Identification

Name
Nesiritide
Accession Number
DB04899
Type
Biotech
Groups
Approved, Investigational
Description

Nesiritide is a medication used to treat acutely decompensated congestive heart failure with dyspnea at rest or with minimal exertion (such as talk, eating or bathing). Nesiritide is the recombinant form of the 32 amino acid human B-type natriuretic peptide, which is normally produced by the ventricular myocardium.

Protein structure
Db04899
Protein chemical formula
Not Available
Protein average weight
3464.0 Da
Sequences
>DB04899: Natriuretic peptides B
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Download FASTA Format
Synonyms
  • BNP
  • Brain natriuretic peptide 32
  • Natriuretic peptides B
  • Nesiritide recombinant
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
NatrecorInjection, powder, lyophilized, for solution1.5 mg/5mLIntravenousScios, Inc.2001-08-01Not applicableUs
NatrecorPowder, for solution1.5 mgIntravenousJanssen Pharmaceuticals2008-02-052012-08-01Canada
Categories
UNII
P7WI8UL647
CAS number
124584-08-3

Pharmacology

Indication

For the intravenous treatment of patients with acutely decompensated congestive heart failure who have dyspnea at rest or with minimal activity.

Structured Indications
Pharmacodynamics

Nesiritide works to facilitate cardiovascular fluid homeostasis through counterregulation of the renin-angiotensin-aldoesterone system, stimulating cyclic guanosine monophosphate, leading to smooth muscle cell relaxation. In simpler terms, it promotes vasodilation, natriuresis, and diuresis.

Mechanism of action

Human BNP binds to the particulate guanylate cyclase receptor of vascular smooth muscle and endothelial cells, leading to increased intracellular concentrations of guanosine 3'5'-cyclic monophosphate (cGMP) and smooth muscle cell relaxation. Cyclic GMP serves as a second messenger to dilate veins and arteries. Nesiritide has been shown to relax isolated human arterial and venous tissue preparations that were precontracted with either endothelin-1 or the alpha-adrenergic agonist, phenylephrine. In human studies, nesiritide produced dose-dependent reductions in pulmonary capillary wedge pressure (PCWP) and systemic arterial pressure in patients with heart failure. In animals, nesiritide had no effects on cardiac contractility or on measures of cardiac electrophysiology such as atrial and ventricular effective refractory times or atrioventricular node conduction. Naturally occurring atrial natriuretic peptide (ANP), a related peptide, increases vascular permeability in animals and humans and may reduce intravascular volume. The effect of nesiritide on vascular permeability has not been studied.

TargetActionsOrganism
UAtrial natriuretic peptide receptor 1
binder
Human
UAtrial natriuretic peptide receptor 2Not AvailableHuman
UAtrial natriuretic peptide receptor 3Not AvailableHuman
Absorption

Administration of nesiritide exhibits biphasic disposition from the plasma.

Volume of distribution
  • 0.19 L/kg
Protein binding
Not Available
Metabolism

Nesiritide undergoes proteolytic cleavage of the peptide by endopeptidases, such as neutral endopeptidase, which are present on the vascular lumenal surface.

Route of elimination

Human BNP is cleared from the circulation via the following three independent mechanisms, in order of decreasing importance: 1) binding to cell surface clearance receptors with subsequent cellular internalization and lysosomal proteolysis; 2) proteolytic cleavage of the peptide by endopeptidases, such as neutral endopeptidase, which are present on the vascular lumenal surface; and 3) renal filtration.

Half life

Approximately 18 minutes

Clearance
  • 9.2 mL/min/k [patients with congestive heart failure receiving IV infusion]
Toxicity

No data are available with respect to overdosage in humans. The expected reaction would be excessive hypotension, which should be treated with drug discontinuation or reduction and appropriate measures.

