Jump to section
IdentificationPharmacologyInteractionsReferencesTrialsEconomicsPropertiesSpectraTaxonomyNesiritide
Identification
- Name
- Nesiritide
- Accession Number
- DB04899
- Type
- Biotech
- Groups
- Approved, Investigational
- Biologic Classification
- Protein Based Therapies
Hormones - Description
Nesiritide is a medication used to treat acutely decompensated congestive heart failure with dyspnea at rest or with minimal exertion (such as talk, eating or bathing). Nesiritide is the recombinant form of the 32 amino acid human B-type natriuretic peptide, which is normally produced by the ventricular myocardium.
- Protein structure
- Protein chemical formula
- Not Available
- Protein average weight
- 3464.0 Da
- Sequences
>DB04899: Natriuretic peptides B SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Download FASTA Format- Synonyms
- BNP
- Brain natriuretic peptide 32
- Natriuretic peptides B
- Nesiritide recombinant
- Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Natrecor Injection, powder, lyophilized, for solution 1.5 mg/5mL Intravenous Scios, Inc. 2001-08-01 Not applicable US 
Natrecor Powder, for solution 1.5 mg Intravenous Janssen Pharmaceuticals 2008-02-05 2012-08-01 Canada 
- Categories
- Amino Acids, Peptides, and Proteins
- Cardiac Therapy
- Cardiovascular Agents
- Cardiovascular System
- Hormones
- Hormones, Hormone Substitutes, and Hormone Antagonists
- Hypotensive Agents
- Natriuretic Agents
- Natriuretic Peptides
- Nerve Tissue Proteins
- Peptide Hormones
- Peptides
- Proteins
- Vasodilators Used in Cardiac Diseases
- UNII
- P7WI8UL647
- CAS number
- 124584-08-3
Pharmacology
- Indication
For the intravenous treatment of patients with acutely decompensated congestive heart failure who have dyspnea at rest or with minimal activity.
- Associated Conditions
- Pharmacodynamics
Nesiritide works to facilitate cardiovascular fluid homeostasis through counterregulation of the renin-angiotensin-aldoesterone system, stimulating cyclic guanosine monophosphate, leading to smooth muscle cell relaxation. In simpler terms, it promotes vasodilation, natriuresis, and diuresis.
- Mechanism of action
Human BNP binds to the particulate guanylate cyclase receptor of vascular smooth muscle and endothelial cells, leading to increased intracellular concentrations of guanosine 3'5'-cyclic monophosphate (cGMP) and smooth muscle cell relaxation. Cyclic GMP serves as a second messenger to dilate veins and arteries. Nesiritide has been shown to relax isolated human arterial and venous tissue preparations that were precontracted with either endothelin-1 or the alpha-adrenergic agonist, phenylephrine. In human studies, nesiritide produced dose-dependent reductions in pulmonary capillary wedge pressure (PCWP) and systemic arterial pressure in patients with heart failure. In animals, nesiritide had no effects on cardiac contractility or on measures of cardiac electrophysiology such as atrial and ventricular effective refractory times or atrioventricular node conduction. Naturally occurring atrial natriuretic peptide (ANP), a related peptide, increases vascular permeability in animals and humans and may reduce intravascular volume. The effect of nesiritide on vascular permeability has not been studied.
Target Actions Organism UAtrial natriuretic peptide receptor 1 binderHuman UAtrial natriuretic peptide receptor 2 Not Available Human UAtrial natriuretic peptide receptor 3 Not Available Human - Absorption
Administration of nesiritide exhibits biphasic disposition from the plasma.
- Volume of distribution
- 0.19 L/kg
- Protein binding
- Not Available
- Metabolism
Nesiritide undergoes proteolytic cleavage of the peptide by endopeptidases, such as neutral endopeptidase, which are present on the vascular lumenal surface.
- Route of elimination
Human BNP is cleared from the circulation via the following three independent mechanisms, in order of decreasing importance: 1) binding to cell surface clearance receptors with subsequent cellular internalization and lysosomal proteolysis; 2) proteolytic cleavage of the peptide by endopeptidases, such as neutral endopeptidase, which are present on the vascular lumenal surface; and 3) renal filtration.
