Nesiritide is combined with Conivaptan.Approved, Investigational
DapagliflozinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Dapagliflozin.Approved
DesfluraneThe risk or severity of adverse effects can be increased when Nesiritide is combined with Desflurane.Approved
DexmedetomidineThe risk or severity of adverse effects can be increased when Dexmedetomidine is combined with Nesiritide.Approved, Vet Approved
DiclofenamideThe risk or severity of adverse effects can be increased when Diclofenamide is combined with Nesiritide.Approved
DiltiazemThe risk or severity of adverse effects can be increased when Diltiazem is combined with Nesiritide.Approved
DinutuximabThe risk or severity of adverse effects can be increased when Nesiritide is combined with Dinutuximab.Approved
DipyridamoleThe risk or severity of adverse effects can be increased when Dipyridamole is combined with Nesiritide.Approved
DoxazosinThe risk or severity of adverse effects can be increased when Doxazosin is combined with Nesiritide.Approved
DuloxetineNesiritide may increase the orthostatic hypotensive activities of Duloxetine.Approved
EfonidipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Efonidipine.Approved
EmpagliflozinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Empagliflozin.Approved
EnalaprilThe risk or severity of adverse effects can be increased when Enalapril is combined with Nesiritide.Approved, Vet Approved
EnalaprilatThe risk or severity of adverse effects can be increased when Nesiritide is combined with Enalaprilat.Approved
EplerenoneThe risk or severity of adverse effects can be increased when Eplerenone is combined with Nesiritide.Approved
EpoprostenolThe risk or severity of adverse effects can be increased when Nesiritide is combined with Epoprostenol.Approved
EprosartanThe risk or severity of adverse effects can be increased when Eprosartan is combined with Nesiritide.Approved
EsmololThe risk or severity of adverse effects can be increased when Esmolol is combined with Nesiritide.Approved
Etacrynic acidThe risk or severity of adverse effects can be increased when Etacrynic acid is combined with Nesiritide.Approved
FelodipineThe risk or severity of adverse effects can be increased when Felodipine is combined with Nesiritide.Approved, Investigational
FenoldopamThe risk or severity of adverse effects can be increased when Nesiritide is combined with Fenoldopam.Approved
FimasartanThe risk or severity of adverse effects can be increased when Nesiritide is combined with Fimasartan.Approved
FosinoprilThe risk or severity of adverse effects can be increased when Fosinopril is combined with Nesiritide.Approved
FurosemideThe risk or severity of adverse effects can be increased when Furosemide is combined with Nesiritide.Approved, Vet Approved
GuanfacineThe risk or severity of adverse effects can be increased when Guanfacine is combined with Nesiritide.Approved, Investigational
HalothaneThe risk or severity of adverse effects can be increased when Nesiritide is combined with Halothane.Approved, Vet Approved
HexobarbitalHexobarbital may increase the hypotensive activities of Nesiritide.Approved
HydralazineThe risk or severity of adverse effects can be increased when Hydralazine is combined with Nesiritide.Approved
HydrochlorothiazideThe risk or severity of adverse effects can be increased when Hydrochlorothiazide is combined with Nesiritide.Approved, Vet Approved
HydroflumethiazideThe risk or severity of adverse effects can be increased when Nesiritide is combined with Hydroflumethiazide.Approved
IloprostThe risk or severity of adverse effects can be increased when Nesiritide is combined with Iloprost.Approved, Investigational
ImidaprilThe risk or severity of adverse effects can be increased when Nesiritide is combined with Imidapril.Investigational
ImipramineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Imipramine.Approved
IndapamideThe risk or severity of adverse effects can be increased when Indapamide is combined with Nesiritide.Approved
IndoraminThe risk or severity of adverse effects can be increased when Nesiritide is combined with Indoramin.Withdrawn
IrbesartanThe risk or severity of adverse effects can be increased when Irbesartan is combined with Nesiritide.Approved, Investigational
IsocarboxazidThe risk or severity of adverse effects can be increased when Nesiritide is combined with Isocarboxazid.Approved
IsofluraneThe risk or severity of adverse effects can be increased when Nesiritide is combined with Isoflurane.Approved, Vet Approved