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AcebutololThe risk or severity of adverse effects can be increased when Acebutolol is combined with Nesiritide.Approved
AldesleukinThe risk or severity of adverse effects can be increased when Aldesleukin is combined with Nesiritide.Approved
AliskirenThe risk or severity of adverse effects can be increased when Nesiritide is combined with Aliskiren.Approved, Investigational
AmifostineThe risk or severity of adverse effects can be increased when Amifostine is combined with Nesiritide.Approved, Investigational
AmilorideThe risk or severity of adverse effects can be increased when Amiloride is combined with Nesiritide.Approved
AmiodaroneThe risk or severity of adverse effects can be increased when Amiodarone is combined with Nesiritide.Approved, Investigational
AmlodipineThe risk or severity of adverse effects can be increased when Amlodipine is combined with Nesiritide.Approved
AmobarbitalAmobarbital may increase the hypotensive activities of Nesiritide.Approved, Illicit
Amphotericin BThe risk or severity of adverse effects can be increased when Amphotericin B is combined with Nesiritide.Approved, Investigational
Amyl NitriteThe risk or severity of adverse effects can be increased when Amyl Nitrite is combined with Nesiritide.Approved
ApomorphineThe risk or severity of adverse effects can be increased when Apomorphine is combined with Nesiritide.Approved, Investigational
ApraclonidineThe risk or severity of adverse effects can be increased when Apraclonidine is combined with Nesiritide.Approved
AripiprazoleAripiprazole may increase the hypotensive activities of Nesiritide.Approved, Investigational
ArotinololThe risk or severity of adverse effects can be increased when Arotinolol is combined with Nesiritide.Approved
Arsenic trioxideThe risk or severity of adverse effects can be increased when Arsenic trioxide is combined with Nesiritide.Approved, Investigational
AtenololThe risk or severity of adverse effects can be increased when Atenolol is combined with Nesiritide.Approved
Azilsartan medoxomilThe risk or severity of adverse effects can be increased when Nesiritide is combined with Azilsartan medoxomil.Approved
BarbexacloneBarbexaclone may increase the hypotensive activities of Nesiritide.Experimental
BarbitalBarbital may increase the hypotensive activities of Nesiritide.Illicit
BarnidipineThe risk or severity of adverse effects can be increased when Barnidipine is combined with Nesiritide.Approved
BenazeprilThe risk or severity of adverse effects can be increased when Benazepril is combined with Nesiritide.Approved, Investigational
BendroflumethiazideThe risk or severity of adverse effects can be increased when Bendroflumethiazide is combined with Nesiritide.Approved
BepridilThe risk or severity of adverse effects can be increased when Bepridil is combined with Nesiritide.Approved, Withdrawn
BetaxololThe risk or severity of adverse effects can be increased when Betaxolol is combined with Nesiritide.Approved
BisoprololThe risk or severity of adverse effects can be increased when Bisoprolol is combined with Nesiritide.Approved
BortezomibThe risk or severity of adverse effects can be increased when Bortezomib is combined with Nesiritide.Approved, Investigational
BretyliumThe risk or severity of adverse effects can be increased when Bretylium is combined with Nesiritide.Approved
BrimonidineThe risk or severity of adverse effects can be increased when Brimonidine is combined with Nesiritide.Approved
BromocriptineThe risk or severity of adverse effects can be increased when Bromocriptine is combined with Nesiritide.Approved, Investigational
BumetanideThe risk or severity of adverse effects can be increased when Bumetanide is combined with Nesiritide.Approved
BupivacaineThe risk or severity of adverse effects can be increased when Bupivacaine is combined with Nesiritide.Approved, Investigational
CanagliflozinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Canagliflozin.Approved
CandesartanThe risk or severity of adverse effects can be increased when Candesartan is combined with Nesiritide.Approved
CaptoprilThe risk or severity of adverse effects can be increased when Captopril is combined with Nesiritide.Approved
CarbetocinThe risk or severity of adverse effects can be increased when Carbetocin is combined with Nesiritide.Approved
CarteololThe risk or severity of adverse effects can be increased when Carteolol is combined with Nesiritide.Approved