- Half life
Approximately 18 minutes
- Clearance
- 9.2 mL/min/k [patients with congestive heart failure receiving IV infusion]
- Toxicity
No data are available with respect to overdosage in humans. The expected reaction would be excessive hypotension, which should be treated with drug discontinuation or reduction and appropriate measures.
- Affected organisms
- Humans and other mammals
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
Drug Interaction Drug group Acebutolol The risk or severity of adverse effects can be increased when Acebutolol is combined with Nesiritide. Approved, Investigational Aldesleukin The risk or severity of adverse effects can be increased when Aldesleukin is combined with Nesiritide. Approved Aliskiren The risk or severity of adverse effects can be increased when Nesiritide is combined with Aliskiren. Approved, Investigational Amifostine The risk or severity of adverse effects can be increased when Amifostine is combined with Nesiritide. Approved, Investigational Amiloride The risk or severity of adverse effects can be increased when Amiloride is combined with Nesiritide. Approved Amiodarone The risk or severity of adverse effects can be increased when Amiodarone is combined with Nesiritide. Approved, Investigational Amlodipine The risk or severity of adverse effects can be increased when Amlodipine is combined with Nesiritide. Approved Amobarbital Amobarbital may increase the hypotensive activities of Nesiritide. Approved, Illicit Amphotericin B The risk or severity of adverse effects can be increased when Amphotericin B is combined with Nesiritide. Approved, Investigational Amyl Nitrite The risk or severity of adverse effects can be increased when Amyl Nitrite is combined with Nesiritide. Approved Apomorphine The risk or severity of adverse effects can be increased when Apomorphine is combined with Nesiritide. Approved, Investigational Apraclonidine The risk or severity of adverse effects can be increased when Apraclonidine is combined with Nesiritide. Approved Aripiprazole Aripiprazole may increase the hypotensive activities of Nesiritide. Approved, Investigational Arotinolol The risk or severity of adverse effects can be increased when Arotinolol is combined with Nesiritide. Investigational Arsenic trioxide The risk or severity of adverse effects can be increased when Arsenic trioxide is combined with Nesiritide. Approved, Investigational Atenolol The risk or severity of adverse effects can be increased when Atenolol is combined with Nesiritide. Approved Azilsartan medoxomil The risk or severity of adverse effects can be increased when Nesiritide is combined with Azilsartan medoxomil. Approved, Investigational Barbexaclone Barbexaclone may increase the hypotensive activities of Nesiritide. Experimental Barbital Barbital may increase the hypotensive activities of Nesiritide. Illicit Barnidipine The risk or severity of adverse effects can be increased when Barnidipine is combined with Nesiritide. Approved Benazepril The risk or severity of adverse effects can be increased when Benazepril is combined with Nesiritide. Approved, Investigational Bendroflumethiazide The risk or severity of adverse effects can be increased when Bendroflumethiazide is combined with Nesiritide. Approved Bepridil The risk or severity of adverse effects can be increased when Bepridil is combined with Nesiritide. Approved, Withdrawn Betaxolol The risk or severity of adverse effects can be increased when Betaxolol is combined with Nesiritide. Approved, Investigational Bisoprolol The risk or severity of adverse effects can be increased when Bisoprolol is combined with Nesiritide. Approved Bortezomib The risk or severity of adverse effects can be increased when Bortezomib is combined with Nesiritide. Approved, Investigational Bretylium The risk or severity of adverse effects can be increased when Bretylium is combined with Nesiritide. Approved Brimonidine The risk or severity of adverse effects can be increased when Brimonidine is combined with Nesiritide. Approved Bromocriptine The risk or severity of adverse effects can be increased when Bromocriptine is combined with Nesiritide. Approved, Investigational Bumetanide The risk or severity of adverse effects can be increased when Bumetanide is combined with Nesiritide. Approved Bupivacaine The risk or severity of adverse effects can be increased when Bupivacaine is combined with Nesiritide. Approved, Investigational Canagliflozin The risk or severity of adverse effects can be increased when Nesiritide is combined with Canagliflozin. Approved