Isosorbide DinitrateThe risk or severity of adverse effects can be increased when Isosorbide Dinitrate is combined with Nesiritide.Approved
Isosorbide MononitrateThe risk or severity of adverse effects can be increased when Isosorbide Mononitrate is combined with Nesiritide.Approved
IsoxsuprineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Isoxsuprine.Approved, Withdrawn
IsradipineThe risk or severity of adverse effects can be increased when Isradipine is combined with Nesiritide.Approved
LabetalolThe risk or severity of adverse effects can be increased when Labetalol is combined with Nesiritide.Approved
LacidipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Lacidipine.Approved
LercanidipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Lercanidipine.Approved, Investigational
LevobunololThe risk or severity of adverse effects can be increased when Levobunolol is combined with Nesiritide.Approved
LevobupivacaineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Levobupivacaine.Approved
LevodopaNesiritide may increase the orthostatic hypotensive activities of Levodopa.Approved
LevosimendanThe risk or severity of adverse effects can be increased when Nesiritide is combined with Levosimendan.Approved, Investigational
LisinoprilThe risk or severity of adverse effects can be increased when Lisinopril is combined with Nesiritide.Approved, Investigational
LofexidineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Lofexidine.Approved, Investigational
LosartanThe risk or severity of adverse effects can be increased when Losartan is combined with Nesiritide.Approved
MannitolThe risk or severity of adverse effects can be increased when Mannitol is combined with Nesiritide.Approved, Investigational
MecamylamineThe risk or severity of adverse effects can be increased when Mecamylamine is combined with Nesiritide.Approved
MethazolamideThe risk or severity of adverse effects can be increased when Methazolamide is combined with Nesiritide.Approved
MethohexitalMethohexital may increase the hypotensive activities of Nesiritide.Approved
MethyclothiazideThe risk or severity of adverse effects can be increased when Methyclothiazide is combined with Nesiritide.Approved
MethyldopaThe risk or severity of adverse effects can be increased when Methyldopa is combined with Nesiritide.Approved
MethylphenobarbitalMethylphenobarbital may increase the hypotensive activities of Nesiritide.Approved
MetipranololThe risk or severity of adverse effects can be increased when Metipranolol is combined with Nesiritide.Approved
MetolazoneThe risk or severity of adverse effects can be increased when Metolazone is combined with Nesiritide.Approved
MetoprololThe risk or severity of adverse effects can be increased when Metoprolol is combined with Nesiritide.Approved, Investigational
MinoxidilThe risk or severity of adverse effects can be increased when Minoxidil is combined with Nesiritide.Approved
MoexiprilThe risk or severity of adverse effects can be increased when Moexipril is combined with Nesiritide.Approved
MorphineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Morphine.Approved, Investigational
MoxonidineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Moxonidine.Approved
NabiloneThe risk or severity of adverse effects can be increased when Nesiritide is combined with Nabilone.Approved, Investigational
NadololThe risk or severity of adverse effects can be increased when Nadolol is combined with Nesiritide.Approved
NebivololThe risk or severity of adverse effects can be increased when Nebivolol is combined with Nesiritide.Approved, Investigational
NicardipineThe risk or severity of adverse effects can be increased when Nicardipine is combined with Nesiritide.Approved
NicorandilNicorandil may increase the hypotensive activities of Nesiritide.Approved
NifedipineThe risk or severity of adverse effects can be increased when Nifedipine is combined with Nesiritide.Approved
NilvadipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Nilvadipine.Approved
NimodipineThe risk or severity of adverse effects can be increased when Nimodipine is combined with Nesiritide.Approved
NisoldipineThe risk or severity of adverse effects can be increased when Nisoldipine is combined with Nesiritide.Approved
NitrendipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Nitrendipine.Approved
Nitric OxideThe risk or severity of adverse effects can be increased when Nesiritide is combined with Nitric Oxide.Approved