CarvedilolThe risk or severity of adverse effects can be increased when Carvedilol is combined with Nesiritide.Approved, Investigational
ChlorothiazideThe risk or severity of adverse effects can be increased when Chlorothiazide is combined with Nesiritide.Approved, Vet Approved
ChlorpromazineThe risk or severity of adverse effects can be increased when Chlorpromazine is combined with Nesiritide.Approved, Vet Approved
ChlorthalidoneThe risk or severity of adverse effects can be increased when Chlorthalidone is combined with Nesiritide.Approved
CilazaprilThe risk or severity of adverse effects can be increased when Cilazapril is combined with Nesiritide.Approved
CilnidipineThe risk or severity of adverse effects can be increased when Cilnidipine is combined with Nesiritide.Approved
ClevidipineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Clevidipine.Approved
ClofarabineThe risk or severity of adverse effects can be increased when Clofarabine is combined with Nesiritide.Approved, Investigational
ClomipramineThe risk or severity of adverse effects can be increased when Clomipramine is combined with Nesiritide.Approved, Vet Approved
ClonidineThe risk or severity of adverse effects can be increased when Clonidine is combined with Nesiritide.Approved
ClozapineThe risk or severity of adverse effects can be increased when Clozapine is combined with Nesiritide.Approved
ConivaptanThe risk or severity of adverse effects can be increased when Conivaptan is combined with Nesiritide.Approved, Investigational
DapagliflozinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Dapagliflozin.Approved
DesfluraneThe risk or severity of adverse effects can be increased when Desflurane is combined with Nesiritide.Approved
DexmedetomidineThe risk or severity of adverse effects can be increased when Dexmedetomidine is combined with Nesiritide.Approved, Vet Approved
DiclofenamideThe risk or severity of adverse effects can be increased when Diclofenamide is combined with Nesiritide.Approved
DiltiazemThe risk or severity of adverse effects can be increased when Diltiazem is combined with Nesiritide.Approved
DinutuximabThe risk or severity of adverse effects can be increased when Nesiritide is combined with Dinutuximab.Approved
DipyridamoleThe risk or severity of adverse effects can be increased when Dipyridamole is combined with Nesiritide.Approved
DoxazosinThe risk or severity of adverse effects can be increased when Doxazosin is combined with Nesiritide.Approved
DuloxetineNesiritide may increase the orthostatic hypotensive activities of Duloxetine.Approved
EfonidipineThe risk or severity of adverse effects can be increased when Efonidipine is combined with Nesiritide.Approved
EmpagliflozinThe risk or severity of adverse effects can be increased when Nesiritide is combined with Empagliflozin.Approved
EnalaprilThe risk or severity of adverse effects can be increased when Enalapril is combined with Nesiritide.Approved, Vet Approved
EnalaprilatThe risk or severity of adverse effects can be increased when Enalaprilat is combined with Nesiritide.Approved
EplerenoneThe risk or severity of adverse effects can be increased when Eplerenone is combined with Nesiritide.Approved
EpoprostenolThe risk or severity of adverse effects can be increased when Epoprostenol is combined with Nesiritide.Approved
EprosartanThe risk or severity of adverse effects can be increased when Eprosartan is combined with Nesiritide.Approved
EsmololThe risk or severity of adverse effects can be increased when Esmolol is combined with Nesiritide.Approved
Etacrynic acidThe risk or severity of adverse effects can be increased when Etacrynic acid is combined with Nesiritide.Approved
FelodipineThe risk or severity of adverse effects can be increased when Felodipine is combined with Nesiritide.Approved, Investigational
FenoldopamThe risk or severity of adverse effects can be increased when Fenoldopam is combined with Nesiritide.Approved
FimasartanThe risk or severity of adverse effects can be increased when Fimasartan is combined with Nesiritide.Approved
FosinoprilThe risk or severity of adverse effects can be increased when Fosinopril is combined with Nesiritide.Approved
FurosemideThe risk or severity of adverse effects can be increased when Furosemide is combined with Nesiritide.Approved, Vet Approved
GuanfacineThe risk or severity of adverse effects can be increased when Guanfacine is combined with Nesiritide.Approved, Investigational
HalothaneThe risk or severity of adverse effects can be increased when Halothane is combined with Nesiritide.Approved, Vet Approved