Candesartan cilexetil The risk or severity of adverse effects can be increased when Candesartan cilexetil is combined with Nesiritide. Approved Captopril The risk or severity of adverse effects can be increased when Captopril is combined with Nesiritide. Approved Carbetocin The risk or severity of adverse effects can be increased when Carbetocin is combined with Nesiritide. Approved, Investigational Carteolol The risk or severity of adverse effects can be increased when Carteolol is combined with Nesiritide. Approved Carvedilol The risk or severity of adverse effects can be increased when Carvedilol is combined with Nesiritide. Approved, Investigational Chlorothiazide The risk or severity of adverse effects can be increased when Chlorothiazide is combined with Nesiritide. Approved, Vet Approved Chlorpromazine The risk or severity of adverse effects can be increased when Chlorpromazine is combined with Nesiritide. Approved, Investigational, Vet Approved Chlorthalidone The risk or severity of adverse effects can be increased when Chlorthalidone is combined with Nesiritide. Approved Cilazapril The risk or severity of adverse effects can be increased when Cilazapril is combined with Nesiritide. Approved Cilnidipine The risk or severity of adverse effects can be increased when Cilnidipine is combined with Nesiritide. Approved, Investigational Clevidipine The risk or severity of adverse effects can be increased when Nesiritide is combined with Clevidipine. Approved, Investigational Clofarabine The risk or severity of adverse effects can be increased when Clofarabine is combined with Nesiritide. Approved, Investigational Clomipramine The risk or severity of adverse effects can be increased when Clomipramine is combined with Nesiritide. Approved, Investigational, Vet Approved Clonidine The risk or severity of adverse effects can be increased when Clonidine is combined with Nesiritide. Approved Clozapine The risk or severity of adverse effects can be increased when Clozapine is combined with Nesiritide. Approved Conivaptan The risk or severity of adverse effects can be increased when Conivaptan is combined with Nesiritide. Approved, Investigational Dapagliflozin The risk or severity of adverse effects can be increased when Nesiritide is combined with Dapagliflozin. Approved Desflurane The risk or severity of adverse effects can be increased when Desflurane is combined with Nesiritide. Approved Dexmedetomidine The risk or severity of adverse effects can be increased when Dexmedetomidine is combined with Nesiritide. Approved, Vet Approved Diclofenamide The risk or severity of adverse effects can be increased when Diclofenamide is combined with Nesiritide. Approved, Investigational Diltiazem The risk or severity of adverse effects can be increased when Diltiazem is combined with Nesiritide. Approved, Investigational Dinutuximab The risk or severity of adverse effects can be increased when Nesiritide is combined with Dinutuximab. Approved, Investigational Dipyridamole The risk or severity of adverse effects can be increased when Dipyridamole is combined with Nesiritide. Approved Doxazosin The risk or severity of adverse effects can be increased when Doxazosin is combined with Nesiritide. Approved Duloxetine Nesiritide may increase the orthostatic hypotensive activities of Duloxetine. Approved Efonidipine The risk or severity of adverse effects can be increased when Efonidipine is combined with Nesiritide. Approved, Investigational Empagliflozin The risk or severity of adverse effects can be increased when Nesiritide is combined with Empagliflozin. Approved Enalapril The risk or severity of adverse effects can be increased when Enalapril is combined with Nesiritide. Approved, Vet Approved Enalaprilat The risk or severity of adverse effects can be increased when Enalaprilat is combined with Nesiritide. Approved Eplerenone The risk or severity of adverse effects can be increased when Eplerenone is combined with Nesiritide. Approved Epoprostenol The risk or severity of adverse effects can be increased when Epoprostenol is combined with Nesiritide. Approved Eprosartan The risk or severity of adverse effects can be increased when Eprosartan is combined with Nesiritide. Approved Esmolol The risk or severity of adverse effects can be increased when Esmolol is combined with Nesiritide. Approved Etacrynic acid The risk or severity of adverse effects can be increased when Etacrynic acid is combined with Nesiritide. Approved, Investigational Felodipine The risk or severity of adverse effects can be increased when