NitroglycerinThe risk or severity of adverse effects can be increased when Nitroglycerin is combined with Nesiritide.Approved, Investigational
NitroprussideThe risk or severity of adverse effects can be increased when Nitroprusside is combined with Nesiritide.Approved
ObinutuzumabThe risk or severity of adverse effects can be increased when Nesiritide is combined with Obinutuzumab.Approved
OlmesartanThe risk or severity of adverse effects can be increased when Olmesartan is combined with Nesiritide.Approved, Investigational
OxprenololThe risk or severity of adverse effects can be increased when Nesiritide is combined with Oxprenolol.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Nesiritide is combined with Paclitaxel.Approved, Vet Approved
PapaverineThe risk or severity of adverse effects can be increased when Papaverine is combined with Nesiritide.Approved
PenbutololThe risk or severity of adverse effects can be increased when Penbutolol is combined with Nesiritide.Approved, Investigational
PentobarbitalPentobarbital may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
PerindoprilThe risk or severity of adverse effects can be increased when Perindopril is combined with Nesiritide.Approved
PhenelzineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Phenelzine.Approved
PhenobarbitalPhenobarbital may increase the hypotensive activities of Nesiritide.Approved
PhenoxybenzamineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Phenoxybenzamine.Approved
PhentolamineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Phentolamine.Approved
PindololThe risk or severity of adverse effects can be increased when Pindolol is combined with Nesiritide.Approved
PipamperoneThe risk or severity of adverse effects can be increased when Nesiritide is combined with Pipamperone.Approved
PramipexoleThe risk or severity of adverse effects can be increased when Nesiritide is combined with Pramipexole.Approved, Investigational
PrazosinThe risk or severity of adverse effects can be increased when Prazosin is combined with Nesiritide.Approved
PrimidonePrimidone may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
PropofolThe risk or severity of adverse effects can be increased when Nesiritide is combined with Propofol.Approved, Investigational, Vet Approved
PropranololThe risk or severity of adverse effects can be increased when Propranolol is combined with Nesiritide.Approved, Investigational
QuetiapineThe risk or severity of adverse effects can be increased when Quetiapine is combined with Nesiritide.Approved
QuinaprilThe risk or severity of adverse effects can be increased when Quinapril is combined with Nesiritide.Approved, Investigational
RamiprilThe risk or severity of adverse effects can be increased when Ramipril is combined with Nesiritide.Approved
RasagilineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Rasagiline.Approved
RemifentanilThe risk or severity of adverse effects can be increased when Nesiritide is combined with Remifentanil.Approved
ReserpineThe risk or severity of adverse effects can be increased when Reserpine is combined with Nesiritide.Approved
RiociguatThe risk or severity of adverse effects can be increased when Nesiritide is combined with Riociguat.Approved
RisperidoneNesiritide may increase the hypotensive activities of Risperidone.Approved, Investigational
RopiniroleThe risk or severity of adverse effects can be increased when Nesiritide is combined with Ropinirole.Approved, Investigational
RopivacaineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Ropivacaine.Approved
RotigotineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Rotigotine.Approved
SacubitrilThe risk or severity of adverse effects can be increased when Nesiritide is combined with Sacubitril.Approved
SecobarbitalSecobarbital may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
SelegilineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Selegiline.Approved, Investigational, Vet Approved
SevofluraneThe risk or severity of adverse effects can be increased when Nesiritide is combined with Sevoflurane.Approved, Vet Approved
Sodium NitriteThe risk or severity of adverse effects can be increased when Nesiritide is combined with Sodium Nitrite.Approved
SotalolThe risk or severity of adverse effects can be increased when Sotalol is combined with Nesiritide.Approved
SpironolactoneThe risk or severity of adverse effects can be increased when Spironolactone is combined with Nesiritide.Approved
StreptokinaseThe risk or severity of adverse effects can be increased when Nesiritide is combined with Streptokinase.Approved