HexobarbitalHexobarbital may increase the hypotensive activities of Nesiritide.Approved
HydralazineThe risk or severity of adverse effects can be increased when Hydralazine is combined with Nesiritide.Approved
HydrochlorothiazideThe risk or severity of adverse effects can be increased when Hydrochlorothiazide is combined with Nesiritide.Approved, Vet Approved
HydroflumethiazideThe risk or severity of adverse effects can be increased when Hydroflumethiazide is combined with Nesiritide.Approved
IloprostThe risk or severity of adverse effects can be increased when Iloprost is combined with Nesiritide.Approved, Investigational
ImidaprilThe risk or severity of adverse effects can be increased when Imidapril is combined with Nesiritide.Investigational
ImipramineThe risk or severity of adverse effects can be increased when Imipramine is combined with Nesiritide.Approved
IndapamideThe risk or severity of adverse effects can be increased when Indapamide is combined with Nesiritide.Approved
IndoraminThe risk or severity of adverse effects can be increased when Indoramin is combined with Nesiritide.Withdrawn
IrbesartanThe risk or severity of adverse effects can be increased when Irbesartan is combined with Nesiritide.Approved, Investigational
IsocarboxazidThe risk or severity of adverse effects can be increased when Isocarboxazid is combined with Nesiritide.Approved
IsofluraneThe risk or severity of adverse effects can be increased when Isoflurane is combined with Nesiritide.Approved, Vet Approved
Isosorbide DinitrateThe risk or severity of adverse effects can be increased when Isosorbide Dinitrate is combined with Nesiritide.Approved
Isosorbide MononitrateThe risk or severity of adverse effects can be increased when Isosorbide Mononitrate is combined with Nesiritide.Approved
IsoxsuprineThe risk or severity of adverse effects can be increased when Nesiritide is combined with Isoxsuprine.Approved, Withdrawn
IsradipineThe risk or severity of adverse effects can be increased when Isradipine is combined with Nesiritide.Approved
LabetalolThe risk or severity of adverse effects can be increased when Labetalol is combined with Nesiritide.Approved
LacidipineThe risk or severity of adverse effects can be increased when Lacidipine is combined with Nesiritide.Approved
LercanidipineThe risk or severity of adverse effects can be increased when Lercanidipine is combined with Nesiritide.Approved, Investigational
LevobunololThe risk or severity of adverse effects can be increased when Levobunolol is combined with Nesiritide.Approved
LevobupivacaineThe risk or severity of adverse effects can be increased when Levobupivacaine is combined with Nesiritide.Approved
LevodopaNesiritide may increase the orthostatic hypotensive activities of Levodopa.Approved
LevosimendanThe risk or severity of adverse effects can be increased when Levosimendan is combined with Nesiritide.Approved, Investigational
LisinoprilThe risk or severity of adverse effects can be increased when Lisinopril is combined with Nesiritide.Approved, Investigational
LofexidineThe risk or severity of adverse effects can be increased when Lofexidine is combined with Nesiritide.Approved, Investigational
LosartanThe risk or severity of adverse effects can be increased when Losartan is combined with Nesiritide.Approved
MannitolThe risk or severity of adverse effects can be increased when Mannitol is combined with Nesiritide.Approved, Investigational
MecamylamineThe risk or severity of adverse effects can be increased when Mecamylamine is combined with Nesiritide.Approved
MethazolamideThe risk or severity of adverse effects can be increased when Methazolamide is combined with Nesiritide.Approved
MethohexitalMethohexital may increase the hypotensive activities of Nesiritide.Approved
MethyclothiazideThe risk or severity of adverse effects can be increased when Methyclothiazide is combined with Nesiritide.Approved
MethyldopaThe risk or severity of adverse effects can be increased when Methyldopa is combined with Nesiritide.Approved
MethylphenobarbitalMethylphenobarbital may increase the hypotensive activities of Nesiritide.Approved
MetipranololThe risk or severity of adverse effects can be increased when Metipranolol is combined with Nesiritide.Approved
MetolazoneThe risk or severity of adverse effects can be increased when Metolazone is combined with Nesiritide.Approved
MetoprololThe risk or severity of adverse effects can be increased when Metoprolol is combined with Nesiritide.Approved, Investigational