Felodipine is combined with Nesiritide. Approved, Investigational Fenoldopam The risk or severity of adverse effects can be increased when Fenoldopam is combined with Nesiritide. Approved Fimasartan The risk or severity of adverse effects can be increased when Fimasartan is combined with Nesiritide. Approved, Investigational Fosinopril The risk or severity of adverse effects can be increased when Fosinopril is combined with Nesiritide. Approved Furosemide The risk or severity of adverse effects can be increased when Furosemide is combined with Nesiritide. Approved, Vet Approved Guanfacine The risk or severity of adverse effects can be increased when Guanfacine is combined with Nesiritide. Approved, Investigational Halothane The risk or severity of adverse effects can be increased when Halothane is combined with Nesiritide. Approved, Vet Approved Hexobarbital Hexobarbital may increase the hypotensive activities of Nesiritide. Approved Hydralazine The risk or severity of adverse effects can be increased when Hydralazine is combined with Nesiritide. Approved Hydrochlorothiazide The risk or severity of adverse effects can be increased when Hydrochlorothiazide is combined with Nesiritide. Approved, Vet Approved Hydroflumethiazide The risk or severity of adverse effects can be increased when Hydroflumethiazide is combined with Nesiritide. Approved, Investigational Iloprost The risk or severity of adverse effects can be increased when Iloprost is combined with Nesiritide. Approved, Investigational Imidapril The risk or severity of adverse effects can be increased when Imidapril is combined with Nesiritide. Investigational Imipramine The risk or severity of adverse effects can be increased when Imipramine is combined with Nesiritide. Approved Indapamide The risk or severity of adverse effects can be increased when Indapamide is combined with Nesiritide. Approved Indoramin The risk or severity of adverse effects can be increased when Indoramin is combined with Nesiritide. Withdrawn Irbesartan The risk or severity of adverse effects can be increased when Irbesartan is combined with Nesiritide. Approved, Investigational Isocarboxazid The risk or severity of adverse effects can be increased when Isocarboxazid is combined with Nesiritide. Approved Isoflurane The risk or severity of adverse effects can be increased when Isoflurane is combined with Nesiritide. Approved, Vet Approved Isosorbide Dinitrate The risk or severity of adverse effects can be increased when Isosorbide Dinitrate is combined with Nesiritide. Approved, Investigational Isosorbide Mononitrate The risk or severity of adverse effects can be increased when Isosorbide Mononitrate is combined with Nesiritide. Approved Isoxsuprine The risk or severity of adverse effects can be increased when Nesiritide is combined with Isoxsuprine. Approved, Withdrawn Isradipine The risk or severity of adverse effects can be increased when Isradipine is combined with Nesiritide. Approved, Investigational Labetalol The risk or severity of adverse effects can be increased when Labetalol is combined with Nesiritide. Approved Lacidipine Nesiritide may increase the hypotensive activities of Lacidipine. Approved, Investigational Lercanidipine The risk or severity of adverse effects can be increased when Lercanidipine is combined with Nesiritide. Approved, Investigational Levobunolol The risk or severity of adverse effects can be increased when Levobunolol is combined with Nesiritide. Approved Levobupivacaine The risk or severity of adverse effects can be increased when Levobupivacaine is combined with Nesiritide. Approved, Investigational Levodopa Nesiritide may increase the orthostatic hypotensive activities of Levodopa. Approved Levosimendan The risk or severity of adverse effects can be increased when Levosimendan is combined with Nesiritide. Approved, Investigational Lisinopril The risk or severity of adverse effects can be increased when Lisinopril is combined with Nesiritide. Approved, Investigational Lofexidine The risk or severity of adverse effects can be increased when Lofexidine is combined with Nesiritide. Approved, Investigational Losartan The risk or severity of adverse effects can be increased when Losartan is combined with Nesiritide. Approved Mannitol The risk or severity of adverse effects can be increased when Mannitol is combined with Nesiritide. Approved, Investigational Mecamylamine The risk or severity of adverse effects can be increased when Mecamylamine is combined with Nesiritide. Approved, Investigational Methazolamide The risk or severity of