SufentanilThe risk or severity of adverse effects can be increased when Nesiritide is combined with Sufentanil.Approved, Investigational
TamsulosinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Tamsulosin.Approved, Investigational
TelmisartanThe risk or severity of adverse effects can be increased when Telmisartan is combined with Nesiritide.Approved, Investigational
TerazosinThe risk or severity of adverse effects can be increased when Terazosin is combined with Nesiritide.Approved
ThalidomideThe risk or severity of adverse effects can be increased when Nesiritide is combined with Thalidomide.Approved, Investigational, Withdrawn
ThiamylalThiamylal may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
ThiopentalThiopental may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
ThioridazineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Thioridazine.Approved
TimololThe risk or severity of adverse effects can be increased when Timolol is combined with Nesiritide.Approved
TizanidineThe risk or severity of adverse effects can be increased when Tizanidine is combined with Nesiritide.Approved
TolazolineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Tolazoline.Approved, Vet Approved
TolcaponeThe risk or severity of adverse effects can be increased when Nesiritide is combined with Tolcapone.Approved, Withdrawn
TorasemideThe risk or severity of adverse effects can be increased when Torasemide is combined with Nesiritide.Approved
TrandolaprilThe risk or severity of adverse effects can be increased when Trandolapril is combined with Nesiritide.Approved
TranylcypromineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Tranylcypromine.Approved
TretinoinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Tretinoin.Approved, Investigational, Nutraceutical
TriamtereneThe risk or severity of adverse effects can be increased when Triamterene is combined with Nesiritide.Approved
ValsartanThe risk or severity of adverse effects can be increased when Valsartan is combined with Nesiritide.Approved, Investigational
VerapamilThe risk or severity of adverse effects can be increased when Verapamil is combined with Nesiritide.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Jefferies JL, Price JF, Denfield SW, Chang AC, Dreyer WJ, McMahon CJ, Grenier MA, Clunie SK, Thomas A, Moffett BS, Wann TS, Smith EO, Towbin JA: Safety and efficacy of nesiritide in pediatric heart failure. J Card Fail. 2007 Sep;13(7):541-8. [PubMed:17826644 ]
  2. Maisel AS: Nesiritide: a new therapy for the treatment of heart failure. Cardiovasc Toxicol. 2003;3(1):37-42. [PubMed:12668889 ]
  3. Vichiendilokkul A, Tran A, Racine E: Nesiritide: a novel approach for acute heart failure. Ann Pharmacother. 2003 Feb;37(2):247-58. [PubMed:12549957 ]
  4. Cheng JW: Nesiritide: review of clinical pharmacology and role in heart failure management. Heart Dis. 2002 May-Jun;4(3):199-203. [PubMed:12028606 ]
  5. Bettencourt P: Brain natriuretic peptide (nesiritide) in the treatment of heart failure. Cardiovasc Drug Rev. 2002 Winter;20(1):27-36. [PubMed:12070532 ]
External Links
ATC CodesC01DX19
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelDownload (205 KB)
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, lyophilized, for solutionIntravenous1.5 mg/5mL
Powder, for solutionIntravenous1.5 mg
Prices
Unit descriptionCostUnit
Natrecor 1.5 mg vial716.36USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339210 No1997-08-052014-08-05Canada
US5114923 No1994-05-192014-05-19Us
Properties
StateSolid
Experimental PropertiesNot Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
binder
General Function:
Protein kinase activity
Specific Function:
Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.
Gene Name:
NPR1
Uniprot ID:
P16066
Molecular Weight:
118918.11 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.
Gene Name:
NPR2
Uniprot ID:
P20594
Molecular Weight:
117020.97 Da
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Peptide hormone binding
Specific Function:
Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May function as a clearance receptor for NPPA, NPPB and NPPC, regulating their local concentrations and effects. May regulate diuresis, blood pressure and skeletal development. Does not have guanylate cyc...
Gene Name:
NPR3
Uniprot ID:
P17342
Molecular Weight:
59807.34 Da
Comments
comments powered by Disqus
Drug created on October 21, 2007 16:23 / Updated on August 17, 2016 12:24