MinoxidilThe risk or severity of adverse effects can be increased when Minoxidil is combined with Nesiritide.Approved
MoexiprilThe risk or severity of adverse effects can be increased when Moexipril is combined with Nesiritide.Approved
MorphineThe risk or severity of adverse effects can be increased when Morphine is combined with Nesiritide.Approved, Investigational
MoxonidineThe risk or severity of adverse effects can be increased when Moxonidine is combined with Nesiritide.Approved
NabiloneThe risk or severity of adverse effects can be increased when Nabilone is combined with Nesiritide.Approved, Investigational
NadololThe risk or severity of adverse effects can be increased when Nadolol is combined with Nesiritide.Approved
NebivololThe risk or severity of adverse effects can be increased when Nebivolol is combined with Nesiritide.Approved, Investigational
NicardipineThe risk or severity of adverse effects can be increased when Nicardipine is combined with Nesiritide.Approved
NicorandilNicorandil may increase the hypotensive activities of Nesiritide.Approved
NifedipineThe risk or severity of adverse effects can be increased when Nifedipine is combined with Nesiritide.Approved
NilvadipineThe risk or severity of adverse effects can be increased when Nilvadipine is combined with Nesiritide.Approved
NimodipineThe risk or severity of adverse effects can be increased when Nimodipine is combined with Nesiritide.Approved
NisoldipineThe risk or severity of adverse effects can be increased when Nisoldipine is combined with Nesiritide.Approved
NitrendipineThe risk or severity of adverse effects can be increased when Nitrendipine is combined with Nesiritide.Approved
Nitric OxideThe risk or severity of adverse effects can be increased when Nitric Oxide is combined with Nesiritide.Approved
NitroglycerinThe risk or severity of adverse effects can be increased when Nitroglycerin is combined with Nesiritide.Approved, Investigational
NitroprussideThe risk or severity of adverse effects can be increased when Nitroprusside is combined with Nesiritide.Approved
ObinutuzumabThe risk or severity of adverse effects can be increased when Obinutuzumab is combined with Nesiritide.Approved
OlmesartanThe risk or severity of adverse effects can be increased when Olmesartan is combined with Nesiritide.Approved, Investigational
OxprenololThe risk or severity of adverse effects can be increased when Oxprenolol is combined with Nesiritide.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Nesiritide.Approved, Vet Approved
PapaverineThe risk or severity of adverse effects can be increased when Papaverine is combined with Nesiritide.Approved
PenbutololThe risk or severity of adverse effects can be increased when Penbutolol is combined with Nesiritide.Approved, Investigational
PentobarbitalPentobarbital may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
PerindoprilThe risk or severity of adverse effects can be increased when Perindopril is combined with Nesiritide.Approved
PhenelzineThe risk or severity of adverse effects can be increased when Phenelzine is combined with Nesiritide.Approved
PhenobarbitalPhenobarbital may increase the hypotensive activities of Nesiritide.Approved
PhenoxybenzamineThe risk or severity of adverse effects can be increased when Phenoxybenzamine is combined with Nesiritide.Approved
PhentolamineThe risk or severity of adverse effects can be increased when Phentolamine is combined with Nesiritide.Approved
PindololThe risk or severity of adverse effects can be increased when Pindolol is combined with Nesiritide.Approved
PipamperoneThe risk or severity of adverse effects can be increased when Pipamperone is combined with Nesiritide.Approved
PramipexoleThe risk or severity of adverse effects can be increased when Pramipexole is combined with Nesiritide.Approved, Investigational
PrazosinThe risk or severity of adverse effects can be increased when Prazosin is combined with Nesiritide.Approved
PrimidonePrimidone may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
PropofolThe risk or severity of adverse effects can be increased when Propofol is combined with Nesiritide.Approved, Investigational, Vet Approved
PropranololThe risk or severity of adverse effects can be increased when Propranolol is combined with Nesiritide.Approved, Investigational
QuetiapineThe risk or severity of adverse effects can be increased when Quetiapine is combined with Nesiritide.Approved
QuinaprilThe risk or severity of adverse effects can be increased when Quinapril is combined with Nesiritide.Approved, Investigational