adverse effects can be increased when Methazolamide is combined with Nesiritide. Approved Methohexital Methohexital may increase the hypotensive activities of Nesiritide. Approved Methyclothiazide The risk or severity of adverse effects can be increased when Methyclothiazide is combined with Nesiritide. Approved Methyldopa The risk or severity of adverse effects can be increased when Methyldopa is combined with Nesiritide. Approved Methylphenobarbital Methylphenobarbital may increase the hypotensive activities of Nesiritide. Approved Metipranolol The risk or severity of adverse effects can be increased when Metipranolol is combined with Nesiritide. Approved Metolazone The risk or severity of adverse effects can be increased when Metolazone is combined with Nesiritide. Approved Metoprolol The risk or severity of adverse effects can be increased when Metoprolol is combined with Nesiritide. Approved, Investigational Minoxidil The risk or severity of adverse effects can be increased when Minoxidil is combined with Nesiritide. Approved, Investigational Moexipril The risk or severity of adverse effects can be increased when Moexipril is combined with Nesiritide. Approved Morphine The risk or severity of adverse effects can be increased when Morphine is combined with Nesiritide. Approved, Investigational Moxonidine The risk or severity of adverse effects can be increased when Moxonidine is combined with Nesiritide. Approved, Investigational Nabilone The risk or severity of adverse effects can be increased when Nabilone is combined with Nesiritide. Approved, Investigational Nadolol The risk or severity of adverse effects can be increased when Nadolol is combined with Nesiritide. Approved Nebivolol The risk or severity of adverse effects can be increased when Nebivolol is combined with Nesiritide. Approved, Investigational Nicardipine The risk or severity of adverse effects can be increased when Nicardipine is combined with Nesiritide. Approved, Investigational Nicorandil Nicorandil may increase the hypotensive activities of Nesiritide. Approved, Investigational Nifedipine The risk or severity of adverse effects can be increased when Nifedipine is combined with Nesiritide. Approved Nilvadipine The risk or severity of adverse effects can be increased when Nilvadipine is combined with Nesiritide. Approved, Investigational Nimodipine The risk or severity of adverse effects can be increased when Nimodipine is combined with Nesiritide. Approved, Investigational Nisoldipine The risk or severity of adverse effects can be increased when Nisoldipine is combined with Nesiritide. Approved Nitrendipine The risk or severity of adverse effects can be increased when Nitrendipine is combined with Nesiritide. Approved, Investigational Nitric Oxide The risk or severity of adverse effects can be increased when Nitric Oxide is combined with Nesiritide. Approved Nitroglycerin The risk or severity of adverse effects can be increased when Nitroglycerin is combined with Nesiritide. Approved, Investigational Nitroprusside The risk or severity of adverse effects can be increased when Nitroprusside is combined with Nesiritide. Approved, Investigational Nitrous acid The risk or severity of adverse effects can be increased when Nitrous acid is combined with Nesiritide. Approved, Investigational Obinutuzumab The risk or severity of adverse effects can be increased when Obinutuzumab is combined with Nesiritide. Approved, Investigational Olmesartan The risk or severity of adverse effects can be increased when Olmesartan is combined with Nesiritide. Approved, Investigational Oxprenolol The risk or severity of adverse effects can be increased when Oxprenolol is combined with Nesiritide. Approved Paclitaxel The risk or severity of adverse effects can be increased when Paclitaxel is combined with Nesiritide. Approved, Vet Approved Papaverine The risk or severity of adverse effects can be increased when Papaverine is combined with Nesiritide. Approved, Investigational Penbutolol The risk or severity of adverse effects can be increased when Penbutolol is combined with Nesiritide. Approved, Investigational Pentobarbital Pentobarbital may increase the hypotensive activities of Nesiritide. Approved, Investigational, Vet Approved Perindopril The risk or severity of adverse effects can be increased when Perindopril is combined with Nesiritide. Approved Phenelzine The risk or severity of adverse effects can be increased when Phenelzine is combined with Nesiritide. Approved Phenobarbital Phenobarbital may increase the hypotensive activities of Nesiritide. Approved, Investigational Phenoxybenzamine The risk or severity of adverse effects can be increased when Phenoxybenzamine is combined with Nesiritide. Approved Phentolamine The risk or severity of adverse effects can be increased when Phentolamine is combined with Nesiritide. Approved Pindolol The risk or severity of adverse effects can be increased when Pindolol is combined with Nesiritide. Approved, Investigational Pipamperone The risk or severity of adverse effects can be increased when Pipamperone is combined with Nesiritide. Approved, Investigational Pramipexole The risk or severity of adverse effects can be increased when Pramipexole is combined with Nesiritide. Approved, Investigational Prazosin The risk or severity of adverse effects can be increased when Prazosin is combined with Nesiritide. Approved Primidone Primidone may increase the hypotensive activities of Nesiritide. Approved, Vet Approved Propofol The risk or severity of adverse effects can be increased when Propofol is combined with Nesiritide. Approved, Investigational, Vet Approved Propranolol The risk or severity of adverse effects can be increased when Propranolol is combined with Nesiritide. Approved, Investigational Quetiapine The risk or severity of adverse effects can be increased when Quetiapine is combined with Nesiritide. Approved Quinapril The risk or severity of adverse effects can be increased when Quinapril is combined with Nesiritide. Approved, Investigational Ramipril The risk or severity of adverse effects can be increased when Ramipril is combined with Nesiritide. Approved Rasagiline The risk or severity of adverse effects can be increased when Rasagiline is combined with Nesiritide. Approved Remifentanil The risk or severity of adverse effects can be increased when Remifentanil is combined with Nesiritide. Approved Reserpine The risk or severity of adverse effects can be increased when Reserpine is combined with Nesiritide. Approved, Investigational Riociguat The risk or severity of adverse effects can be increased when Nesiritide is combined with Riociguat. Approved Risperidone Nesiritide may increase the hypotensive activities of Risperidone. Approved, Investigational Ropinirole The risk or severity of adverse effects can be increased when Ropinirole is combined with Nesiritide. Approved, Investigational Ropivacaine The risk or severity of adverse effects can be increased when Ropivacaine is combined with Nesiritide. Approved Rotigotine The risk or severity of adverse effects can be increased when Rotigotine is combined with Nesiritide. Approved Sacubitril The risk or severity of adverse effects can be increased when Sacubitril is combined with Nesiritide. Approved Secobarbital Secobarbital may increase the hypotensive activities of Nesiritide. Approved, Vet Approved Selegiline The risk or severity of adverse effects can be increased when Selegiline is combined with Nesiritide. Approved, Investigational, Vet Approved Sevoflurane The risk or severity of adverse effects can be increased when Sevoflurane is combined with Nesiritide. Approved, Vet Approved Sotalol The risk or severity of adverse effects can be increased when Sotalol is combined with Nesiritide. Approved Spironolactone The risk or severity of adverse effects can be increased when Spironolactone is combined with Nesiritide. Approved Streptokinase The risk or severity of adverse effects can be increased when Streptokinase is combined with Nesiritide. Approved, Investigational Sufentanil The risk or severity of adverse effects can be increased when Sufentanil is combined with Nesiritide. Approved, Investigational Tamsulosin The risk or severity of adverse effects can be increased when Tamsulosin is combined with Nesiritide. Approved, Investigational Telmisartan The risk or severity of adverse effects can be increased when Telmisartan is combined with Nesiritide. Approved, Investigational Terazosin The risk or severity of adverse effects can be increased when Terazosin is combined with Nesiritide. Approved Thalidomide The risk or severity of adverse effects can be increased when Thalidomide is combined with Nesiritide. Approved, Investigational, Withdrawn Thiamylal Thiamylal may increase the hypotensive activities of Nesiritide. Approved, Vet Approved Thiopental Thiopental may increase the hypotensive activities of Nesiritide. Approved, Vet Approved Thioridazine The risk or severity of adverse effects can be increased when Thioridazine is combined with Nesiritide. Approved, Withdrawn Timolol The risk or severity of adverse effects can be