RamiprilThe risk or severity of adverse effects can be increased when Ramipril is combined with Nesiritide.Approved
RasagilineThe risk or severity of adverse effects can be increased when Rasagiline is combined with Nesiritide.Approved
RemifentanilThe risk or severity of adverse effects can be increased when Remifentanil is combined with Nesiritide.Approved
ReserpineThe risk or severity of adverse effects can be increased when Reserpine is combined with Nesiritide.Approved
RiociguatThe risk or severity of adverse effects can be increased when Nesiritide is combined with Riociguat.Approved
RisperidoneNesiritide may increase the hypotensive activities of Risperidone.Approved, Investigational
RopiniroleThe risk or severity of adverse effects can be increased when Ropinirole is combined with Nesiritide.Approved, Investigational
RopivacaineThe risk or severity of adverse effects can be increased when Ropivacaine is combined with Nesiritide.Approved
RotigotineThe risk or severity of adverse effects can be increased when Rotigotine is combined with Nesiritide.Approved
SacubitrilThe risk or severity of adverse effects can be increased when Sacubitril is combined with Nesiritide.Approved
SecobarbitalSecobarbital may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
SelegilineThe risk or severity of adverse effects can be increased when Selegiline is combined with Nesiritide.Approved, Investigational, Vet Approved
SevofluraneThe risk or severity of adverse effects can be increased when Sevoflurane is combined with Nesiritide.Approved, Vet Approved
Sodium NitriteThe risk or severity of adverse effects can be increased when Sodium Nitrite is combined with Nesiritide.Approved
SotalolThe risk or severity of adverse effects can be increased when Sotalol is combined with Nesiritide.Approved
SpironolactoneThe risk or severity of adverse effects can be increased when Spironolactone is combined with Nesiritide.Approved
StreptokinaseThe risk or severity of adverse effects can be increased when Streptokinase is combined with Nesiritide.Approved
SufentanilThe risk or severity of adverse effects can be increased when Sufentanil is combined with Nesiritide.Approved, Investigational
TamsulosinThe risk or severity of adverse effects can be increased when Tamsulosin is combined with Nesiritide.Approved, Investigational
TelmisartanThe risk or severity of adverse effects can be increased when Telmisartan is combined with Nesiritide.Approved, Investigational
TerazosinThe risk or severity of adverse effects can be increased when Terazosin is combined with Nesiritide.Approved
ThalidomideThe risk or severity of adverse effects can be increased when Thalidomide is combined with Nesiritide.Approved, Investigational, Withdrawn
ThiamylalThiamylal may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
ThiopentalThiopental may increase the hypotensive activities of Nesiritide.Approved, Vet Approved
ThioridazineThe risk or severity of adverse effects can be increased when Thioridazine is combined with Nesiritide.Withdrawn
TimololThe risk or severity of adverse effects can be increased when Timolol is combined with Nesiritide.Approved
TizanidineThe risk or severity of adverse effects can be increased when Tizanidine is combined with Nesiritide.Approved
TolazolineThe risk or severity of adverse effects can be increased when Tolazoline is combined with Nesiritide.Approved, Vet Approved
TolcaponeThe risk or severity of adverse effects can be increased when Tolcapone is combined with Nesiritide.Approved, Withdrawn
TorasemideThe risk or severity of adverse effects can be increased when Torasemide is combined with Nesiritide.Approved
TrandolaprilThe risk or severity of adverse effects can be increased when Trandolapril is combined with Nesiritide.Approved
TranylcypromineThe risk or severity of adverse effects can be increased when Tranylcypromine is combined with Nesiritide.Approved
TretinoinThe risk or severity of adverse effects can be increased when Tretinoin is combined with Nesiritide.Approved, Investigational, Nutraceutical
TriamtereneThe risk or severity of adverse effects can be increased when Triamterene is combined with Nesiritide.Approved
ValsartanThe risk or severity of adverse effects can be increased when Valsartan is combined with Nesiritide.Approved, Investigational
VerapamilThe risk or severity of adverse effects can be increased when Verapamil is combined with Nesiritide.Approved
Food Interactions
Not Available

References

Synthesis Reference
Not Available
General References
  1. Jefferies JL, Price JF, Denfield SW, Chang AC, Dreyer WJ, McMahon CJ, Grenier MA, Clunie SK, Thomas A, Moffett BS, Wann TS, Smith EO, Towbin JA: Safety and efficacy of nesiritide in pediatric heart failure. J Card Fail. 2007 Sep;13(7):541-8. [PubMed:17826644 ]
  2. Maisel AS: Nesiritide: a new therapy for the treatment of heart failure. Cardiovasc Toxicol. 2003;3(1):37-42. [PubMed:12668889 ]
  3. Vichiendilokkul A, Tran A, Racine E: Nesiritide: a novel approach for acute heart failure. Ann Pharmacother. 2003 Feb;37(2):247-58. [PubMed:12549957 ]
  4. Cheng JW: Nesiritide: review of clinical pharmacology and role in heart failure management. Heart Dis. 2002 May-Jun;4(3):199-203. [PubMed:12028606 ]
  5. Bettencourt P: Brain natriuretic peptide (nesiritide) in the treatment of heart failure. Cardiovasc Drug Rev. 2002 Winter;20(1):27-36. [PubMed:12070532 ]
External Links
UniProt
P16860
ChEMBL
CHEMBL1201668
Therapeutic Targets Database
DAP001320
PharmGKB
PA164781045
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Nesiritide
ATC Codes
C01DX19 — Nesiritide
AHFS Codes
Not Available
PDB Entries
Not Available
FDA label
Download (205 KB)
MSDS
Not Available