increased when Timolol is combined with Nesiritide. Approved Tizanidine The risk or severity of adverse effects can be increased when Tizanidine is combined with Nesiritide. Approved, Investigational Tolazoline The risk or severity of adverse effects can be increased when Tolazoline is combined with Nesiritide. Approved, Vet Approved Tolcapone The risk or severity of adverse effects can be increased when Tolcapone is combined with Nesiritide. Approved, Withdrawn Torasemide The risk or severity of adverse effects can be increased when Torasemide is combined with Nesiritide. Approved Trandolapril The risk or severity of adverse effects can be increased when Trandolapril is combined with Nesiritide. Approved Tranylcypromine The risk or severity of adverse effects can be increased when Tranylcypromine is combined with Nesiritide. Approved, Investigational Tretinoin The risk or severity of adverse effects can be increased when Tretinoin is combined with Nesiritide. Approved, Investigational, Nutraceutical Triamterene The risk or severity of adverse effects can be increased when Triamterene is combined with Nesiritide. Approved Valsartan The risk or severity of adverse effects can be increased when Valsartan is combined with Nesiritide. Approved, Investigational Verapamil The risk or severity of adverse effects can be increased when Verapamil is combined with Nesiritide. Approved - Food Interactions
- Not Available
References
- General References
- Jefferies JL, Price JF, Denfield SW, Chang AC, Dreyer WJ, McMahon CJ, Grenier MA, Clunie SK, Thomas A, Moffett BS, Wann TS, Smith EO, Towbin JA: Safety and efficacy of nesiritide in pediatric heart failure. J Card Fail. 2007 Sep;13(7):541-8. [PubMed:17826644]
- Maisel AS: Nesiritide: a new therapy for the treatment of heart failure. Cardiovasc Toxicol. 2003;3(1):37-42. [PubMed:12668889]
- Vichiendilokkul A, Tran A, Racine E: Nesiritide: a novel approach for acute heart failure. Ann Pharmacother. 2003 Feb;37(2):247-58. [PubMed:12549957]
- Cheng JW: Nesiritide: review of clinical pharmacology and role in heart failure management. Heart Dis. 2002 May-Jun;4(3):199-203. [PubMed:12028606]
- Bettencourt P: Brain natriuretic peptide (nesiritide) in the treatment of heart failure. Cardiovasc Drug Rev. 2002 Winter;20(1):27-36. [PubMed:12070532]
- External Links
- UniProt
- P16860
- PubChem Substance
- 46508506
- ChEMBL
- CHEMBL1201668
- Therapeutic Targets Database
- DAP001320
- PharmGKB
- PA164781045
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Nesiritide
- ATC Codes
- C01DX19 — Nesiritide
- FDA label
- Download (205 KB)
Clinical Trials
- Clinical Trials
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Janssen-Ortho Inc.
- Scios Inc.
- Dosage forms
Form Route Strength Injection, powder, lyophilized, for solution Intravenous 1.5 mg/5mL Powder, for solution Intravenous 1.5 mg - Prices
Unit description Cost Unit Natrecor 1.5 mg vial 716.36USD vial DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
Patent Number Pediatric Extension Approved Expires (estimated) US5114923 No 1994-05-19 2014-05-19 US CA1339210 No 1997-08-05 2014-08-05 Canada
Properties
- State
- Solid
- Experimental Properties
- Not Available
Taxonomy
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
Targets
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- Actions
- Binder
- General Function
- Protein kinase activity
- Specific Function
- Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate ...
- Gene Name
- NPR1
- Uniprot ID
- P16066
- Uniprot Name
- Atrial natriuretic peptide receptor 1
- Molecular Weight
- 118918.11 Da
References
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Transmembrane signaling receptor activity
- Specific Function
- Receptor for the C-type natriuretic peptide NPPC/CNP hormone. Has guanylate cyclase activity upon binding of its ligand. May play a role in the regulation of skeletal growth.
- Gene Name
- NPR2
- Uniprot ID
- P20594
- Uniprot Name
- Atrial natriuretic peptide receptor 2
- Molecular Weight
- 117020.97 Da
- Kind
- Protein
- Organism
- Human
- Pharmacological action
- Unknown
- General Function
- Peptide hormone binding
- Specific Function
- Receptor for the natriuretic peptide hormones, binding with similar affinities atrial natriuretic peptide NPPA/ANP, brain natriuretic peptide NPPB/BNP, and C-type natriuretic peptide NPPC/CNP. May ...
- Gene Name
- NPR3
- Uniprot ID
- P17342
- Uniprot Name
- Atrial natriuretic peptide receptor 3
- Molecular Weight
- 59807.34 Da
Drug created on October 21, 2007 16:23 / Updated on June 02, 2018 07:36