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Not Yet RecruitingNot AvailableBMI >30 kg/m2 / Hyperinsulinemia1
1CompletedBasic ScienceBMI >30 kg/m2 / Cardiovascular Disease (CVD) / Diabetes / Hypertensive1
1TerminatedBasic ScienceCongestive Heart Failure (CHF) / Renal Dysfunction1
1, 2CompletedBasic ScienceAsymptomatic Systolic Dysfunction / Heart Failure, Unspecified1
1, 2CompletedBasic ScienceCongestive Heart Failure (CHF)1
1, 2CompletedBasic ScienceLeft Ventricular Diastolic Dysfunction1
1, 2CompletedPreventionCongestive Heart Failure (CHF)1
1, 2CompletedTreatmentAcute Renal Failure (ARF)1
1, 2CompletedTreatmentCongestive Heart Failure (CHF) / Prophylaxis of cardiomyopathy1
1, 2CompletedTreatmentDiastolic Heart Failure1
1, 2Enrolling by InvitationTreatmentHeart Failure, Unspecified / Renal Dysfunction1
1, 2RecruitingTreatmentHypertensive1
1, 2TerminatedTreatmentCardiopulmonary Bypass / Heart Defects,Congenital1
1, 2TerminatedTreatmentCardiorenal Syndrome1
1, 2TerminatedTreatmentHypertensive1
2CompletedPreventionAcute Myocardial Infarction (AMI)1
2CompletedPreventionCardiopulmonary Bypass / Congestive Heart Failure (CHF) / Coronary Artery Bypass Grafting (CABG) Surgery / Coronary Artery Bypass Surgery / Coronary Heart Disease (CHD) / Ischaemic Heart Diseases1
2CompletedPreventionRenal Failure1
2CompletedTreatmentAcute Heart Failure (AHF)1
2CompletedTreatmentCongestive Heart Failure (CHF)2
2CompletedTreatmentCongestive Heart Failure (CHF) / Impaired Renal Function1
2CompletedTreatmentHeart Failure, Unspecified1
2TerminatedTreatmentHeart Defects,Congenital1
2TerminatedTreatmentHeart Failure, Unspecified1
3CompletedTreatmentCongestive Heart Failure (CHF)2
3CompletedTreatmentCongestive Heart Failure (CHF) / Dyspnea, Paroxysma / Prophylaxis of cardiomyopathy1
3CompletedTreatmentCongestive Heart Failure (CHF) / Heart Decompensation3
3CompletedTreatmentCongestive Heart Failure (CHF) / Kidney Diseases / Prophylaxis of cardiomyopathy1
3CompletedTreatmentCongestive Heart Failure in Acute Coronary Syndrome / Symptomatic Decompensated Congestive Heart Failure1
3CompletedTreatmentHeart Decompensation1
3TerminatedTreatmentHeart Failure, Unspecified1
3Unknown StatusPreventionAcute Renal Failure (ARF) / Cardiovascular Disease (CVD) / Mortality1
3WithdrawnTreatmentCardiopulmonary Bypass / Congestive Heart Failure (CHF) / Coronary Artery Bypass Grafting (CABG) Surgery / Coronary Artery Bypass Surgery / Coronary Heart Disease (CHD) / Ischaemic Heart Diseases1
4CompletedPreventionPulmonary Hypertension (PH)1
4CompletedTreatmentAcute Decompensated Heart Failure (ADHF)1
4CompletedTreatmentChronic Heart Failure (CHF) / Congestive Heart Failure (CHF)1
4CompletedTreatmentCongestive Heart Failure (CHF) / Prophylaxis of cardiomyopathy1
4TerminatedTreatmentAcute Heart Failure (AHF) / Cardiovascular Disease (CVD) / Congestive Heart Failure (CHF) / Diastolic Heart Failure / Heart Diseases / Heart Failure, Unspecified1
4TerminatedTreatmentCancers / Cardiothoracic Surgery / Chronic Lung Diseases / Pulmonary Hypertension (PH)1
4TerminatedTreatmentCardiorenal Syndrome / Congestive Heart Failure (CHF)1
4TerminatedTreatmentCongestive Heart Failure (CHF)2
4Unknown StatusSupportive CareCoronary Artery Disease1
4WithdrawnTreatmentCongestive Heart Failure (CHF) / Dyspnea / Pulmonary Edemas1
Not AvailableCompletedBasic ScienceHigh Blood Pressure1
Not AvailableCompletedDiagnosticSyncope1
Not AvailableCompletedHealth Services ResearchCongestive Heart Failure (CHF)1
Not AvailableCompletedOtherHealthy Volunteers1
Not AvailableCompletedTreatmentCongestive Cardiomyopathy1
Not AvailableCompletedTreatmentHypertensive / Type 2 Diabetes Mellitus1
Not AvailableRecruitingDiagnosticMeningococcal Infections / Severe Sepsis / Shock, Septic1
Not AvailableRecruitingTreatmentCongenital Heart Disease (CHD) / Total Cavo-pulmonary Connection1
Not AvailableWithdrawnOtherHypertensive1
Not AvailableWithdrawnTreatmentHeart Decompensation / Heart Failure, Unspecified / Ventricular Dysfunction1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Injection, powder, lyophilized, for solutionIntravenous1.5 mg/5mL
Powder, for solutionIntravenous1.5 mg
Prices
Unit descriptionCostUnit
Natrecor 1.5 mg vial716.36USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5114923 No1994-05-192014-05-19Us
CA1339210 No1997-08-052014-08-05Canada

Properties

State
Solid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Binder
General Function
Protein kinase activity
Specific Function
Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate ...
Gene Name
NPR1
Uniprot ID
P16066
Uniprot Name
Atrial natriuretic peptide receptor 1
Molecular Weight
118918.11 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.
Gene Name
NPR2
Uniprot ID
P20594
Uniprot Name
Atrial natriuretic peptide receptor 2
Molecular Weight
117020.97 Da
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Peptide hormone binding
Specific Function
Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May ...
Gene Name
NPR3
Uniprot ID
P17342
Uniprot Name
Atrial natriuretic peptide receptor 3
Molecular Weight
59807.34 Da

Drug created on October 21, 2007 16:23 / Updated on August 17, 2016 12:24